BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049C05

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP18035.1|  unnamed protein product                                349   3e-114   Coffea canephora [robusta coffee]
gb|AFK79031.1|  cytochrome P450 CYP736A54                               338   6e-110   Bupleurum chinense
emb|CDP12931.1|  unnamed protein product                                342   1e-106   Coffea canephora [robusta coffee]
ref|XP_006363549.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    330   1e-106   Solanum tuberosum [potatoes]
dbj|BAP15886.1|  cytochrome P450 71AU50                                 325   9e-105   Prunus mume [ume]
ref|XP_009770873.1|  PREDICTED: cytochrome P450 CYP736A12-like          324   2e-104   Nicotiana sylvestris
ref|XP_009586899.1|  PREDICTED: cytochrome P450 CYP736A12-like          323   2e-104   Nicotiana tomentosiformis
ref|XP_008227094.1|  PREDICTED: cytochrome P450 CYP736A12-like          323   3e-104   
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg             323   3e-104   Prunus persica
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             323   4e-104   Prunus persica
ref|XP_004304846.1|  PREDICTED: cytochrome P450 CYP736A12-like          323   5e-104   Fragaria vesca subsp. vesca
ref|XP_009802012.1|  PREDICTED: cytochrome P450 CYP736A12-like          323   6e-104   Nicotiana sylvestris
ref|XP_004236729.1|  PREDICTED: cytochrome P450 CYP736A12-like          322   1e-103   Solanum lycopersicum
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          321   2e-103   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               320   3e-103   Vitis vinifera
ref|XP_009607201.1|  PREDICTED: cytochrome P450 CYP736A12-like          320   8e-103   Nicotiana tomentosiformis
ref|XP_007212357.1|  hypothetical protein PRUPE_ppa014572mg             319   1e-102   Prunus persica
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          319   1e-102   Prunus mume [ume]
ref|XP_006354708.1|  PREDICTED: flavonoid 3'-monooxygenase-like         318   2e-102   Solanum tuberosum [potatoes]
ref|XP_011078642.1|  PREDICTED: cytochrome P450 CYP736A12-like          319   2e-102   Sesamum indicum [beniseed]
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like          318   3e-102   Prunus mume [ume]
ref|XP_009600860.1|  PREDICTED: cytochrome P450 CYP736A12-like          318   3e-102   Nicotiana tomentosiformis
ref|XP_006346716.1|  PREDICTED: cytochrome P450 71A1-like               318   4e-102   Solanum tuberosum [potatoes]
ref|XP_004237154.1|  PREDICTED: cytochrome P450 CYP736A12-like          317   5e-102   
ref|XP_009607200.1|  PREDICTED: cytochrome P450 CYP736A12-like          317   1e-101   
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             316   2e-101   Citrus clementina [clementine]
ref|XP_011100884.1|  PREDICTED: cytochrome P450 CYP736A12-like          316   2e-101   Sesamum indicum [beniseed]
ref|XP_011100886.1|  PREDICTED: cytochrome P450 CYP736A12-like          316   3e-101   Sesamum indicum [beniseed]
ref|XP_010099912.1|  Cytochrome P450 71A1                               315   3e-101   Morus notabilis
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             315   5e-101   Prunus persica
ref|XP_009767392.1|  PREDICTED: cytochrome P450 CYP736A12-like          315   7e-101   Nicotiana sylvestris
ref|XP_004237435.1|  PREDICTED: cytochrome P450 CYP736A12-like          315   7e-101   Solanum lycopersicum
ref|XP_006365792.1|  PREDICTED: cytochrome P450 71A1-like               314   1e-100   Solanum tuberosum [potatoes]
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         314   1e-100   Jatropha curcas
emb|CDP12853.1|  unnamed protein product                                312   1e-100   Coffea canephora [robusta coffee]
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             313   3e-100   Populus trichocarpa [western balsam poplar]
ref|XP_006354707.1|  PREDICTED: cytochrome P450 71A1-like               308   8e-100   Solanum tuberosum [potatoes]
gb|EYU24031.1|  hypothetical protein MIMGU_mgv1a004909mg                311   1e-99    Erythranthe guttata [common monkey flower]
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          311   2e-99    Populus euphratica
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          311   2e-99    Pyrus x bretschneideri [bai li]
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    311   2e-99    Populus euphratica
ref|XP_002310014.1|  cytochrome P450 family protein                     311   2e-99    
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             311   2e-99    
ref|XP_010319819.1|  PREDICTED: cytochrome P450 CYP736A12-like          303   4e-99    Solanum lycopersicum
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          310   4e-99    Cucumis melo [Oriental melon]
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          310   6e-99    Eucalyptus grandis [rose gum]
ref|XP_006354701.1|  PREDICTED: cytochrome P450 84A1-like               309   1e-98    Solanum tuberosum [potatoes]
gb|AJD25258.1|  cytochrome P450 CYP736A123                              308   1e-98    Salvia miltiorrhiza [Chinese salvia]
ref|XP_002310015.1|  cytochrome P450 family protein                     308   1e-98    
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             308   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_004253509.1|  PREDICTED: cytochrome P450 CYP736A12-like          308   2e-98    Solanum lycopersicum
ref|XP_006348217.1|  PREDICTED: cytochrome P450 71A1-like               308   2e-98    Solanum tuberosum [potatoes]
ref|XP_009608339.1|  PREDICTED: cytochrome P450 CYP736A12-like          308   2e-98    Nicotiana tomentosiformis
gb|KDO35964.1|  hypothetical protein CISIN_1g036473mg                   298   3e-98    Citrus sinensis [apfelsine]
gb|AJD25256.1|  cytochrome P450 CYP736A121                              306   1e-97    Salvia miltiorrhiza [Chinese salvia]
emb|CBI21487.3|  unnamed protein product                                309   1e-97    Vitis vinifera
ref|XP_008364815.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    306   1e-97    
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               306   1e-97    Vitis vinifera
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          306   2e-97    Prunus mume [ume]
emb|CDP01387.1|  unnamed protein product                                305   3e-97    Coffea canephora [robusta coffee]
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             305   4e-97    Prunus persica
ref|XP_006493869.1|  PREDICTED: cytochrome P450 71A1-like               295   4e-97    
gb|EYU24035.1|  hypothetical protein MIMGU_mgv1a020942mg                305   4e-97    Erythranthe guttata [common monkey flower]
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          305   7e-97    Cucumis melo [Oriental melon]
ref|XP_009615258.1|  PREDICTED: cytochrome P450 CYP736A12-like          304   1e-96    Nicotiana tomentosiformis
ref|XP_009629564.1|  PREDICTED: cytochrome P450 CYP736A12-like          301   1e-96    
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             303   1e-96    Citrus clementina [clementine]
ref|XP_002310007.2|  cytochrome P450 family protein                     303   1e-96    Populus trichocarpa [western balsam poplar]
emb|CDP12933.1|  unnamed protein product                                303   2e-96    Coffea canephora [robusta coffee]
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g             303   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_004162327.1|  PREDICTED: cytochrome P450 71A1-like               303   2e-96    
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  303   2e-96    
ref|XP_004143568.1|  PREDICTED: cytochrome P450 71A1-like               303   3e-96    
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          303   3e-96    Eucalyptus grandis [rose gum]
ref|XP_009770688.1|  PREDICTED: cytochrome P450 CYP736A12-like          303   3e-96    Nicotiana sylvestris
emb|CDP01384.1|  unnamed protein product                                302   4e-96    Coffea canephora [robusta coffee]
ref|XP_007048087.1|  Cytochrome P450                                    303   5e-96    
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         301   1e-95    Morus notabilis
ref|XP_006493867.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    301   1e-95    
ref|XP_006428066.1|  hypothetical protein CICLE_v10025445mg             301   1e-95    Citrus clementina [clementine]
ref|XP_006354704.1|  PREDICTED: cytochrome P450 750A1-like              301   2e-95    Solanum tuberosum [potatoes]
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             300   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_006365795.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    300   2e-95    Solanum tuberosum [potatoes]
ref|XP_004237505.1|  PREDICTED: cytochrome P450 CYP736A12-like          300   4e-95    Solanum lycopersicum
ref|XP_004162313.1|  PREDICTED: cytochrome P450 71A1-like               300   4e-95    
ref|XP_004143567.1|  PREDICTED: cytochrome P450 71A1-like               295   4e-95    
gb|EYU31074.1|  hypothetical protein MIMGU_mgv1a005121mg                300   5e-95    Erythranthe guttata [common monkey flower]
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          299   5e-95    Cucumis melo [Oriental melon]
ref|XP_006354722.1|  PREDICTED: cytochrome P450 71A1-like               299   6e-95    Solanum tuberosum [potatoes]
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          299   8e-95    Eucalyptus grandis [rose gum]
ref|XP_004237617.1|  PREDICTED: cytochrome P450 CYP736A12-like          299   8e-95    Solanum lycopersicum
ref|XP_011090597.1|  PREDICTED: cytochrome P450 CYP736A12-like          298   1e-94    Sesamum indicum [beniseed]
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   298   1e-94    Vitis arizonica x Vitis rupestris
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   298   1e-94    Vitis arizonica x Vitis rupestris
ref|XP_008364814.1|  PREDICTED: cytochrome P450 CYP736A12-like          298   2e-94    Malus domestica [apple tree]
ref|XP_009631573.1|  PREDICTED: cytochrome P450 CYP736A12-like          289   2e-94    Nicotiana tomentosiformis
ref|XP_009782203.1|  PREDICTED: cytochrome P450 CYP736A12-like          298   2e-94    Nicotiana sylvestris
gb|EYU31078.1|  hypothetical protein MIMGU_mgv1a004963mg                298   3e-94    Erythranthe guttata [common monkey flower]
ref|XP_002310009.2|  hypothetical protein POPTR_0007s06300g             293   5e-94    
ref|XP_006367702.1|  PREDICTED: cytochrome P450 71A1-like               298   6e-94    
ref|XP_004504031.1|  PREDICTED: cytochrome P450 750A1-like              296   7e-94    Cicer arietinum [garbanzo]
gb|EYU31075.1|  hypothetical protein MIMGU_mgv1a005090mg                296   1e-93    Erythranthe guttata [common monkey flower]
ref|XP_006354705.1|  PREDICTED: cytochrome P450 750A1-like              296   2e-93    Solanum tuberosum [potatoes]
ref|XP_011090604.1|  PREDICTED: cytochrome P450 CYP736A12-like          295   2e-93    Sesamum indicum [beniseed]
ref|XP_009372721.1|  PREDICTED: cytochrome P450 CYP736A12-like          295   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_009631554.1|  PREDICTED: cytochrome P450 CYP736A12-like          295   3e-93    Nicotiana tomentosiformis
ref|XP_003630097.1|  Cytochrome P450                                    293   4e-93    
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             294   6e-93    
ref|XP_006366158.1|  PREDICTED: cytochrome P450 750A1-like              293   9e-93    Solanum tuberosum [potatoes]
emb|CBI21489.3|  unnamed protein product                                295   1e-92    Vitis vinifera
gb|KJB37876.1|  hypothetical protein B456_006G224400                    289   1e-92    Gossypium raimondii
ref|XP_009588170.1|  PREDICTED: cytochrome P450 CYP736A12-like          292   3e-92    Nicotiana tomentosiformis
ref|XP_008385983.1|  PREDICTED: cytochrome P450 CYP736A12-like          292   5e-92    
gb|AJD25257.1|  cytochrome P450 CYP736A122                              292   6e-92    Salvia miltiorrhiza [Chinese salvia]
ref|XP_009378500.1|  PREDICTED: cytochrome P450 CYP736A12-like          291   6e-92    Pyrus x bretschneideri [bai li]
gb|KJB37875.1|  hypothetical protein B456_006G224300                    291   1e-91    Gossypium raimondii
gb|EYU24037.1|  hypothetical protein MIMGU_mgv1a005167mg                291   1e-91    Erythranthe guttata [common monkey flower]
ref|XP_008385728.1|  PREDICTED: cytochrome P450 CYP736A12-like          286   1e-91    
ref|XP_003627829.1|  Cytochrome P450                                    293   2e-91    
gb|KHN29102.1|  Cytochrome P450 71A1                                    290   3e-91    Glycine soja [wild soybean]
ref|XP_007159747.1|  hypothetical protein PHAVU_002G263700g             290   4e-91    Phaseolus vulgaris [French bean]
ref|XP_011090598.1|  PREDICTED: cytochrome P450 CYP736A12-like          290   4e-91    
gb|KDP20096.1|  hypothetical protein JCGZ_05865                         289   6e-91    Jatropha curcas
ref|XP_006346619.1|  PREDICTED: cytochrome P450 71A1-like               288   9e-91    Solanum tuberosum [potatoes]
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               288   1e-90    Glycine max [soybeans]
gb|KJB37877.1|  hypothetical protein B456_006G224400                    288   2e-90    Gossypium raimondii
gb|KHN38214.1|  Cytochrome P450 71A1                                    286   2e-90    Glycine soja [wild soybean]
ref|XP_004237615.1|  PREDICTED: cytochrome P450 CYP736A12-like          287   3e-90    Solanum lycopersicum
emb|CBI15435.3|  unnamed protein product                                285   5e-90    Vitis vinifera
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          286   5e-90    Eucalyptus grandis [rose gum]
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    286   5e-90    
ref|XP_007036492.1|  Cytochrome P450 superfamily protein                287   6e-90    
ref|XP_007221131.1|  hypothetical protein PRUPE_ppa019068mg             286   6e-90    Prunus persica
gb|EYU31077.1|  hypothetical protein MIMGU_mgv1a024906mg                277   7e-90    Erythranthe guttata [common monkey flower]
ref|XP_009337209.1|  PREDICTED: cytochrome P450 CYP736A12-like          286   9e-90    
gb|EYU24036.1|  hypothetical protein MIMGU_mgv1a005182mg                285   2e-89    Erythranthe guttata [common monkey flower]
ref|XP_008440670.1|  PREDICTED: cytochrome P450 CYP736A12-like          285   2e-89    Cucumis melo [Oriental melon]
ref|XP_002275826.1|  PREDICTED: cytochrome P450 CYP736A12               285   2e-89    Vitis vinifera
emb|CDP12932.1|  unnamed protein product                                275   2e-89    Coffea canephora [robusta coffee]
ref|XP_004143571.1|  PREDICTED: cytochrome P450 71A1-like               282   3e-89    
ref|XP_004252295.1|  PREDICTED: cytochrome P450 CYP736A12-like          284   5e-89    Solanum lycopersicum
ref|XP_009337257.1|  PREDICTED: cytochrome P450 CYP736A12-like          283   1e-88    Pyrus x bretschneideri [bai li]
gb|EYU27291.1|  hypothetical protein MIMGU_mgv1a023536mg                282   3e-88    Erythranthe guttata [common monkey flower]
ref|XP_009336569.1|  PREDICTED: cytochrome P450 CYP736A12-like          282   4e-88    Pyrus x bretschneideri [bai li]
ref|XP_004153472.1|  PREDICTED: cytochrome P450 71B13-like              281   4e-88    Cucumis sativus [cucumbers]
ref|XP_004299223.2|  PREDICTED: cytochrome P450 CYP736A12-like          282   6e-88    Fragaria vesca subsp. vesca
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like          281   8e-88    
ref|XP_009346975.1|  PREDICTED: cytochrome P450 CYP736A12-like          281   1e-87    Pyrus x bretschneideri [bai li]
gb|KEH15707.1|  cytochrome P450 family 71 protein                       278   2e-87    Medicago truncatula
gb|KEH15895.1|  cytochrome P450 family 71 protein                       274   3e-87    Medicago truncatula
ref|XP_003596030.1|  Cytochrome P450                                    279   3e-87    
gb|EYU31073.1|  hypothetical protein MIMGU_mgv1a004944mg                280   3e-87    Erythranthe guttata [common monkey flower]
ref|XP_004291274.1|  PREDICTED: cytochrome P450 CYP736A12-like          279   6e-87    Fragaria vesca subsp. vesca
ref|XP_009337244.1|  PREDICTED: cytochrome P450 CYP736A12-like          279   7e-87    Pyrus x bretschneideri [bai li]
dbj|BAD15331.1|  cytochrome P450                                        278   8e-87    Panax ginseng [Asiatic ginseng]
ref|XP_002511968.1|  flavonoid 3-hydroxylase, putative                  278   1e-86    Ricinus communis
ref|XP_003531375.1|  PREDICTED: cytochrome P450 750A1-like isofor...    278   1e-86    Glycine max [soybeans]
ref|XP_009337218.1|  PREDICTED: cytochrome P450 CYP736A12-like          278   1e-86    Pyrus x bretschneideri [bai li]
gb|KJB78920.1|  hypothetical protein B456_013G025400                    277   2e-86    Gossypium raimondii
ref|XP_004301061.2|  PREDICTED: cytochrome P450 CYP736A12-like          278   4e-86    Fragaria vesca subsp. vesca
ref|XP_004252382.1|  PREDICTED: cytochrome P450 CYP736A12               276   6e-86    Solanum lycopersicum
sp|H2DH18.1|C7A12_PANGI  RecName: Full=Cytochrome P450 CYP736A12        276   6e-86    Panax ginseng [Asiatic ginseng]
ref|XP_008460602.1|  PREDICTED: cytochrome P450 CYP736A12-like          276   1e-85    Cucumis melo [Oriental melon]
gb|AAL66194.1|AF386512_1  cytochrome P450                               275   1e-85    Pyrus communis
ref|XP_008374739.1|  PREDICTED: cytochrome P450 CYP736A12-like          275   2e-85    
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              274   3e-85    Glycine max [soybeans]
ref|XP_008360900.1|  PREDICTED: cytochrome P450 CYP736A12-like          274   5e-85    Malus domestica [apple tree]
gb|KGN49699.1|  hypothetical protein Csa_5G076690                       267   5e-85    Cucumis sativus [cucumbers]
ref|XP_008346790.1|  PREDICTED: cytochrome P450 CYP736A12-like is...    270   7e-85    
ref|XP_008346791.1|  PREDICTED: cytochrome P450 CYP736A12-like is...    270   7e-85    
ref|XP_008374965.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    276   1e-84    
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             273   1e-84    Phaseolus vulgaris [French bean]
ref|XP_008240284.1|  PREDICTED: cytochrome P450 CYP736A12-like          273   1e-84    Prunus mume [ume]
ref|XP_009337234.1|  PREDICTED: cytochrome P450 CYP736A12-like          273   1e-84    Pyrus x bretschneideri [bai li]
ref|XP_008393300.1|  PREDICTED: cytochrome P450 CYP736A12-like          272   4e-84    
ref|XP_010042459.1|  PREDICTED: cytochrome P450 CYP736A12-like          262   4e-84    Eucalyptus grandis [rose gum]
ref|XP_008385725.1|  PREDICTED: cytochrome P450 CYP736A12-like          271   1e-83    
ref|XP_002275714.2|  PREDICTED: cytochrome P450 CYP736A12-like          270   1e-83    Vitis vinifera
ref|XP_006354703.1|  PREDICTED: cytochrome P450 84A1-like               260   1e-83    Solanum tuberosum [potatoes]
ref|XP_010094782.1|  Cytochrome P450 71A1                               270   3e-83    
ref|XP_004153471.1|  PREDICTED: cytochrome P450 71A1-like               269   3e-83    
ref|XP_008374738.1|  PREDICTED: cytochrome P450 CYP736A12-like          270   4e-83    
ref|XP_008344234.1|  PREDICTED: cytochrome P450 CYP736A12-like          268   5e-83    Malus domestica [apple tree]
ref|XP_007209911.1|  hypothetical protein PRUPE_ppa004377mg             268   8e-83    
gb|KHF97324.1|  Cytochrome P450                                         268   1e-82    Gossypium arboreum [tree cotton]
ref|XP_006585306.1|  PREDICTED: cytochrome P450 750A1-like isofor...    265   1e-82    Glycine max [soybeans]
ref|XP_011465681.1|  PREDICTED: cytochrome P450 CYP736A12-like          266   4e-82    Fragaria vesca subsp. vesca
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               266   4e-82    Cicer arietinum [garbanzo]
ref|XP_004143566.1|  PREDICTED: cytochrome P450 750A1-like              266   7e-82    
ref|XP_004162326.1|  PREDICTED: cytochrome P450 750A1-like              266   7e-82    
ref|XP_009372715.1|  PREDICTED: cytochrome P450 CYP736A12-like          265   7e-82    
ref|XP_004172515.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    264   1e-81    
ref|XP_004156155.1|  PREDICTED: cytochrome P450 84A1-like               255   2e-81    
ref|XP_003530005.1|  PREDICTED: cytochrome P450 71A1-like               265   2e-81    Glycine max [soybeans]
ref|XP_006354702.1|  PREDICTED: cytochrome P450 84A1-like               254   2e-81    
ref|XP_009795378.1|  PREDICTED: cytochrome P450 CYP736A12-like          261   2e-81    Nicotiana sylvestris
ref|XP_006350392.1|  PREDICTED: cytochrome P450 71A1-like               265   2e-81    Solanum tuberosum [potatoes]
ref|XP_004142334.1|  PREDICTED: cytochrome P450 84A1-like               254   2e-81    
ref|XP_004143572.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    264   3e-81    
gb|KHG07950.1|  Cytochrome P450                                         265   3e-81    Gossypium arboreum [tree cotton]
ref|XP_009617817.1|  PREDICTED: cytochrome P450 CYP736A12-like          263   7e-81    
gb|KHN32024.1|  Cytochrome P450 71A1                                    261   9e-81    Glycine soja [wild soybean]
ref|XP_009605506.1|  PREDICTED: cytochrome P450 CYP736A12-like          255   2e-80    Nicotiana tomentosiformis
gb|KEH27062.1|  cytochrome P450 family 71 protein                       254   3e-80    Medicago truncatula
gb|KJB13389.1|  hypothetical protein B456_002G072000                    262   3e-80    Gossypium raimondii
ref|XP_003630098.1|  Cytochrome P450                                    260   4e-80    
ref|XP_009372726.1|  PREDICTED: cytochrome P450 CYP736A12-like          261   5e-80    Pyrus x bretschneideri [bai li]
ref|XP_004169555.1|  PREDICTED: cytochrome P450 71A1-like               258   6e-80    
ref|XP_009372727.1|  PREDICTED: cytochrome P450 CYP736A12-like          260   6e-80    
gb|KJB13388.1|  hypothetical protein B456_002G071900                    261   8e-80    Gossypium raimondii
ref|XP_010111002.1|  Cytochrome P450 71D10                              259   1e-79    
gb|KHN20714.1|  Cytochrome P450 71D10                                   260   1e-79    Glycine soja [wild soybean]
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g             259   2e-79    Phaseolus vulgaris [French bean]
gb|KHN32022.1|  Cytochrome P450 71A1                                    259   2e-79    Glycine soja [wild soybean]
ref|XP_008385982.1|  PREDICTED: cytochrome P450 CYP736A12-like          259   3e-79    
gb|KCW83844.1|  hypothetical protein EUGRSUZ_B00712                     257   3e-79    Eucalyptus grandis [rose gum]
ref|XP_010094781.1|  Cytochrome P450 71D8                               258   5e-79    Morus notabilis
ref|XP_004143494.1|  PREDICTED: cytochrome P450 750A1-like              258   7e-79    Cucumis sativus [cucumbers]
ref|XP_004162312.1|  PREDICTED: cytochrome P450 750A1-like              257   1e-78    
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like          258   1e-78    Tarenaya hassleriana [spider flower]
ref|XP_007152786.1|  hypothetical protein PHAVU_004G159500g             258   1e-78    Phaseolus vulgaris [French bean]
ref|XP_010663579.1|  PREDICTED: cytochrome P450 CYP736A12-like          257   2e-78    Vitis vinifera
ref|XP_010045641.1|  PREDICTED: cytochrome P450 CYP736A12-like          257   2e-78    Eucalyptus grandis [rose gum]
ref|XP_007036496.1|  Cytochrome P450 superfamily protein, putativ...    257   2e-78    
ref|XP_007036495.1|  Cytochrome P450 superfamily protein, putativ...    257   4e-78    
gb|AET05316.2|  cytochrome P450 family 71 protein                       248   6e-78    Medicago truncatula
ref|XP_009372722.1|  PREDICTED: cytochrome P450 CYP736A12-like          246   6e-78    Pyrus x bretschneideri [bai li]
gb|KHG22550.1|  Cytochrome P450                                         255   7e-78    Gossypium arboreum [tree cotton]
gb|KEH21372.1|  cytochrome P450 family protein                          248   7e-78    Medicago truncatula
gb|KJB34360.1|  hypothetical protein B456_006G062200                    256   7e-78    Gossypium raimondii
gb|KJB34359.1|  hypothetical protein B456_006G062100                    255   7e-78    Gossypium raimondii
gb|KHG22812.1|  Cytochrome P450                                         255   8e-78    Gossypium arboreum [tree cotton]
ref|XP_003630840.1|  Cytochrome P450                                    248   8e-78    
gb|KCW79058.1|  hypothetical protein EUGRSUZ_C00484                     255   8e-78    Eucalyptus grandis [rose gum]
ref|XP_007152787.1|  hypothetical protein PHAVU_004G159600g             254   1e-77    Phaseolus vulgaris [French bean]
gb|KHN20715.1|  Cytochrome P450 71A1                                    254   1e-77    Glycine soja [wild soybean]
ref|XP_010036875.1|  PREDICTED: cytochrome P450 CYP736A12-like          254   2e-77    Eucalyptus grandis [rose gum]
ref|XP_010663583.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X2    253   2e-77    
ref|XP_007152789.1|  hypothetical protein PHAVU_004G159800g             254   2e-77    Phaseolus vulgaris [French bean]
ref|XP_004237368.1|  PREDICTED: cytochrome P450 CYP736A12-like          254   2e-77    Solanum lycopersicum
ref|XP_010045642.1|  PREDICTED: cytochrome P450 CYP736A12-like          254   2e-77    Eucalyptus grandis [rose gum]
ref|XP_002275691.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X1    254   2e-77    Vitis vinifera
ref|XP_010047217.1|  PREDICTED: cytochrome P450 CYP736A12-like          255   2e-77    Eucalyptus grandis [rose gum]
ref|XP_003615678.1|  Cytochrome P450                                    253   4e-77    Medicago truncatula
gb|AFK79030.1|  cytochrome P450 CYP736A53                               253   5e-77    Bupleurum chinense
ref|XP_007152790.1|  hypothetical protein PHAVU_004G159900g             253   7e-77    Phaseolus vulgaris [French bean]
ref|XP_009372725.1|  PREDICTED: cytochrome P450 CYP736A12-like          252   9e-77    Pyrus x bretschneideri [bai li]
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              261   1e-76    
ref|XP_006365796.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    252   1e-76    Solanum tuberosum [potatoes]
emb|CAN69565.1|  hypothetical protein VITISV_033534                     252   1e-76    Vitis vinifera
gb|KJB34356.1|  hypothetical protein B456_006G061800                    251   2e-76    Gossypium raimondii
gb|KEH27058.1|  cytochrome P450 family 71 protein                       252   2e-76    Medicago truncatula
ref|XP_007036499.1|  Cytochrome P450, putative                          251   2e-76    
ref|XP_003534174.2|  PREDICTED: cytochrome P450 750A1-like              260   3e-76    Glycine max [soybeans]
ref|XP_008449122.1|  PREDICTED: cytochrome P450 CYP736A12-like          249   3e-76    
ref|XP_007152788.1|  hypothetical protein PHAVU_004G159700g             243   4e-76    Phaseolus vulgaris [French bean]
ref|XP_007036494.1|  Cytochrome P450                                    246   5e-76    
ref|XP_003528941.2|  PREDICTED: cytochrome P450 750A1-like              259   5e-76    Glycine max [soybeans]
ref|XP_004512940.1|  PREDICTED: cytochrome P450 71A1-like               250   5e-76    Cicer arietinum [garbanzo]
ref|XP_007152783.1|  hypothetical protein PHAVU_004G159300g             249   1e-75    Phaseolus vulgaris [French bean]
ref|XP_009767574.1|  PREDICTED: cytochrome P450 CYP736A12-like          239   2e-75    Nicotiana sylvestris
gb|KHG07602.1|  Cytochrome P450                                         246   3e-75    Gossypium arboreum [tree cotton]
ref|XP_008441067.1|  PREDICTED: cytochrome P450 CYP736A12-like          243   3e-75    
ref|XP_008351916.1|  PREDICTED: cytochrome P450 CYP736A12-like          248   6e-75    
gb|KHN32025.1|  Cytochrome P450 71A1                                    252   7e-75    Glycine soja [wild soybean]
ref|XP_003525259.2|  PREDICTED: cytochrome P450 750A1-like              246   7e-75    Glycine max [soybeans]
gb|AES98630.2|  cytochrome P450 family 71 protein                       249   2e-74    Medicago truncatula
ref|XP_003615666.1|  Cytochrome P450                                    246   2e-74    Medicago truncatula
ref|XP_010537441.1|  PREDICTED: cytochrome P450 CYP736A12-like          246   3e-74    Tarenaya hassleriana [spider flower]
ref|XP_003615665.1|  Cytochrome P450                                    246   4e-74    Medicago truncatula
ref|XP_004490599.1|  PREDICTED: uncharacterized protein LOC101502297    253   8e-74    
ref|XP_003615672.1|  Cytochrome P450                                    249   1e-73    
ref|XP_004308347.1|  PREDICTED: cytochrome P450 CYP736A12-like          243   3e-73    Fragaria vesca subsp. vesca
emb|CBI15434.3|  unnamed protein product                                251   3e-73    Vitis vinifera
ref|XP_007036498.1|  Cytochrome P450                                    236   6e-73    
gb|KHF98693.1|  Cytochrome P450                                         240   7e-73    Gossypium arboreum [tree cotton]
ref|XP_010537440.1|  PREDICTED: cytochrome P450 CYP736A12-like          242   8e-73    Tarenaya hassleriana [spider flower]
emb|CAN69566.1|  hypothetical protein VITISV_033535                     253   9e-73    Vitis vinifera
gb|AES98625.2|  cytochrome P450 family 71 protein                       242   1e-72    Medicago truncatula
gb|KCW48536.1|  hypothetical protein EUGRSUZ_K02211                     241   2e-72    
ref|XP_010036876.1|  PREDICTED: cytochrome P450 CYP736A12-like          241   3e-72    
gb|KJB60525.1|  hypothetical protein B456_009G310200                    241   3e-72    
ref|XP_007160365.1|  hypothetical protein PHAVU_002G315400g             240   7e-72    
ref|XP_006380458.1|  hypothetical protein POPTR_0007s06340g             233   7e-72    
ref|XP_002313762.1|  cytochrome P450 family protein                     239   1e-71    
gb|KDO59988.1|  hypothetical protein CISIN_1g037605mg                   228   2e-71    
gb|KJB23394.1|  hypothetical protein B456_004G095700                    238   2e-71    
ref|XP_002514610.1|  flavonoid 3-hydroxylase, putative                  237   7e-71    
gb|KJB34358.1|  hypothetical protein B456_006G062000                    237   8e-71    
ref|XP_008441066.1|  PREDICTED: cytochrome P450 CYP736A12-like          237   8e-71    
ref|XP_004162328.1|  PREDICTED: flavonoid 3'-monooxygenase-like         237   8e-71    
gb|KDO38935.1|  hypothetical protein CISIN_1g045398mg                   226   8e-71    
ref|XP_011047458.1|  PREDICTED: cytochrome P450 84A1-like               237   1e-70    
gb|AGE09596.1|  FAH1-like protein                                       227   3e-70    
ref|XP_003615667.1|  Cytochrome P450                                    242   4e-70    
ref|XP_004490596.1|  PREDICTED: uncharacterized protein LOC101501242    242   6e-70    
ref|XP_003615674.1|  Cytochrome P450                                    236   6e-70    
ref|XP_006428068.1|  hypothetical protein CICLE_v10027567mg             232   8e-70    
gb|AES98632.2|  cytochrome P450 family 71 protein                       234   1e-69    
ref|XP_004143569.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    234   1e-69    
gb|KDO59983.1|  hypothetical protein CISIN_1g038070mg                   222   2e-69    
gb|ACN40174.1|  unknown                                                 234   2e-69    
ref|XP_010537439.1|  PREDICTED: cytochrome P450 CYP736A12-like          233   4e-69    
ref|XP_010694276.1|  PREDICTED: cytochrome P450 CYP736A12-like          231   1e-68    
gb|ACU45738.1|  ferulate 5-hydroxylase                                  231   3e-68    
ref|XP_010526785.1|  PREDICTED: cytochrome P450 84A1                    230   4e-68    
dbj|BAI47545.1|  coniferaldehyde 5-hydroxylase                          231   4e-68    
ref|XP_007046764.1|  Ferulic acid 5-hydroxylase 1                       230   5e-68    
gb|KJB43396.1|  hypothetical protein B456_007G197700                    230   5e-68    
ref|XP_010033459.1|  PREDICTED: cytochrome P450 84A1-like               230   8e-68    
gb|KHG17821.1|  Cytochrome P450 protein                                 229   1e-67    
dbj|BAI47544.1|  coniferaldehyde 5-hydroxylase                          229   2e-67    
ref|XP_008796879.1|  PREDICTED: cytochrome P450 84A1-like               228   2e-67    
ref|XP_010933756.1|  PREDICTED: cytochrome P450 84A1-like               228   2e-67    
ref|XP_008791649.1|  PREDICTED: cytochrome P450 84A1-like               225   3e-67    
gb|KDO49907.1|  hypothetical protein CISIN_1g009497mg                   228   3e-67    
ref|XP_006487364.1|  PREDICTED: cytochrome P450 84A1-like               228   3e-67    
ref|XP_004512097.1|  PREDICTED: cytochrome P450 84A1-like               228   4e-67    
ref|XP_010531068.1|  PREDICTED: cytochrome P450 84A1-like               228   4e-67    
ref|XP_003607058.1|  Ferulate 5-hydroxylase                             228   4e-67    
ref|XP_010113394.1|  Cytochrome P450 84A1                               227   4e-67    
ref|XP_008337913.1|  PREDICTED: cytochrome P450 84A1-like               228   4e-67    
ref|XP_007042040.1|  Ferulic acid 5-hydroxylase 1                       227   6e-67    
gb|ABS53040.1|  Cald5H                                                  227   6e-67    
gb|ABB02161.1|  ferulate 5-hydroxylase                                  227   6e-67    
gb|AGR85825.1|  ferulate-5-hydroxylase                                  224   7e-67    
ref|XP_009346304.1|  PREDICTED: cytochrome P450 84A1-like               227   7e-67    
gb|KCW78883.1|  hypothetical protein EUGRSUZ_C00326                     226   7e-67    
ref|XP_009770876.1|  PREDICTED: cytochrome P450 CYP736A12-like          216   7e-67    
ref|XP_003612110.1|  Cytochrome P450                                    227   9e-67    
gb|AAW50817.1|  ferulate-5-hydroxylase                                  226   9e-67    
gb|ACJ85732.1|  unknown                                                 226   1e-66    
ref|XP_006425557.1|  hypothetical protein CICLE_v10025382mg             226   1e-66    
gb|KJB79068.1|  hypothetical protein B456_013G032800                    227   1e-66    
ref|XP_008440792.1|  PREDICTED: cytochrome P450 84A1-like               226   2e-66    
gb|KHG17003.1|  Cytochrome P450 protein                                 226   2e-66    
gb|ABB02162.1|  ferulate 5-hydroxylase                                  226   2e-66    
gb|ABR16821.1|  unknown                                                 225   3e-66    
ref|XP_008791650.1|  PREDICTED: cytochrome P450 84A1-like               225   3e-66    
ref|XP_002272644.1|  PREDICTED: cytochrome P450 84A1                    225   3e-66    
ref|XP_010919382.1|  PREDICTED: cytochrome P450 84A1                    225   3e-66    
ref|XP_009338655.1|  PREDICTED: cytochrome P450 84A1-like               225   3e-66    
ref|XP_006423464.1|  hypothetical protein CICLE_v10028122mg             226   3e-66    
gb|AFK42518.1|  unknown                                                 217   3e-66    
ref|XP_009378215.1|  PREDICTED: cytochrome P450 84A1-like               225   3e-66    
ref|XP_006466893.1|  PREDICTED: cytochrome P450 84A1-like               225   3e-66    
gb|KDO71086.1|  hypothetical protein CISIN_1g010226mg                   225   3e-66    
ref|XP_006412017.1|  hypothetical protein EUTSA_v10024928mg             225   4e-66    
emb|CAC26936.1|  ferulate-5-hydroxylase                                 225   5e-66    
emb|CAC26932.1|  ferulate-5-hydroxylase                                 224   6e-66    
emb|CAN73481.1|  hypothetical protein VITISV_026695                     224   6e-66    
ref|XP_010432189.1|  PREDICTED: cytochrome P450 84A1-like               224   7e-66    
ref|NP_195345.1|  ferulic acid 5-hydroxylase 1                          224   7e-66    
ref|XP_010437364.1|  PREDICTED: cytochrome P450 84A1-like               224   7e-66    
ref|XP_002867029.1|  ferulate-5-hydroxylase                             224   8e-66    
gb|ABL07485.1|  cytochrome P450                                         224   9e-66    
ref|XP_010446813.1|  PREDICTED: cytochrome P450 84A1                    224   9e-66    
gb|EYU40391.1|  hypothetical protein MIMGU_mgv1a006014mg                223   9e-66    
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                224   9e-66    
gb|AGG18092.1|  flavonoid 3'-hydroxylase                                217   9e-66    
ref|XP_009384541.1|  PREDICTED: cytochrome P450 84A1-like               224   1e-65    
gb|AJD25177.1|  cytochrome P450 CYP75B79                                223   2e-65    
gb|ACR14867.1|  flavonoid 3' hydroxylase                                223   2e-65    
ref|XP_004134878.1|  PREDICTED: cytochrome P450 84A1-like               223   2e-65    
gb|AID69231.1|  ferulate-5-hydroxylase                                  223   2e-65    
ref|XP_008372753.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    223   3e-65    
ref|XP_010058414.1|  PREDICTED: geraniol 8-hydroxylase-like             221   3e-65    
ref|XP_007156106.1|  hypothetical protein PHAVU_003G259200g             222   3e-65    
ref|XP_006283399.1|  hypothetical protein CARUB_v10004440mg             224   3e-65    
gb|AGR44939.1|  ferulate 5-hydroxylase protein                          222   5e-65    
gb|AGG18103.1|  flavonoid 3'-hydroxylase                                215   5e-65    
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         222   5e-65    
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                222   6e-65    
ref|XP_010919383.1|  PREDICTED: cytochrome P450 84A1-like               222   6e-65    
gb|KHG11872.1|  Cytochrome P450 protein                                 222   7e-65    
ref|XP_003537622.1|  PREDICTED: cytochrome P450 84A1-like               222   8e-65    
ref|XP_010550444.1|  PREDICTED: cytochrome P450 84A1-like               221   8e-65    
gb|AFH89637.1|  ferulate-5-hydroxylase                                  214   9e-65    
ref|XP_010271496.1|  PREDICTED: cytochrome P450 84A1-like               221   1e-64    
gb|EYU24083.1|  hypothetical protein MIMGU_mgv1a025005mg                221   1e-64    
gb|KFK30256.1|  hypothetical protein AALP_AA7G237600                    221   1e-64    
ref|XP_004148555.1|  PREDICTED: cytochrome P450 84A1-like               221   1e-64    
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            221   1e-64    
ref|XP_004509332.1|  PREDICTED: cytochrome P450 84A1-like               221   1e-64    
gb|EMS53883.1|  Cytochrome P450 84A1                                    216   1e-64    
ref|XP_010029715.1|  PREDICTED: cytochrome P450 84A1-like               221   2e-64    
ref|XP_007157951.1|  hypothetical protein PHAVU_002G111900g             221   2e-64    
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              221   2e-64    
ref|XP_002275191.1|  PREDICTED: cytochrome P450 84A1-like               221   2e-64    
gb|EMT06970.1|  Cytochrome P450 84A1                                    216   2e-64    
gb|ABR18406.1|  unknown                                                 221   2e-64    
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             221   2e-64    
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              221   2e-64    
gb|AFH89638.1|  ferulate-5-hydroxylase                                  213   2e-64    
ref|XP_004287841.1|  PREDICTED: cytochrome P450 84A1                    221   2e-64    
ref|XP_009780649.1|  PREDICTED: geraniol 8-hydroxylase-like             220   2e-64    
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             220   2e-64    
emb|CAN60361.1|  hypothetical protein VITISV_036388                     220   2e-64    
gb|AJD25204.1|  cytochrome P450 CYP84A60                                220   2e-64    
ref|XP_009384087.1|  PREDICTED: cytochrome P450 84A1-like               220   2e-64    
gb|AFZ78545.1|  coniferaldehyde 5-hydroxylase                           218   2e-64    
emb|CAN74838.1|  hypothetical protein VITISV_002617                     220   3e-64    
emb|CBI37999.3|  unnamed protein product                                221   3e-64    
ref|XP_007203643.1|  hypothetical protein PRUPE_ppa004260mg             220   3e-64    
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             220   3e-64    
ref|XP_004164845.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    220   3e-64    
ref|XP_008241781.1|  PREDICTED: cytochrome P450 84A1                    220   3e-64    
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                220   3e-64    
emb|CDP01938.1|  unnamed protein product                                220   4e-64    
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 219   4e-64    
gb|ABR18060.1|  unknown                                                 219   4e-64    
ref|XP_010689622.1|  PREDICTED: cytochrome P450 CYP736A12-like          212   4e-64    
ref|XP_002318091.2|  hypothetical protein POPTR_0012s09180g             219   5e-64    
ref|XP_011040452.1|  PREDICTED: cytochrome P450 71A1-like               219   5e-64    
gb|KHN30969.1|  Cytochrome P450 71A1                                    212   5e-64    
gb|EAZ44883.1|  hypothetical protein OsJ_29523                          218   5e-64    
gb|KCW72821.1|  hypothetical protein EUGRSUZ_E01263                     218   5e-64    
emb|CAB65335.1|  ferulate-5-hydroxylase                                 219   5e-64    
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         219   5e-64    
gb|KJB51032.1|  hypothetical protein B456_008G198200                    219   6e-64    
ref|XP_011040453.1|  PREDICTED: cytochrome P450 71A1-like               219   7e-64    
ref|XP_006383141.1|  cytochrome P450 family protein                     219   7e-64    
gb|AGJ84132.1|  putative ferulate 5-hydroxylase                         219   7e-64    
gb|ABK23613.1|  unknown                                                 215   7e-64    
gb|AAG14961.1|AF214007_1  cytochrome p450-dependent monooxygenase       219   7e-64    
emb|CDO97842.1|  unnamed protein product                                212   8e-64    
ref|XP_006578667.1|  PREDICTED: cytochrome P450 71A1-like               212   8e-64    
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         219   8e-64    
emb|CBI38004.3|  unnamed protein product                                218   9e-64    
gb|AHA49900.1|  flavonoid 3' hydroxylase                                219   9e-64    
ref|XP_002318090.2|  hypothetical protein POPTR_0012s09160g             219   9e-64    
ref|XP_003517196.1|  PREDICTED: cytochrome P450 84A1-like               219   1e-63    
ref|XP_010263873.1|  PREDICTED: cytochrome P450 84A1-like               219   1e-63    
ref|XP_009782145.1|  PREDICTED: geraniol 8-hydroxylase-like             218   1e-63    
ref|XP_011100951.1|  PREDICTED: cytochrome P450 84A1-like               219   1e-63    
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                218   1e-63    
ref|XP_009145966.1|  PREDICTED: cytochrome P450 84A1                    219   1e-63    
ref|XP_009777846.1|  PREDICTED: geraniol 8-hydroxylase-like             216   1e-63    
ref|XP_011028697.1|  PREDICTED: cytochrome P450 84A1-like               218   1e-63    
ref|XP_006365963.1|  PREDICTED: geraniol 8-hydroxylase-like             218   1e-63    
gb|ACC63881.1|  coniferyl aldehyde 5-hydroxylase                        218   1e-63    
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                218   1e-63    
ref|XP_009624917.1|  PREDICTED: geraniol 8-hydroxylase-like             218   1e-63    
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 218   1e-63    
gb|ACC63880.1|  coniferyl aldehyde 5-hydroxylase                        218   1e-63    
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         218   1e-63    
ref|XP_004174193.1|  PREDICTED: cytochrome P450 84A1-like               209   1e-63    
ref|XP_010056209.1|  PREDICTED: geraniol 8-hydroxylase-like             218   1e-63    
gb|KCW83258.1|  hypothetical protein EUGRSUZ_B00197                     212   1e-63    
ref|NP_001063284.1|  Os09g0441100                                       218   1e-63    
gb|AGL98409.1|  flavonoid 3'-hydroxylase                                209   2e-63    
gb|KJB40168.1|  hypothetical protein B456_007G049600                    218   2e-63    
gb|KJB19523.1|  hypothetical protein B456_003G107400                    218   2e-63    
ref|XP_011090419.1|  PREDICTED: cytochrome P450 84A1-like               218   2e-63    
gb|ABK24537.1|  unknown                                                 218   2e-63    
gb|AEO21428.1|  coniferylaldehyde 5-hydroxylase                         218   2e-63    
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         218   2e-63    
gb|ABG73616.1|  ferulate-5-hydroxylase                                  218   2e-63    
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             218   2e-63    
gb|ABC68398.1|  cytochrome P450 monooxygenase CYP84A16                  218   2e-63    
ref|XP_002310288.1|  cytochrome P450 family protein                     218   2e-63    
gb|AAG14962.1|AF214008_1  cytochrome p450-dependent monooxygenase       218   2e-63    
gb|AFO67696.1|  ferulate 5-hydroxylase                                  208   2e-63    
ref|XP_006427642.1|  hypothetical protein CICLE_v10025377mg             218   2e-63    
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               218   2e-63    
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               218   2e-63    
gb|AIB06740.1|  flavanone 3'-hydroxylase                                218   2e-63    
ref|XP_006829159.1|  hypothetical protein AMTR_s00001p00269980          218   3e-63    
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               218   3e-63    
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                217   3e-63    
ref|XP_002274902.1|  PREDICTED: cytochrome P450 84A1-like               218   3e-63    
gb|AFO67726.1|  ferulate 5-hydroxylase                                  208   3e-63    
ref|XP_002513345.1|  cytochrome P450, putative                          216   3e-63    
gb|AFO67732.1|  ferulate 5-hydroxylase                                  208   3e-63    
ref|XP_008448126.1|  PREDICTED: cytochrome P450 84A1-like               218   3e-63    
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like         218   3e-63    
gb|AFO67708.1|  ferulate 5-hydroxylase                                  208   3e-63    
gb|AFK39641.1|  unknown                                                 206   4e-63    
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               217   4e-63    
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               217   4e-63    
ref|XP_008236853.1|  PREDICTED: cytochrome P450 84A1-like               217   4e-63    
gb|AJD25205.1|  cytochrome P450 CYP84A61                                217   4e-63    
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                               216   4e-63    
ref|XP_010695999.1|  PREDICTED: cytochrome P450 71A1-like               217   4e-63    
ref|XP_010537437.1|  PREDICTED: cytochrome P450 CYP736A12-like          217   4e-63    
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         217   4e-63    
gb|KCW83256.1|  hypothetical protein EUGRSUZ_B00195                     214   4e-63    
dbj|BAJ95709.1|  predicted protein                                      217   5e-63    
ref|XP_004152498.1|  PREDICTED: cytochrome P450 71A1-like               217   5e-63    
gb|AGC29946.1|  CYP84A52                                                217   5e-63    
gb|AAS46257.1|  flavonoid 3'-hydroxylase                                217   5e-63    
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                217   5e-63    
gb|KDP46687.1|  hypothetical protein JCGZ_06475                         217   5e-63    
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              217   5e-63    
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      214   5e-63    
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              217   5e-63    
gb|EYU31149.1|  hypothetical protein MIMGU_mgv1a004547mg                217   5e-63    
ref|XP_002868879.1|  hypothetical protein ARALYDRAFT_912358             216   6e-63    
ref|XP_008779115.1|  PREDICTED: cytochrome P450 71A1-like               210   6e-63    
gb|AAT39511.1|  ferulate 5-hydroxylase                                  216   6e-63    



>emb|CDP18035.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  +MKSGE+  QF R H+KA++LDMLAGSMDTSATVVEWIM+EL ++  +MK +++EL
Sbjct  270  TMLALMKSGETEFQFDRRHIKAVLLDMLAGSMDTSATVVEWIMAELLKNSRVMKKVQQEL  329

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            + +VGLDRMVEE DL++L YL+MV+KE+ R+HPVAPLL+PHAA+EDC V+GFHIPK +R+
Sbjct  330  DEKVGLDRMVEESDLDNLRYLDMVVKEALRLHPVAPLLIPHAAIEDCTVDGFHIPKDSRV  389

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N+WAIG DPN WSDP  FIP RFSG +I+ RG DF+L+PFGSGRR CPG+QLG+TVVR
Sbjct  390  IINVWAIGRDPNAWSDPDMFIPERFSGNSIDIRGHDFQLLPFGSGRRGCPGIQLGLTVVR  449

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            LLVAQLVHCF W+LPNGM P ELDMTEEFGLVVTRAKHLMA+PTYRL
Sbjct  450  LLVAQLVHCFTWELPNGMLPSELDMTEEFGLVVTRAKHLMAVPTYRL  496



>gb|AFK79031.1| cytochrome P450 CYP736A54 [Bupleurum chinense]
Length=497

 Score =   338 bits (866),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 193/228 (85%), Gaps = 0/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIMKSGES  +F R HVKA ++DM A S DTS+T +EW +SEL RHP +M  +++EL
Sbjct  268  TMLDIMKSGESEFEFDRSHVKATLMDMFAASADTSSTTIEWTLSELLRHPRVMNKVQKEL  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG++RMVEE DLE LEYL MVIKE+ R+HPVAPLLLPH A+EDC V+GF IPK +R+
Sbjct  328  EQVVGMNRMVEESDLESLEYLGMVIKETMRLHPVAPLLLPHLAIEDCTVDGFFIPKNSRV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG D NVWSD +KF+P RF G+NI+ RGRDFEL+PFGSGRR CPG+QLG+TVVR
Sbjct  388  VVNVWAIGRDSNVWSDAEKFLPERFIGSNIDLRGRDFELLPFGSGRRGCPGMQLGLTVVR  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQL+HCFDWDLPNGM P ELDMTEEFGL+V RAKHLMAIPT RL+
Sbjct  448  LVVAQLLHCFDWDLPNGMQPSELDMTEEFGLLVGRAKHLMAIPTCRLQ  495



>emb|CDP12931.1| unnamed protein product [Coffea canephora]
Length=980

 Score =   342 bits (877),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  + KSGE+  QF R H+KAI+LDMLAGSMDTSAT VEW ++EL ++P +MK L++EL
Sbjct  747  TMLALKKSGETEFQFDRPHIKAILLDMLAGSMDTSATTVEWTLAELLKNPRVMKKLRQEL  806

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
              +VGLDRMVEE DL++L+YL+MV+KE+ R+HPVAPLL+PHAA EDC V+GFHIPK +R+
Sbjct  807  NEKVGLDRMVEESDLDNLQYLDMVVKEALRLHPVAPLLIPHAAREDCTVDGFHIPKDSRV  866

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N+W IG DPN W DP+KFIP RF G NI+ RG DF+L+PFGSGRR CPG QLG+TVVR
Sbjct  867  IINVWTIGRDPNAWPDPEKFIPERFVGNNIDVRGHDFQLLPFGSGRRGCPGTQLGLTVVR  926

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            LLVAQLVHCF+W LPNGM P ELDMTEEFGLVVTRAKHL+A+PTYRL
Sbjct  927  LLVAQLVHCFNWKLPNGMLPSELDMTEEFGLVVTRAKHLVAVPTYRL  973


 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M  I++S  S   F R HVKAI+LDML  SMD+SAT VEW MSEL RHPE M+ L++ELE
Sbjct  526  MMGIIQSETSEFDFDRRHVKAILLDMLLASMDSSATAVEWAMSELLRHPEAMQKLQKELE  585

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             +VGL R+VEE DLE LEYL+MV+KES R+HPV PL+LPH +MEDC ++ FHI K  RII
Sbjct  586  EKVGLKRIVEESDLEGLEYLDMVVKESMRLHPVGPLMLPHESMEDCKIDDFHIQKNTRII  645

Query  398  VNIWAIG  378
            +N+  + 
Sbjct  646  INVAEVA  652



>ref|XP_006363549.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
 ref|XP_006363550.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=499

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SGES  +F R HVKAI+LDML  SMDTS+T ++WI +EL RHP+++K L++EL
Sbjct  271  TMMNIMQSGESEFEFDRRHVKAILLDMLIASMDTSSTAIDWIFTELLRHPKVIKKLQKEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG++RMVEE DLE LEYL+MVIKE FR+HPVAPLL+PH ++EDC ++GF IPK +R+
Sbjct  331  EQIVGMNRMVEESDLEKLEYLDMVIKEGFRLHPVAPLLIPHESIEDCTIDGFDIPKGSRL  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN WAIG DP +WS+P+KF+P RF G+NI+ RG +F+L+PFGSGRRSCPGLQLG+T VR
Sbjct  391  LVNTWAIGRDPEIWSEPEKFMPERFVGSNIDLRGNNFQLLPFGSGRRSCPGLQLGLTTVR  450

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L++AQ+VHCFDW LPNGM P +LDMTE+FGLV+TRA+HLM IPTYRL +
Sbjct  451  LVLAQMVHCFDWKLPNGMMPNDLDMTEKFGLVMTRAQHLMVIPTYRLNV  499



>dbj|BAP15886.1| cytochrome P450 71AU50 [Prunus mume]
Length=497

 Score =   325 bits (832),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 191/227 (84%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R H+KAIMLDML  SMDTSAT +EW +SEL RHP+ MK +++ELE
Sbjct  268  MVGFMGSEESEYRIERPHIKAIMLDMLVASMDTSATTIEWALSELMRHPKAMKKVQKELE  327

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGLD+MVEE DLE L+YL MV+KE+FR+HPVAPLL+PHA++EDC VNG+HIPK++R++
Sbjct  328  NVVGLDKMVEESDLEKLDYLNMVVKETFRLHPVAPLLIPHASIEDCTVNGYHIPKKSRVL  387

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N+WAIG DPN W+D +KFIP RF G++++ RG  F+LIPFGSGRR CPG+QLG+TVV+L
Sbjct  388  INVWAIGRDPNAWTDAEKFIPERFEGSSVDVRGNHFQLIPFGSGRRRCPGIQLGLTVVQL  447

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCFDW+LPN M P+ELDMTEEFGL V RAKHL+AIP+YRLR
Sbjct  448  VLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRLR  494



>ref|XP_009770873.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+ DIM+S E+  +F R H+KAI+LD+L  SMDTS+T +EWI++EL RHPE+MK L+ EL
Sbjct  271  TLMDIMQSKEAEFEFDRRHIKAILLDLLIASMDTSSTTIEWILTELLRHPEVMKKLQNEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG +RMVEE DL++L+YL+MVIKE  R+HPVAPLLLPH ++EDC V+GFH+PK +R+
Sbjct  331  EQVVGKNRMVEESDLKNLQYLDMVIKEGCRLHPVAPLLLPHESIEDCTVDGFHLPKGSRL  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N+WAIG D + W +P+KF P RF G+N++ RGR++EL+PFGSGRR CPGLQLG+TVVR
Sbjct  391  LLNVWAIGRDSDTWLEPEKFKPERFQGSNVDLRGRNYELLPFGSGRRGCPGLQLGLTVVR  450

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L+VAQLVHCFDW+LPNGM PK++DMTE+FGLV  RA++LMAIPTYRL +
Sbjct  451  LVVAQLVHCFDWELPNGMLPKDIDMTEKFGLVTARAQNLMAIPTYRLHI  499



>ref|XP_009586899.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=500

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 193/229 (84%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  +F R HVKAIMLD+L  SMDT++T ++W  +EL RHP++MK L+ EL
Sbjct  272  TMMSIMQSGEAEFEFDRRHVKAIMLDLLIASMDTASTAIDWTFTELLRHPKVMKKLQNEL  331

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG +RMVEE DLE LEYL+MVIKE FR+HPVAPLL+PH ++EDC+V+GF IPK +RI
Sbjct  332  EQVVGTNRMVEETDLEKLEYLDMVIKEGFRLHPVAPLLIPHESIEDCIVDGFDIPKGSRI  391

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN WAIG DP  W +P+KF P RF G+NI+ RGRDF+L+PFGSGRRSCPGLQLG+T+V 
Sbjct  392  LVNTWAIGRDPEAWPEPEKFRPERFVGSNIDLRGRDFQLLPFGSGRRSCPGLQLGLTIVL  451

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L++AQLVHCFDW+LPNGM P++LDMTE+FGLV  RA+HL+AIPTYRL +
Sbjct  452  LVLAQLVHCFDWELPNGMMPEDLDMTEKFGLVTARAQHLVAIPTYRLHV  500



>ref|XP_008227094.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 190/227 (84%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R H KAIMLDML  SMDTSAT +EW +SEL RHP+ MK +++ELE
Sbjct  268  MVGFMGSEESEYRIERPHTKAIMLDMLVASMDTSATTIEWALSELMRHPKAMKKVQKELE  327

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGLD+MVEE DLE L+YL MV+KE+FR+HPVAPLL+PHA++EDC VNG+HIPK++R++
Sbjct  328  NVVGLDKMVEESDLEKLDYLNMVVKETFRLHPVAPLLVPHASIEDCTVNGYHIPKKSRVL  387

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N+WAIG DPN W+D +KFIP RF G++++ RG  F+LIPFGSGRR CPG+QLG+TVV+L
Sbjct  388  INVWAIGRDPNAWTDAEKFIPERFEGSSVDVRGNHFQLIPFGSGRRRCPGIQLGLTVVQL  447

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCFDW+LPN M P+ELDMTEEFGL V RAKHL+AIP+YRLR
Sbjct  448  VLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRLR  494



>ref|XP_007211842.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
 gb|EMJ13041.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
Length=497

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R H+KAIMLDML  SMDTS+T +EW +SEL RHP+ MK +++ELE
Sbjct  268  MVGFMGSEESEYRIERPHIKAIMLDMLVASMDTSSTTIEWALSELMRHPKAMKKVQKELE  327

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGLD+MVEE DLE L+YL MV+KE+FR+HPVAPLL+PHA++EDC VNG+HIPK +R++
Sbjct  328  NVVGLDKMVEESDLEKLDYLNMVVKETFRLHPVAPLLVPHASIEDCTVNGYHIPKNSRVL  387

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N+WAIG DPN W+DP+KFIP RF G++++ RG  F+LIPFGSGRR CPG+QLG+TVV+L
Sbjct  388  INVWAIGRDPNAWTDPEKFIPERFEGSSVDVRGNHFQLIPFGSGRRRCPGIQLGLTVVQL  447

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCFDW+LPN M P ELDMTEEFG  V RAKHL+AIP+YRLR
Sbjct  448  VLAQLVHCFDWELPNNMLPDELDMTEEFGFTVPRAKHLLAIPSYRLR  494



>ref|XP_007208656.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
 gb|EMJ09855.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
Length=498

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R ++KAI+LDMLAG+MDT+AT +EW +SEL +HP +MK +++ELE
Sbjct  270  MLGFMGSEESEYRIERSNIKAIILDMLAGAMDTTATAIEWTLSELIKHPRVMKKVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG++R VEE DLE LEYL+MV+KE+ R+HPVAPLLLPHAA+EDC VNGFHIP+++R+I
Sbjct  330  NVVGMEREVEESDLEKLEYLDMVVKETMRLHPVAPLLLPHAAIEDCNVNGFHIPRKSRVI  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +NI+AIG DP++W+D +KFIP RF G+NI++RGRDF+ IPFGSGRR CPG+QLGIT+V+L
Sbjct  390  INIFAIGRDPSIWTDAEKFIPERFDGSNIDFRGRDFQFIPFGSGRRGCPGMQLGITMVQL  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            +VAQLVHCFDW+LPN M P ELDMTEEFGL V RAKHL+A+PTYRL+
Sbjct  450  VVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAKHLLAVPTYRLQ  496



>ref|XP_004304846.1| PREDICTED: cytochrome P450 CYP736A12-like [Fragaria vesca subsp. 
vesca]
Length=499

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 191/227 (84%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R ++KAI+LDM+AG+MDTSAT +EW +SEL RHP +MK +++ELE
Sbjct  271  MLCFMGSKESEYKIERSNIKAIILDMVAGAMDTSATAIEWTLSELMRHPRVMKKVQKELE  330

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+DRMV+E DLE LEYL MV+KE+ R+HPVAPLL+PHAA+EDC VNGFHIPK++R++
Sbjct  331  DVVGMDRMVDESDLEKLEYLNMVVKENLRLHPVAPLLIPHAAIEDCTVNGFHIPKKSRVM  390

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WA+G DP+ W+DP KFIP RF G+NI+ RGRDF+L+PFGSGRR CPG+ LG+TVV L
Sbjct  391  VNVWAVGRDPSAWTDPDKFIPERFVGSNIDLRGRDFQLLPFGSGRRGCPGMHLGLTVVHL  450

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            +VAQLVHCFDW+LP+ + P ELDMTEEFGL V RAKHL+AIP+YRLR
Sbjct  451  VVAQLVHCFDWELPDNILPTELDMTEEFGLTVPRAKHLLAIPSYRLR  497



>ref|XP_009802012.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 193/229 (84%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  +F R H+KA++LDML  SMDT++T ++W  +EL RHP +MK L+ EL
Sbjct  272  TMMAIMQSGEAEFEFDRRHIKAVLLDMLIASMDTASTAIDWTFTELLRHPNVMKKLQNEL  331

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG +RMVEE DLE L+YL+MV+KE FR+HPVAPLLLP  ++EDC+V+GF IPK +RI
Sbjct  332  EQVVGTNRMVEESDLEKLDYLDMVVKEGFRLHPVAPLLLPRESIEDCIVDGFDIPKGSRI  391

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN WAIG DP  W +P+KF P RF G+NI+ RGRDF+L+PFGSGRRSCPGLQLG+T+VR
Sbjct  392  LVNTWAIGRDPEAWPEPEKFKPERFVGSNIDLRGRDFQLLPFGSGRRSCPGLQLGLTIVR  451

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L++AQLVHCFDW+LPNGM+P++LDMTE+FGLV  RA+HL+AIPTY+L +
Sbjct  452  LVLAQLVHCFDWELPNGMAPEDLDMTEKFGLVTARAQHLVAIPTYQLHV  500



>ref|XP_004236729.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=501

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 192/230 (83%), Gaps = 1/230 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IMKSGE+  QF R HVKAI+LDML  SMDTSAT ++WI+SEL R P IMK L++E 
Sbjct  272  TMLNIMKSGETEFQFDRGHVKAILLDMLIASMDTSATTIDWILSELLRQPNIMKKLQKEF  331

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E ++G+ RMVEE DLE LEYL MVIKES R+HPVAPLLLPH ++EDC ++G+ IPK++RI
Sbjct  332  EEKIGMKRMVEELDLEKLEYLNMVIKESLRLHPVAPLLLPHQSIEDCTIDGYFIPKKSRI  391

Query  401  IVNIWAIGHDPNVW-SDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            +VN +AIG DP VW ++P +FIP RF G++I+ RG DFEL+PFGSGRR CPGLQLG+ ++
Sbjct  392  LVNTYAIGRDPKVWPNNPDEFIPERFVGSSIDLRGHDFELLPFGSGRRRCPGLQLGLIII  451

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            RL+VAQLVHCFDW+LPNGM P +LDM EEFGLVV+RAKH+MAIP YRL +
Sbjct  452  RLIVAQLVHCFDWELPNGMLPNDLDMGEEFGLVVSRAKHVMAIPNYRLSM  501



>ref|XP_008347028.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008356594.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 190/227 (84%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R ++KAIMLDML+GSMDT+AT  EW +SEL +HP++MK +++E+E
Sbjct  269  MLGFMGSVESEYRIERSNIKAIMLDMLSGSMDTTATSTEWTLSELLKHPQVMKKVQKEIE  328

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG++RMVEE DLE LEYL+ V+KE+ R+HPVAPLLLPHAA+EDC VNGFHIP ++RI+
Sbjct  329  NVVGMERMVEESDLEKLEYLDKVVKETMRLHPVAPLLLPHAAIEDCNVNGFHIPGKSRIM  388

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +NIWAIG +P+VW+D  KFIP RF G+NI++RGRDF+ IPFGSGRR CPG+QLGIT+V L
Sbjct  389  INIWAIGRNPSVWTDADKFIPERFDGSNIDFRGRDFQFIPFGSGRRGCPGMQLGITMVLL  448

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            LVAQLVHCFDW+LPN M P ELDMTEEFGL V RA HL+A+PTYRLR
Sbjct  449  LVAQLVHCFDWELPNNMLPTELDMTEEFGLTVPRANHLLALPTYRLR  495



>ref|XP_002280620.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=498

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   M S E+  Q  R ++KA++LDMLAGSMDTSAT +EW ++EL ++P IMK ++EEL
Sbjct  270  VMLGYMGSKENEFQIERSNIKALVLDMLAGSMDTSATAIEWALAELLKNPRIMKKVQEEL  329

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG++R VEE DLE LEYL+MV+KE+ R+HPVAPLL+PH ++EDC VNGFHIP+++R+
Sbjct  330  EKVVGMERKVEESDLESLEYLDMVVKETLRLHPVAPLLIPHESLEDCTVNGFHIPQKSRV  389

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN +AIG DPNVW+D +KF+P RF G++I+ RGRDF+LIPFGSGRR CPG+QLG+TVVR
Sbjct  390  MVNTYAIGRDPNVWTDAEKFLPERFIGSSIDLRGRDFQLIPFGSGRRGCPGMQLGLTVVR  449

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPNGM P ELDMTEEFGL V RAKH++A+PTYRL
Sbjct  450  LVLAQLVHCFDWELPNGMMPSELDMTEEFGLTVPRAKHILAVPTYRL  496



>ref|XP_009607201.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=498

 Score =   320 bits (819),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 192/229 (84%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+  IM+S E+  +F R H+KAI+LD+L  SMDTS+T +EW ++EL RHPE+MK L+ EL
Sbjct  270  TLMSIMQSKEAEFEFDRRHIKAILLDLLIASMDTSSTTIEWTLTELLRHPEVMKKLQNEL  329

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG +RMVEE DLE LEYL+MVIKE  R+HPVAPLLLPH ++EDC V+GFH+PK +R+
Sbjct  330  EQVVGRNRMVEESDLESLEYLDMVIKEGCRLHPVAPLLLPHESIEDCTVDGFHLPKGSRL  389

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N+WAIG D + W +P+KF P RF G+N++ RGR++EL+PFGSGRR CPGLQLG+T+VR
Sbjct  390  LLNVWAIGRDSDTWIEPEKFKPERFQGSNVDLRGRNYELLPFGSGRRGCPGLQLGLTIVR  449

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L+VAQLVHCFDW+LPNGM PK++DMTE+FGLV  RA+HLMA PTYRL +
Sbjct  450  LVVAQLVHCFDWELPNGMLPKDIDMTEKFGLVTARAQHLMATPTYRLHM  498



>ref|XP_007212357.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
 gb|EMJ13556.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
Length=497

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R H+KAIMLDML  SMDTS+T +EW +SEL RHP+ MK +++ELE
Sbjct  268  MVGFMGSEESEYRIERPHIKAIMLDMLVASMDTSSTTIEWALSELMRHPKAMKKVQKELE  327

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGLD+MVEE DLE L+YL MV+KE+FR+HPVAPLL+PHA++EDC VNG+HIPK++R++
Sbjct  328  NVVGLDKMVEESDLEKLDYLNMVVKETFRLHPVAPLLVPHASIEDCTVNGYHIPKKSRVL  387

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N+WAIG DPN W+D +KFIP RF G++++ RG  F+LIPFGSGRR CPG+QLG+TVV+L
Sbjct  388  INVWAIGRDPNAWTDAEKFIPERFEGSSVDVRGNHFQLIPFGSGRRRCPGIQLGLTVVQL  447

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCFDW+LPN M P  LDMTEEFGL V RAKHL+AIP+YRLR
Sbjct  448  VLAQLVHCFDWELPNNMLPDGLDMTEEFGLTVPRAKHLLAIPSYRLR  494



>ref|XP_008234579.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=498

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R ++KAI+LDMLAG+MDT+AT +EW +SEL +HP +MK +++ELE
Sbjct  270  MLGFMGSEESEYRIERSNIKAIILDMLAGAMDTTATAIEWTLSELIKHPRVMKKVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG++R VEE DLE LEYL+MV+KE+ R+HPVAPLLLPHAA+EDC V+GFHIP+++R++
Sbjct  330  NVVGMEREVEESDLEKLEYLDMVVKETMRLHPVAPLLLPHAAIEDCNVSGFHIPRKSRVM  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +NI+AIG DP++W+D +KFIP RF G+NI++RGRDF+ IPFGSGRR CPG+QLGIT+V+L
Sbjct  390  INIFAIGRDPSIWTDAEKFIPERFDGSNIDFRGRDFQFIPFGSGRRGCPGMQLGITMVQL  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            +VAQLVHCFDW+LPN M P ELDMTEEFGL V RAKHL+A+PTYRL+
Sbjct  450  VVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAKHLLAVPTYRLQ  496



>ref|XP_006354708.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=493

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 191/229 (83%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+ +IM+SGE    F R HVKAI+LD+L  SMDTSAT ++WI++EL RHP +MK L+ EL
Sbjct  265  TLMEIMQSGEGEFDFDRRHVKAILLDLLVASMDTSATTIDWILAELLRHPNVMKKLQNEL  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG +RMVEE DLE+LEYLEMVIKES R+HPVAPLL+PH ++EDC V+GFHIPK +R+
Sbjct  325  EQVVGKNRMVEESDLENLEYLEMVIKESSRLHPVAPLLIPHESIEDCEVDGFHIPKGSRL  384

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N+W IG DP++W +P+ F P RF G+NI+ RGR FEL+PFGSGRRSCPGLQLG+T VR
Sbjct  385  LINVWTIGRDPDIWVEPENFKPERFQGSNIDLRGRHFELLPFGSGRRSCPGLQLGLTTVR  444

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L++AQLVHCFDW LPNGM+PK++DMTE+FGLV TR +HL  IP YRL +
Sbjct  445  LVLAQLVHCFDWKLPNGMTPKDIDMTEKFGLVTTRVQHLRLIPKYRLHI  493



>ref|XP_011078642.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 192/229 (84%), Gaps = 1/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGES-TIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEE  585
            TM  IM+SG++   QF R HVKAIMLDMLAGSMDT+A+ VEWI+SEL R+P  MK +++E
Sbjct  271  TMMSIMQSGQTREFQFDRRHVKAIMLDMLAGSMDTAASSVEWILSELLRNPTTMKKVQKE  330

Query  584  LERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRAR  405
            LE  VGL+RMVEE D++ LEYL+MV+KE+FR+HPVAPLL+PH AMEDC VNG+ IPK +R
Sbjct  331  LEEVVGLERMVEESDIDQLEYLDMVVKETFRLHPVAPLLIPHYAMEDCTVNGYDIPKASR  390

Query  404  IIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            II+N  AIG DP+ WS+P+KFIP RF G+ I+ RG+ F+L+PFGSGRR CPG+QLG+  V
Sbjct  391  IIINTHAIGRDPDAWSEPEKFIPERFVGSEIDVRGQHFQLLPFGSGRRGCPGMQLGLIQV  450

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            RL+V+QLVHCFDW LPNG+ PKELDM EEFGLVV RA HLMAIPT+RL+
Sbjct  451  RLIVSQLVHCFDWRLPNGVLPKELDMAEEFGLVVNRANHLMAIPTFRLQ  499



>ref|XP_008227118.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 187/227 (82%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R H+KAIMLDML  SMDTS+T +EW +SEL RHP+ MK +++ELE
Sbjct  268  MVGFMGSEESEYRIERPHIKAIMLDMLVASMDTSSTTIEWALSELMRHPKAMKKVQKELE  327

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGLD+MVEE DL  L+YL MV+KE+FR+HPVAPLL+PHA+ EDC VNG+HIPK++R++
Sbjct  328  NVVGLDKMVEESDLGKLDYLNMVVKETFRLHPVAPLLVPHASTEDCTVNGYHIPKKSRVL  387

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N+WA G DPN W+D +KFIP RF G++++  G  F+LIPFGSGRR CPG+QLG+TVV+L
Sbjct  388  INVWATGRDPNAWTDAEKFIPERFEGSSVDVTGNHFQLIPFGSGRRRCPGIQLGLTVVQL  447

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCFDW+LPN M P+ELDMTEEFGL V RAKHL+AIP+YRLR
Sbjct  448  VLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRLR  494



>ref|XP_009600860.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=487

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 190/229 (83%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+  IM+S E+  +F R HVKAI+LD+L  SMDTS+T VEWI+SEL RHP +MK L+ EL
Sbjct  258  TLMGIMQSEEAEFEFDRRHVKAILLDLLMASMDTSSTTVEWILSELIRHPNVMKKLQNEL  317

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG +RMVEE DLE+LEYLEMVIKE FR+HPV PLL+PH +++DC V+GFHI K +RI
Sbjct  318  EQVVGKNRMVEESDLENLEYLEMVIKEGFRLHPVVPLLIPHESIKDCTVDGFHIRKGSRI  377

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG DP+VWS+P+KFIP RF G NI+ +G  F+L+PFG GRRSCP LQLG+T+VR
Sbjct  378  LVNVWAIGRDPDVWSEPEKFIPERFLGCNIDLKGHSFQLLPFGFGRRSCPSLQLGLTIVR  437

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            LL+AQLVHCFDW LPN M PK+L+M E+FGLV TR +HLMAIPTYRL +
Sbjct  438  LLIAQLVHCFDWKLPNNMLPKDLNMNEKFGLVTTRVQHLMAIPTYRLHI  486



>ref|XP_006346716.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 191/229 (83%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SGE+  +F R HVKAI+LD+L  S+DTSAT ++WI SEL RHP IMK L++EL
Sbjct  271  TMMNIMQSGEAEFEFDRRHVKAILLDLLIASIDTSATSIDWIFSELLRHPNIMKKLQKEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG++RMVEE DL  LEYL M+IKE FR+HP+APLL+P  +MEDC+++GF+IP+ +RI
Sbjct  331  EQVVGMNRMVEESDLGKLEYLNMIIKEGFRLHPIAPLLIPRESMEDCIIDGFNIPRGSRI  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN WAIG D  VW +P+KF+P RF G++I+ RG DF+L+PF SGRR CPGLQLG+TVVR
Sbjct  391  LVNTWAIGRDSEVWPEPEKFMPERFVGSDIDLRGHDFQLLPFSSGRRRCPGLQLGLTVVR  450

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L++AQLVHCFDW LPN M P +LDMTE+F LVV+RA+HLMAIPTYRL +
Sbjct  451  LVIAQLVHCFDWKLPNDMMPNDLDMTEKFSLVVSRAQHLMAIPTYRLHV  499



>ref|XP_004237154.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=499

 Score =   317 bits (813),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SGE+  +F R H+KAI+LD+L  S+DTSAT ++WI SEL RHP++MK L++EL
Sbjct  271  TMMNIMQSGEAEFEFDRRHIKAILLDLLIASIDTSATSIDWIFSELVRHPKVMKKLQKEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG++R+VEE DLE L+YL+M+IKE FR+HP+APLL+PH +++DC+++GF+I + +RI
Sbjct  331  EQVVGMNRIVEESDLEKLKYLDMIIKEGFRLHPIAPLLIPHESIKDCIIDGFNITRGSRI  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN WAIG DP VW +P+KF+P RF G++I+ RGRDF+L+PF SGRRSCPGLQLG+ VVR
Sbjct  391  LVNTWAIGRDPEVWPEPEKFMPERFVGSDIDLRGRDFQLLPFSSGRRSCPGLQLGLIVVR  450

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L++AQLVHCFDW LPN M P +LDMTE+FGLVV+RA+HL+AIPTYRL +
Sbjct  451  LVIAQLVHCFDWKLPNDMMPNDLDMTEKFGLVVSRAQHLVAIPTYRLHV  499



>ref|XP_009607200.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=497

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 194/229 (85%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+  IM+S E+  +F R HVKA++LD+L  S DTS+T +EWI++EL RHP++MK L+ EL
Sbjct  268  TLMGIMQSKEAEFEFDRRHVKAVLLDLLIASTDTSSTTIEWILTELLRHPDVMKKLQCEL  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG +RMVEE D E+L+YL+MVIKES R+HPVAPLL+PH ++EDCV++GFHIPK +R+
Sbjct  328  EQVVGKNRMVEELDFENLQYLDMVIKESCRLHPVAPLLIPHESIEDCVIDGFHIPKGSRL  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG D + W +P+KF P RF G+NI+  G++F+L+PFGSGRRSCPGLQLG+T+VR
Sbjct  388  LVNVWAIGRDSDTWLEPEKFKPERFQGSNIDLGGQNFQLLPFGSGRRSCPGLQLGLTIVR  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L+VAQL+HCFDW+LPNGM P+ +DMTE+FGLV  RA+HLMAIPTYRL +
Sbjct  448  LVVAQLIHCFDWELPNGMLPEHIDMTEKFGLVTARAQHLMAIPTYRLHM  496



>ref|XP_006428070.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
 ref|XP_006493870.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41310.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
Length=498

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M     S ++  +  REH+KAI+LDMLAG+MDTS TVVEW +SEL +HP +MK L+ ELE
Sbjct  271  MLSFEGSEDTEKKIEREHIKAILLDMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELE  330

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL RMVEE DLE LEYL+MV+KE+ R+HPVAPL+ PH +MEDC VNGFHIPK++R+I
Sbjct  331  NIVGLKRMVEESDLEILEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVI  390

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAIG DP  W+DP+KF P RF G++++ RGRDF+L+PFGSGRR+CPG+QL +TVV+ 
Sbjct  391  VNAWAIGRDPKAWNDPEKFFPERFIGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQ  450

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            + AQLVHCFDW+LP GM P ELDMTEEFGLV  RAKHL+A+P+YRL
Sbjct  451  VTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRL  496



>ref|XP_011100884.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=496

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M  IM+SGE+  +F R +VKA++LD+L   MDTSA   EW  SEL RHP++MK L+ ELE
Sbjct  269  MMAIMESGEAEFEFDRRNVKAVLLDLLIAGMDTSAAATEWAFSELIRHPQVMKKLQNELE  328

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL++MVEE  L+ LEYL+ V+KE+ R+HPVAPLL+PH +M+DCV++GFHIPK +R +
Sbjct  329  TVVGLEQMVEESHLDRLEYLDFVVKETLRLHPVAPLLVPHESMQDCVIDGFHIPKGSRTM  388

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VNIWAIG DPNVW DP+ F P RF G+NI+ RGRDF LIPFGSGRR CPGLQLG+T+VRL
Sbjct  389  VNIWAIGRDPNVWPDPEAFKPERFIGSNIDIRGRDFRLIPFGSGRRGCPGLQLGLTMVRL  448

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            LVAQLVHCFDW+LPN M P +LDM+E FGLV +RAKHLMAIP YRL
Sbjct  449  LVAQLVHCFDWELPNCMLPSDLDMSEHFGLVTSRAKHLMAIPRYRL  494



>ref|XP_011100886.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=520

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 187/227 (82%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SG +  QF R HVKA++LD+L   +DTS + +EW ++EL RHP +MK L++EL
Sbjct  292  TMMEIMESGNAEFQFDRRHVKAVLLDILIAGIDTSTSAIEWALAELIRHPRVMKKLQKEL  351

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG+D+MVEE  L  LEYL+ V+KE+ R+HPV PLL+PH +MEDCV++G+HIPK +R 
Sbjct  352  ETVVGMDQMVEESHLHGLEYLDFVVKETLRLHPVGPLLIPHESMEDCVIDGYHIPKGSRA  411

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+WAIG DPNVW DP+ F P RF G+NI+ RGRDF+L+PFGSGRRSCPGLQLG+T+V+
Sbjct  412  IVNVWAIGRDPNVWPDPEVFKPERFIGSNIDLRGRDFQLLPFGSGRRSCPGLQLGLTMVQ  471

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+++QLVHCFDW LPNGM P +LDM+E FGL V RAKHL+AIP+YRL
Sbjct  472  LVLSQLVHCFDWQLPNGMQPSDLDMSEHFGLTVARAKHLVAIPSYRL  518



>ref|XP_010099912.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB80841.1| Cytochrome P450 71A1 [Morus notabilis]
Length=500

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  +  R ++KAI+LDM+AGSMDTS+T  EW +SEL ++P ++K +++ELE
Sbjct  272  MLSFMGSKESEYRIERTNIKAIILDMVAGSMDTSSTATEWAISELIKNPRVLKKVQKELE  331

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+DR VEE DLE LEYL+MV+KE+ R+HPVAPLL+PHAAMEDC+VNGFHIP ++R++
Sbjct  332  TVVGMDRTVEESDLERLEYLDMVVKETLRLHPVAPLLIPHAAMEDCIVNGFHIPNKSRVM  391

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N++AIG DPN W+DP+KF P RF G++++ RGRDF+LIPFGSGRR CPG+QLG+TVVRL
Sbjct  392  INVYAIGRDPNSWTDPEKFFPERFVGSSVDLRGRDFQLIPFGSGRRGCPGMQLGLTVVRL  451

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            LVAQLVHCFDW+LPNGM P ELDM EEFGL   RA HLMAIPT RL+
Sbjct  452  LVAQLVHCFDWELPNGMLPAELDMEEEFGLTTPRANHLMAIPTCRLQ  498



>ref|XP_007213194.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
 gb|EMJ14393.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
Length=494

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M  IM S ES  +  R ++KAI+LDML  SMDTS+T +EW++SEL RHP +MK +++EL
Sbjct  266  VMVGIMGSAESQYRIERSNIKAIILDMLVASMDTSSTTIEWVLSELMRHPHVMKKVRKEL  325

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+RMVEE DLE LEYL++V+KE+ R+HPVAPLL+PHAA+EDC VNGFHIPK +R+
Sbjct  326  EDVVGLERMVEESDLEKLEYLDIVVKETLRLHPVAPLLIPHAAIEDCTVNGFHIPKASRV  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N+W+IG DP+ W+D +KFIP RF G+NI+ RG  FELIPFGSGRR CPG+QL +T+V+
Sbjct  386  IINVWSIGRDPSAWTDAEKFIPERFVGSNIDVRGNHFELIPFGSGRRRCPGIQLRLTMVQ  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW+LPN M P ELDM+EEFGL V RAKHL+AIP+YRL
Sbjct  446  LMVAQLVHCFDWELPNSMLPNELDMSEEFGLTVPRAKHLLAIPSYRL  492



>ref|XP_009767392.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 187/227 (82%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  +F R HVKAI+LDML  SMDTSAT VEWI+SEL RHP++MK L++EL
Sbjct  267  TMMAIMQSGEAGFEFDRRHVKAILLDMLTASMDTSATSVEWILSELLRHPQVMKKLQKEL  326

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGLDRMVEE DLE+L+YL+MVIKE+ R+H VAPLL  H ++EDCVV+GF + K +RI
Sbjct  327  EEVVGLDRMVEESDLENLKYLDMVIKEALRLHSVAPLL-NHESIEDCVVDGFFVQKGSRI  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN++A   D N W +P KF P RF  +N++ RG DF+L+PFGSGRRSCPG+QLGI +VR
Sbjct  386  IVNVYAAQRDSNAWPEPDKFFPERFVESNVDLRGHDFQLLPFGSGRRSCPGMQLGIIIVR  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW+LPNGM P ELDM+E+FGLV  RAKHLMA+PTYRL
Sbjct  446  LVVAQLVHCFDWELPNGMQPSELDMSEQFGLVTYRAKHLMAVPTYRL  492



>ref|XP_004237435.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=500

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 191/229 (83%), Gaps = 1/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIM+SGE+  +F R HVKA++LDML  SMDTSAT VEWI++EL RHP +MK L++EL
Sbjct  273  TMMDIMQSGEAGFEFDRRHVKAVLLDMLMASMDTSATSVEWILTELLRHPHVMKKLQKEL  332

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VGLDRMV+E DLE+L YL+MVIKE+ R+H  APLL+ H ++EDCVV+GF + K +RI
Sbjct  333  EQVVGLDRMVDESDLENLNYLDMVIKEALRLHSAAPLLI-HESIEDCVVDGFFVQKGSRI  391

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN++A   DPN W +P KF+P RF  ++++ RG DF+L+PFGSGRRSCPG+QLGI +VR
Sbjct  392  VVNVYAAQRDPNAWPEPDKFLPERFVESSVDLRGHDFQLLPFGSGRRSCPGMQLGIIIVR  451

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L+VAQLVHCFDW+LPNGM P ELDM+E+FG+V  RAKHLMAIPTYRL+L
Sbjct  452  LVVAQLVHCFDWELPNGMQPSELDMSEQFGVVTCRAKHLMAIPTYRLQL  500



>ref|XP_006365792.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 188/229 (82%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  +F R HVKA++LD+L  S DT +T ++WI SEL RHP++MK L+ EL
Sbjct  271  TMMTIMQSGEAEFKFDRRHVKAVLLDLLIASTDTISTAIDWIFSELLRHPKVMKKLQNEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG++RMVEE DLE LEYL+MVIKE  R+HP +PLL PH ++EDC+V+GF +PK +R+
Sbjct  331  EQAVGINRMVEESDLERLEYLDMVIKEGLRLHPPSPLLTPHESIEDCIVDGFDVPKGSRL  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             VN+WAIG DP  W DP+KF+P RF  +NI+ RG DF+L+PFGSGRRSCPGLQLG+T+VR
Sbjct  391  FVNVWAIGRDPEAWPDPEKFMPERFIDSNIDLRGHDFQLLPFGSGRRSCPGLQLGLTIVR  450

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L++AQLVHCFDW+LPNGM P  +DMTE+FGLV  RA+HLMAIPTYRL +
Sbjct  451  LVLAQLVHCFDWELPNGMMPNHIDMTEKFGLVTPRAQHLMAIPTYRLNV  499



>gb|KDP35215.1| hypothetical protein JCGZ_09374 [Jatropha curcas]
Length=499

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 191/226 (85%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M + + S  S     R+H+KAI+LDMLAGSMDTSA V+EW +SEL +HP IMK +++ELE
Sbjct  272  MLEFVGSEVSEYHIGRDHIKAIILDMLAGSMDTSAAVIEWALSELLKHPRIMKKVQKELE  331

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             +VGL++MVEE DLE+LEYLEMVIKE+FR+HPVAPLL+PH A +D +V+G+ IPK + I+
Sbjct  332  LKVGLNKMVEESDLENLEYLEMVIKETFRLHPVAPLLIPHQATQDTIVDGYLIPKNSHIV  391

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N WAIG DP+ W+DP++F+P RF+G N+++RGRDF+L+PFGSGRR CPG+QLG+TVVRL
Sbjct  392  INTWAIGRDPSAWTDPERFLPERFAGNNVDFRGRDFQLLPFGSGRRGCPGIQLGVTVVRL  451

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            ++AQLVHCFDW+LPN M P ELDM+EEF LV  RAKHL+A+PTYRL
Sbjct  452  VLAQLVHCFDWELPNDMLPNELDMSEEFSLVTPRAKHLLALPTYRL  497



>emb|CDP12853.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+  +MKS E+  +F R H+KA+++D+L  +MDT+AT VEWI++EL ++P +MK +++EL
Sbjct  205  TILALMKSKETEFEFDRRHIKAVLVDLLTAAMDTTATTVEWILAELLKNPRVMKKVQQEL  264

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            + +VGL RMVEE +LE+L YL+MV+KE+ R+HPV PLLLPHAA+EDC+V+GFHIPK +R+
Sbjct  265  DEKVGLHRMVEESELENLTYLDMVVKEALRLHPVVPLLLPHAALEDCIVDGFHIPKDSRV  324

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             +N W IG DPN WSDP+KF P RF G+NI+ RG DF+LIPFGSGRR CPG+QLG+TVVR
Sbjct  325  TINAWTIGRDPNAWSDPEKFTPERFIGSNIDVRGHDFQLIPFGSGRRICPGMQLGLTVVR  384

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++A++VHCF+W+LPNGM P ELDMTEEFGLV+TRAKHLMAIPTYRL
Sbjct  385  LMLARMVHCFNWELPNGMLPSELDMTEEFGLVMTRAKHLMAIPTYRL  431



>ref|XP_002310011.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
 gb|EEE90461.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
Length=493

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   MKS E+     +  +KAIMLDMLAGSMDTS+TV++W  SEL ++P +MK +++EL
Sbjct  265  VMLSCMKSEENEYLVDQGCMKAIMLDMLAGSMDTSSTVIDWAFSELIKNPRVMKKVQKEL  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG  RMVEE DLE LEYL+MV+KE+FR+HPV PLL+PH AMEDC+VNGFHIPK++ +
Sbjct  325  EEVVGKQRMVEESDLESLEYLDMVVKETFRLHPVGPLLIPHEAMEDCIVNGFHIPKKSHV  384

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N+WAIG DP  W+D + F P RF G++I+ RGR+F+LIPFG+GRRSCPG+QLG+TVVR
Sbjct  385  IINVWAIGRDPKAWTDAENFYPERFVGSDIDVRGRNFQLIPFGAGRRSCPGMQLGLTVVR  444

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPNG+ P E+DMTEEFGLV+ R+KHL+AIPTYRL
Sbjct  445  LVLAQLVHCFDWELPNGILPSEVDMTEEFGLVICRSKHLVAIPTYRL  491



>ref|XP_006354707.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=383

 Score =   308 bits (789),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+ +IM+SGE+  +F R HVKAI+LD+L  SMDTS+T +EWI+SELFRHP +MK L+ EL
Sbjct  154  TLMEIMQSGEAEFEFDRRHVKAILLDLLVASMDTSSTSIEWILSELFRHPNVMKKLQSEL  213

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG   +VEE+DLE+L+YL MVIKE FR+HPVAPLLLPH ++EDC ++GFHIPK +R+
Sbjct  214  DYVVGQKGIVEEKDLENLDYLNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFHIPKGSRV  273

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG DP+VW +P+KFIP RF  + I+ RG++F+L+PFGSGRRSCPGLQLG+T+VR
Sbjct  274  LVNVWAIGRDPDVWHEPEKFIPERFVESTIDVRGQNFQLLPFGSGRRSCPGLQLGLTIVR  333

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVH FDW+ PNGM   +++MTE+FGLV  RA  LMAIP YRL
Sbjct  334  LVVAQLVHSFDWEFPNGMMSCDINMTEKFGLVTARALSLMAIPIYRL  380



>gb|EYU24031.1| hypothetical protein MIMGU_mgv1a004909mg [Erythranthe guttata]
Length=505

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+  IM+SG++  QF R HVKAIMLDMLA SMDT+A+ VEWI++ L ++P++MK ++EEL
Sbjct  277  TLMSIMQSGDAEFQFDRGHVKAIMLDMLAASMDTAASTVEWILALLIKNPKVMKKVQEEL  336

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VGL+RMVEE DL+ L+YL+MV+KE+FR+HPVAPLL+PH + EDC VNG+HIPK +R+
Sbjct  337  EQVVGLERMVEESDLDQLKYLDMVVKETFRLHPVAPLLIPHYSTEDCTVNGYHIPKESRV  396

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN  AIG DPNVW+ P +F P RF G+ I+ RG+ FEL+PFGSGRR CPG+QLG+  VR
Sbjct  397  IVNTHAIGRDPNVWARPNEFFPERFVGSEIDLRGQHFELLPFGSGRRGCPGMQLGLIQVR  456

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+V+QLVHCFDW LP GM P+ELDMTEEF LVV+RA  L+AIPT+RLR
Sbjct  457  LIVSQLVHCFDWKLPEGMLPEELDMTEEFSLVVSRANPLIAIPTFRLR  504



>ref|XP_011013422.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=493

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   MKS E+     +  +KAIMLDMLAGSMDTSATV++W  SEL ++P +MK L++EL
Sbjct  265  VMLSFMKSEENEHLVDQGCMKAIMLDMLAGSMDTSATVIDWAFSELIKNPRVMKKLQKEL  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG  RMVEE DLE LEYL+MV+KE+ R+HP  PL++PH AMEDC+VNGFHIPK++ +
Sbjct  325  EEAVGKQRMVEESDLERLEYLDMVVKETLRLHPAGPLMIPHEAMEDCIVNGFHIPKKSHV  384

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N+WAIG DP  W+D +KF P RF G++I+ RGR+F+LIPFG+GRRSCPG+QLG+TVVR
Sbjct  385  IINVWAIGRDPKAWTDAEKFYPERFVGSDIDVRGRNFQLIPFGTGRRSCPGMQLGLTVVR  444

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPNG+ P E+DMTEEFGLV+ R+KHL+AIPTYRL
Sbjct  445  LVLAQLVHCFDWELPNGILPSEVDMTEEFGLVMCRSKHLVAIPTYRL  491



>ref|XP_009372714.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 190/227 (84%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D M S +S  +    ++KAIMLDM AGSMDT++T VEW +SEL RHP++MKT+++ELE
Sbjct  272  MVDFMGSEDSDYRIEHTNIKAIMLDMFAGSMDTTSTTVEWALSELMRHPQVMKTVQKELE  331

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL+RMVEE DLE L+YL+MV+KE+ R+HPVAPLL+PHAA+EDC+V+G+H+PK++R+I
Sbjct  332  NVVGLNRMVEESDLEKLDYLDMVVKETLRLHPVAPLLVPHAAIEDCIVDGYHVPKKSRVI  391

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N WAIG DP+ W D +KF+P RF G +++ RG  F+LIPFGSGRR CPG+QLG+TVV+ 
Sbjct  392  INAWAIGRDPSAWEDAEKFVPERFEGNSVDVRGNHFQLIPFGSGRRRCPGIQLGLTVVKF  451

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCFDW+LP+ M P +LDMTE FG+ V+RAKHL+AIP+YRL+
Sbjct  452  VLAQLVHCFDWELPDNMLPNDLDMTEGFGITVSRAKHLLAIPSYRLQ  498



>ref|XP_011025622.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Populus euphratica]
Length=493

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   MKS E+     +  +KAIMLDMLAGSMDTSATV++W  SEL ++P +MK L++ELE
Sbjct  266  MLSFMKSEENEHLVDQGCMKAIMLDMLAGSMDTSATVIDWAFSELIKNPRVMKKLQKELE  325

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG  RMVEE DLE LEYL+MV+KE+ R+HP  PL++PH AMEDC+VNGFHIPK++ +I
Sbjct  326  EVVGKQRMVEESDLERLEYLDMVVKETLRLHPAGPLMIPHEAMEDCIVNGFHIPKKSHVI  385

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N+WAIG DP  W+D +KF P RF G++I+ RGR+F+LIPFG+GRRSCPG+QLG+TVVRL
Sbjct  386  INVWAIGRDPKAWTDAEKFYPERFVGSDIDVRGRNFQLIPFGTGRRSCPGMQLGLTVVRL  445

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            ++AQLVHCFDW+LPNG+ P E+DMTEEFGLV+ R+KHL+AIPTYRL
Sbjct  446  VLAQLVHCFDWELPNGILPSEVDMTEEFGLVMCRSKHLVAIPTYRL  491



>ref|XP_002310014.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90464.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 185/228 (81%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + S E+     R+++KAI+LDML GSMDTSAT +EW +SEL RHP +MK +++ELE
Sbjct  270  MLDFLGSEETEYSIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIRHPRVMKKVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             ++G+DRMVEE DLE LEYL MVIKE+FR+HPVAPLL PH +MEDC ++GF IP++ R+I
Sbjct  330  EKIGMDRMVEESDLEGLEYLHMVIKEAFRLHPVAPLLGPHESMEDCTIDGFLIPQKTRVI  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG D + W+D  KFIP RF+G+NI+ RGRDF+L+PFG+GRR CPG+ LG+T+VR 
Sbjct  390  VNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPGMHLGLTMVRQ  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            +VAQLVHCFDW+LPN M P+ELDMTE FGLV  RA HL A PTYRL L
Sbjct  450  IVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLHL  497



>ref|XP_006380462.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
 gb|ERP58259.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
Length=497

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 186/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + S E+  +  R+++KAI+LDML GSMDTSAT +EW +SEL RHP +MK +++ELE
Sbjct  270  MLDFLGSEETEYRIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIRHPRVMKKVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             ++G+DRMVEE DLE LEYL MVIKE+FR+HPVAPLL PH +MEDC ++GF IP++ R+I
Sbjct  330  EKIGMDRMVEESDLEGLEYLHMVIKEAFRLHPVAPLLGPHESMEDCTIDGFLIPQKTRVI  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG D + W+D  KFIP RF+G+NI+ RGRDF+L+PFG+GRR CPG+ LG+T+VR 
Sbjct  390  VNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPGMHLGLTMVRQ  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            +VAQLVHCFDW+LPN M P+ELDMTE FGLV  RA HL A PTYRL L
Sbjct  450  IVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLHL  497



>ref|XP_010319819.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=304

 Score =   303 bits (777),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+ +IM+SGE+  +F R HVKAI+LD+L  SMDTS+T +EWI+SELF+HP +MK L+ EL
Sbjct  75   TLMEIMQSGETEFEFDRRHVKAILLDLLVASMDTSSTSIEWILSELFKHPNVMKKLQSEL  134

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG   +VEE+DLE+L+YL MVIKE FR+HPVAPLLLPH ++EDC ++GF IPK +R+
Sbjct  135  DNVVGQKGIVEEKDLENLDYLNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFQIPKGSRV  194

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG DP+VW +P+KFIP RF  + I+ RG++F+L+PFGS RRSCPGLQLG+T+VR
Sbjct  195  LVNVWAIGRDPDVWHEPEKFIPERFVESTIDVRGQNFQLLPFGSSRRSCPGLQLGLTIVR  254

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVH FDW+LPNG  P +++MTE+FGLV  RA  LMAIP YRL
Sbjct  255  LVVAQLVHSFDWELPNGTMPNDINMTEKFGLVTARALSLMAIPIYRL  301



>ref|XP_008440668.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   310 bits (795),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 183/226 (81%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D++ S ++  Q  R  +KAIMLDMLA +MDTS+T + W MSEL R P++MK ++ EL+
Sbjct  272  MLDLIDSQQTEYQIDRSTIKAIMLDMLAAAMDTSSTTIGWAMSELIRQPDVMKKMQSELQ  331

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VGLDRMVEE DL  LEYLEMV+KE  R++P  PLL+PH ++EDC VNGFHIPK++R+I
Sbjct  332  KVVGLDRMVEESDLVSLEYLEMVVKEIMRLYPAGPLLIPHESLEDCTVNGFHIPKKSRLI  391

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAIG DP+VW+DP KF P RF G+ I+ +G+DFELIPFG+GRR CPG+QLG+T+VRL
Sbjct  392  VNAWAIGRDPSVWNDPHKFFPERFIGSQIDLKGKDFELIPFGAGRRGCPGMQLGLTMVRL  451

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+AQLVHCFDW+LPNGM P ELDMTEEFGL   RA+ LM IPT+RL
Sbjct  452  LLAQLVHCFDWELPNGMLPSELDMTEEFGLTCPRAQDLMVIPTFRL  497



>ref|XP_010030392.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54382.1| hypothetical protein EUGRSUZ_I00333 [Eucalyptus grandis]
Length=499

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 184/228 (81%), Gaps = 2/228 (1%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M  IM   E      R H+KAI+LDMLAGSMDTSAT +EW M+EL +HP  MK L+EELE
Sbjct  270  MLGIMGLNEGEYHIDRPHIKAIILDMLAGSMDTSATAIEWAMAELIKHPRAMKKLREELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            +  GL+R+VEE DLE L+YL MVIKE+ R+HPVAPLLLPH A EDC VNGFHIP ++R+I
Sbjct  330  KAAGLNRVVEESDLEGLDYLHMVIKETMRLHPVAPLLLPHEATEDCTVNGFHIPYKSRVI  389

Query  398  VNIWAIGHDPNVWS--DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            VN+W+IG DP VW+  DP++F+P RF G++++ +GRDF+L+PFG+GRR CPG+QLG+TVV
Sbjct  390  VNVWSIGRDPKVWTTHDPEEFVPERFLGSSVDVKGRDFQLLPFGTGRRGCPGMQLGLTVV  449

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            R +VAQLVHCFDW+LP+GMSP ELDMTE+FGL   RAKHL+  P YRL
Sbjct  450  RFVVAQLVHCFDWELPSGMSPSELDMTEKFGLATPRAKHLVVTPRYRL  497



>ref|XP_006354701.1| PREDICTED: cytochrome P450 84A1-like [Solanum tuberosum]
Length=496

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 189/229 (83%), Gaps = 1/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIM+SGE+  +F R HVKA++LDML  SMDTSAT VEWI++EL RHP +MK L++EL
Sbjct  269  TMMDIMQSGEAGFKFDRCHVKAVLLDMLMTSMDTSATSVEWILTELLRHPHVMKKLQKEL  328

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VGLDRMVEE DLE+L YL+MVIKE+ R+H  APLL+ H +++DCVV+GF + K +RI
Sbjct  329  EQVVGLDRMVEESDLENLNYLDMVIKEALRLHSAAPLLI-HESIQDCVVDGFFVQKGSRI  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN++A   DPN W +P KF+P RF  + ++ RG DF+L+PF SGRRSCPG+QLGI +VR
Sbjct  388  IVNVYAAQRDPNAWPEPDKFLPERFVESTVDLRGHDFQLLPFSSGRRSCPGMQLGIIIVR  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            L+VAQLVHCFDW+LPNGM P ELDM+E+FG+V  RAKHLMAIPTYRL+L
Sbjct  448  LVVAQLVHCFDWELPNGMQPSELDMSEQFGVVNCRAKHLMAIPTYRLQL  496



>gb|AJD25258.1| cytochrome P450 CYP736A123 [Salvia miltiorrhiza]
Length=488

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM SGE+  +F R H+KA++LD+L   MDTSAT  EW MSEL RHP +MK L+EEL
Sbjct  260  TMMAIMDSGEAGFEFDRTHIKAVLLDLLIAGMDTSATATEWTMSELLRHPTVMKKLQEEL  319

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+ MVEE  L+ LEYLE V+KE  R+HPVAPLL+PH +MEDC + GFHIPK++R+
Sbjct  320  ESMVGLESMVEESHLDKLEYLECVVKEVMRLHPVAPLLIPHESMEDCELQGFHIPKKSRV  379

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG DP+VW++P  F P RF G++I+ RGR FELIPF SGRR CPG+QLG  +V+
Sbjct  380  MVNVWAIGRDPDVWANPDSFTPERFVGSDIDMRGRHFELIPFSSGRRGCPGMQLGSALVK  439

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            LLVAQLVHCF W+LPNGM P ++DM+E FGLV  RAK LMA+PTYRL +
Sbjct  440  LLVAQLVHCFHWELPNGMKPHDIDMSEHFGLVTARAKRLMAVPTYRLHI  488



>ref|XP_002310015.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90465.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 186/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + S E+  +  R+++KAI+LDML GSMDTSA  +EW +SEL +HP +MK +++ELE
Sbjct  270  MLDFLGSEETEYRIGRDNIKAIILDMLVGSMDTSAAAIEWTLSELIKHPRVMKKVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             ++G+DRMVEE DLE LEYL MVIKE+FR+HPVAPLL+PH +MEDC ++GF IP++ R+I
Sbjct  330  EKIGMDRMVEESDLEGLEYLHMVIKEAFRLHPVAPLLVPHESMEDCTIDGFLIPQKTRVI  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG D + W+D  KFIP RF+G+NI+ RGRDF+L+PFGSGRRSCPG+ LG+T+VR 
Sbjct  390  VNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLPFGSGRRSCPGMHLGLTMVRQ  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            +VAQLVHCF+W+LPN M P+ELDMTE F LV  RA HL A PTYRL L
Sbjct  450  IVAQLVHCFEWELPNNMLPEELDMTEAFSLVTPRANHLCATPTYRLHL  497



>ref|XP_002310016.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
 gb|EEE90466.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
Length=497

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 185/228 (81%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + S E+  +  R+++KAI+LDML GSMDTSAT +EW +SEL RHP +MK +++ELE
Sbjct  270  MLDFLGSEETEYRIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIRHPRVMKKVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             ++G+DRMVEE DLE LEYL MVIKE+FR+HPVAPLL PH +MEDC ++GF IP++ R+I
Sbjct  330  EKIGMDRMVEESDLEGLEYLHMVIKEAFRLHPVAPLLGPHESMEDCTIDGFLIPQKTRVI  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG D + W+D  +FIP RF+G+NI+ RGRDF+L+PFG+GRR CPG+ LG T+VR 
Sbjct  390  VNVWAIGRDQSAWTDANRFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPGMHLGQTMVRQ  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            +VAQLVHCFDW+LPN M P+ELDMTE FGLV  RA HL A PTYRL L
Sbjct  450  IVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLHL  497



>ref|XP_004253509.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=493

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 188/228 (82%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIM+SGE+  QF R HVKA+MLDML  S+DTS++ +EW++SEL R+P+IMK L+ EL
Sbjct  265  TMMDIMQSGEAEFQFDRRHVKAVMLDMLVASIDTSSSSIEWMLSELLRNPDIMKKLQREL  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+RMV+E DLE+L+YL MV KESFR+H  APLLL H AMEDCVV+ F+I K +++
Sbjct  325  EEVVGLNRMVQESDLENLKYLNMVFKESFRLHAAAPLLL-HEAMEDCVVDDFYIKKGSQV  383

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN + I  DPN W+D  KF+P RF  +N++ RGRD++L+PFGSGRRSCPG+QL + +VR
Sbjct  384  IVNAYTIHRDPNFWTDADKFMPERFLESNVDVRGRDYQLLPFGSGRRSCPGMQLALIIVR  443

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCFDW+LPN M+PK+LDMTE+FG+V  RA HLMA+PTYRL+
Sbjct  444  LVVAQLVHCFDWELPNEMNPKDLDMTEQFGIVTGRANHLMAVPTYRLQ  491



>ref|XP_006348217.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
 ref|XP_006354706.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=492

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+ +IM+SGE+  +F R HVKAI+LD+L  SMDTS+T +EWI+SELFRHP +MK L+ EL
Sbjct  265  TLMEIMQSGEAEFEFDRRHVKAILLDLLVASMDTSSTSIEWILSELFRHPNVMKKLQSEL  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG   +VEE+DLE+L+YL MVIKE FR+HPVAPLLLPH ++EDC ++GFHIPK +R+
Sbjct  325  DYVVGQKGIVEEKDLENLDYLNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFHIPKGSRV  384

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG DP+VW +P+KFIP RF  + I+ RG++F+L+PFGSGRRSCPGLQLG+T+VR
Sbjct  385  LVNVWAIGRDPDVWHEPEKFIPERFVESTIDVRGQNFQLLPFGSGRRSCPGLQLGLTIVR  444

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVH FDW+ PNGM   +++MTE+FGLV  RA  LMAIP YR++
Sbjct  445  LVVAQLVHSFDWEFPNGMMSCDINMTEKFGLVTARALSLMAIPIYRVK  492



>ref|XP_009608339.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=495

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 187/227 (82%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  +F R H+KA++LDML  SMDTSAT VEW ++EL RHP +MK L++EL
Sbjct  267  TMMAIMQSGEAGFEFDRRHIKAVLLDMLMASMDTSATSVEWTLTELLRHPHVMKKLQKEL  326

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGLDRMVEE DLE+L+YL+MVIKE+ R+H  APLL+ H ++EDCVV+GF++ K +RI
Sbjct  327  EEVVGLDRMVEESDLENLKYLDMVIKEALRLHSAAPLLI-HESIEDCVVDGFYVQKGSRI  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN++A   DPN W +P KF P RF  +N++ RG DF+L+PFGSGRRSCPG+QLGI +VR
Sbjct  386  IVNVYAAQRDPNAWPEPDKFFPERFVESNVDLRGHDFQLLPFGSGRRSCPGMQLGIIIVR  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW+LPNGM P ELDM+E+FG+V  RAKHL+A+PTY+L
Sbjct  446  LVVAQLVHCFDWELPNGMQPSELDMSEQFGVVTCRAKHLIAVPTYKL  492



>gb|KDO35964.1| hypothetical protein CISIN_1g036473mg, partial [Citrus sinensis]
Length=204

 Score =   298 bits (762),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  686  DMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVI  507
            DMLAG+MDTS TVVEW +SEL +HP +MK L+ ELE  VGL RMVEE DLE+LEYL+MV+
Sbjct  1    DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV  60

Query  506  KESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRF  327
            KE+ R+HPVAPL+ PH +MEDC VNGFHIPK++R+IVN WAIG DP  W+DP+KF P RF
Sbjct  61   KETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERF  120

Query  326  SGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDM  147
             G++++ RGRDF+L+PFGSGRR+CPG+QL +TVV+ + AQLVHCFDW+LP GM P ELDM
Sbjct  121  VGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDM  180

Query  146  TEEFGLVVTRAKHLMAIPTYRL  81
            TEEFGLV  RAKHL+A+P+YRL
Sbjct  181  TEEFGLVTYRAKHLLAVPSYRL  202



>gb|AJD25256.1| cytochrome P450 CYP736A121 [Salvia miltiorrhiza]
Length=496

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE   QF R HVKAIMLDMLA SMDT+A  V+WI+SEL R+P +M+ +K+EL
Sbjct  268  TMMSIMQSGECEFQFDRRHVKAIMLDMLAASMDTAAASVDWILSELLRNPAVMEKVKKEL  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VGL RMVEE DL+ LEYL MV+KE++R+HPVAPLL+PH A E+  V+G++IPK +RI
Sbjct  328  EQVVGLKRMVEESDLDRLEYLNMVVKETYRLHPVAPLLIPHYAREESTVDGYNIPKESRI  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN +AIG DPN W+DP+KF+P RF G++I+ RG+ F+L+PFGSGRR CPG+QLG+  VR
Sbjct  388  IVNTYAIGRDPNAWTDPEKFLPERFVGSDIDVRGQHFQLLPFGSGRRGCPGIQLGLIQVR  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+V+QLVHCFDW LPN M PKEL+M E+F LVVTRA  LMAIP++RL+
Sbjct  448  LIVSQLVHCFDWQLPNDMPPKELNMDEDFSLVVTRANPLMAIPSFRLQ  495



>emb|CBI21487.3| unnamed protein product [Vitis vinifera]
Length=608

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D+M S E+     R ++KAI LDM+A SMDTSAT++EW +SEL +HP +MK +  ELE
Sbjct  381  MLDLMGSEETEYNIQRANIKAISLDMMAASMDTSATMIEWALSELIKHPPMMKKVINELE  440

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VG++RMVEE DLE LEYL MV+KE+ R+HPVAPLL+PH +MEDC V+GFHIP+++R+I
Sbjct  441  KVVGMERMVEESDLESLEYLNMVVKETLRLHPVAPLLIPHESMEDCTVDGFHIPQKSRVI  500

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG DPN W+D  KF+P RF  ++I++RG+ F+ IPFGSGRR CPG+QLG+TVVRL
Sbjct  501  VNVWAIGRDPNAWTDADKFLPERFMESDIDFRGQHFQFIPFGSGRRGCPGMQLGLTVVRL  560

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            ++AQLVHCFDW+LP+ M P ELDMTEEFGL + RAKHL+AIPT RL
Sbjct  561  VLAQLVHCFDWELPDNMLPSELDMTEEFGLTLPRAKHLVAIPTCRL  606


 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  749  IMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQV  570
            +M S  +     R  +KAI  DMLAGSM+TS++ ++W ++EL RHP +MK ++ ELE+ V
Sbjct  166  LMGSEGTGYNIERASIKAISFDMLAGSMETSSSSIDWAVAELIRHPRVMKKVQSELEKVV  225

Query  569  GLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCV  438
            G++RMVEE DLE LEYL MV+KE+ R++P  PLL+PH +MEDC 
Sbjct  226  GMERMVEESDLESLEYLNMVVKETLRLYPAGPLLVPHESMEDCT  269



>ref|XP_008364815.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=499

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S +S  +  R ++KAIMLDM AGSMDT++T VEW +SEL RHP++MK +++ELE
Sbjct  272  MVAFMGSEDSDYRIERTNIKAIMLDMFAGSMDTTSTTVEWALSELMRHPQVMKKVQKELE  331

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL+RMVEE DLE LEYL+MV+KE+ R+HPVAPLL+PHAA+EDC+V+G+H+PK++ +I
Sbjct  332  NVVGLNRMVEESDLEKLEYLDMVVKETLRLHPVAPLLVPHAAIEDCIVDGYHVPKKSLVI  391

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N WAIG D + W D +KF+P RF G N++ RG  F+LIPFGSGRR CPG+QLG+TVV+ 
Sbjct  392  INAWAIGRDQSAWEDAEKFVPERFEGNNVDVRGNHFQLIPFGSGRRRCPGIQLGLTVVQF  451

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCFDW+LP+ M P +LDMTE+FGL V+RAKHL+AIP+YRL+
Sbjct  452  VLAQLVHCFDWELPDNMLPNDLDMTEDFGLTVSRAKHLLAIPSYRLQ  498



>ref|XP_002276487.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=494

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D+M S E+     R ++KAI LDM+A SMDTSAT++EW +SEL +HP +MK +  ELE
Sbjct  267  MLDLMGSEETEYNIQRANIKAISLDMMAASMDTSATMIEWALSELIKHPPMMKKVINELE  326

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VG++RMVEE DLE LEYL MV+KE+ R+HPVAPLL+PH +MEDC V+GFHIP+++R+I
Sbjct  327  KVVGMERMVEESDLESLEYLNMVVKETLRLHPVAPLLIPHESMEDCTVDGFHIPQKSRVI  386

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG DPN W+D  KF+P RF  ++I++RG+ F+ IPFGSGRR CPG+QLG+TVVRL
Sbjct  387  VNVWAIGRDPNAWTDADKFLPERFMESDIDFRGQHFQFIPFGSGRRGCPGMQLGLTVVRL  446

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            ++AQLVHCFDW+LP+ M P ELDMTEEFGL + RAKHL+AIPT RL
Sbjct  447  VLAQLVHCFDWELPDNMLPSELDMTEEFGLTLPRAKHLVAIPTCRL  492



>ref|XP_008227122.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=496

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S ES  Q  R H+KAI++DML  SMDTS+T V+W +SEL RHP+ MK +++ELE
Sbjct  269  MVGFMGSEESEYQIERPHIKAIIMDMLVASMDTSSTTVDWALSELMRHPKAMKQVQKELE  328

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL+RMVEE DLE L+YL MV+KE+ R+HPVAPLL+PHAA EDC VNG+HIPK++R+I
Sbjct  329  DVVGLERMVEESDLEKLDYLSMVVKETLRLHPVAPLLVPHAATEDCTVNGYHIPKKSRVI  388

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N WAIG DP+ W+D ++FIP RF G++++ RG  F+LIPFGSGRR CPG+QLG+TVV+L
Sbjct  389  INAWAIGRDPSAWTDAEEFIPERFEGSDVDVRGNHFQLIPFGSGRRRCPGIQLGLTVVQL  448

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            ++AQLVHCFDW+LPN M P+ELDM+E FG+ V RAK L+AIP+YRL
Sbjct  449  MLAQLVHCFDWELPNNMLPEELDMSEVFGITVARAKRLIAIPSYRL  494



>emb|CDP01387.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M  IM+SGE+  +F R HVKA++LD+L  SMDTS T VEW +SEL R PE M+ L++ELE
Sbjct  270  MMGIMQSGEAEFEFDRRHVKAVLLDLLVASMDTSVTAVEWAISELLRRPEAMRKLQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             +VGL+R VEE D+E LEYL+MVIKE+ R+HPVAPLLLPH +MEDC V+ FHI K++RII
Sbjct  330  DKVGLERTVEESDVEGLEYLDMVIKETMRLHPVAPLLLPHESMEDCAVDDFHIQKKSRII  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N++AIGHDPNVW DP+ FIP RF  +NI+ RG+DF+LIPFGSGRR CPGLQLGI +VR 
Sbjct  390  INVYAIGHDPNVWPDPETFIPERFKDSNIDLRGQDFQLIPFGSGRRGCPGLQLGILLVRF  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCF+W+  + + P +LDM+E FGLV+ RAKHL  +PTYRL+
Sbjct  450  VLAQLVHCFNWEPADNIKPTDLDMSETFGLVLARAKHLKVVPTYRLQ  496



>ref|XP_007214404.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
 gb|EMJ15603.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
Length=496

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   M S ES  Q  R H+KAI++DML  SMDTS+T V+W +SEL RHP+ MK +++EL
Sbjct  268  VMVGFMGSVESEYQIERPHIKAIIMDMLVASMDTSSTTVDWALSELMRHPKAMKEVQKEL  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+RMVEE DLE L+YL MV+KE+ R+HPVAPLL+PHAA EDC+VNG+HIPK++R+
Sbjct  328  EDVVGLERMVEESDLEKLDYLSMVVKETLRLHPVAPLLVPHAATEDCIVNGYHIPKKSRV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N WAIG DP+ W+D ++FIP RF G++++ RG  F+LIPFGSGRR CPG+QLG+TVV+
Sbjct  388  IINAWAIGRDPSAWTDAEEFIPERFEGSDVDVRGNHFQLIPFGSGRRRCPGIQLGLTVVQ  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPN M P+ELDM+E FG+ V R K L+AIP+YRL
Sbjct  448  LMLAQLVHCFDWELPNNMLPEELDMSESFGITVERVKRLIAIPSYRL  494



>ref|XP_006493869.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=203

 Score =   295 bits (755),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -3

Query  683  MLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIK  504
            MLAG+MDTS TVVEW +SEL +HP +MK L+ ELE  VGL RMVEE DLE LEYL+MV+K
Sbjct  1    MLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLEILEYLDMVVK  60

Query  503  ESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFS  324
            E+ R+HPVAPL+ PH +MEDC VNGFHIPK++R+IVN WAIG DP  W+DP+KF P RF 
Sbjct  61   ETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFI  120

Query  323  GTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMT  144
            G++++ RGRDF+L+PFGSGRR+CPG+QL +TVV+ + AQLVHCFDW+LP GM P ELDMT
Sbjct  121  GSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMT  180

Query  143  EEFGLVVTRAKHLMAIPTYRL  81
            EEFGLV  RAKHL+A+P+YRL
Sbjct  181  EEFGLVTYRAKHLLAVPSYRL  201



>gb|EYU24035.1| hypothetical protein MIMGU_mgv1a020942mg [Erythranthe guttata]
Length=499

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  +M SGE+  +F R HVKA++ DML    DTS+T VEW +SEL RHP IMK L++EL
Sbjct  270  TMMAVMNSGEAGFEFDRRHVKAVLQDMLIAGTDTSSTSVEWAISELIRHPSIMKKLQKEL  329

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNG-FHIPKRAR  405
            E  VGL+ MVEE  LE LEYL+ V+KE+ R+HP APLL+P  +MEDC +NG FHIPK++R
Sbjct  330  ESTVGLNHMVEESHLEKLEYLDFVVKETLRLHPPAPLLIPRESMEDCTINGIFHIPKKSR  389

Query  404  IIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
             IVN+WAIG DP+ W++P+ F P RF+G++++ RGRDF+LIPFGSGRRSCPG QLG+TVV
Sbjct  390  AIVNVWAIGRDPSAWANPETFWPERFAGSDVDSRGRDFQLIPFGSGRRSCPGQQLGLTVV  449

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +L++AQLVHCFDW+LPNGM P +LDM+E FG+V++RA+HLM IP YRL
Sbjct  450  KLMLAQLVHCFDWELPNGMLPSDLDMSEHFGVVMSRAEHLMLIPKYRL  497



>ref|XP_008440671.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D++ S ++  Q  R  +KAIMLDMLA +MDTS+T + W MSEL RHP +MK +++EL+
Sbjct  272  MLDLIDSQQTEYQIDRSAIKAIMLDMLAAAMDTSSTTIGWAMSELIRHPYVMKKMQDELQ  331

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VGL RMVEE DL  LEYLEMV+KE  R++P APLL+PH ++EDC VNGFHIPK++R+I
Sbjct  332  KVVGLHRMVEESDLVCLEYLEMVVKEIMRLYPAAPLLIPHESLEDCTVNGFHIPKKSRLI  391

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAIG DP+VW+DP KF P RF G+ I+ +G+DFELIPFG+GRR CPG+QLG+T+VRL
Sbjct  392  VNAWAIGRDPSVWNDPHKFFPERFIGSQIDLKGKDFELIPFGAGRRGCPGMQLGLTMVRL  451

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+AQLVHCFDW+LPNGM P ELDM EEFGL   RA+ LM IP +RL
Sbjct  452  LLAQLVHCFDWELPNGMLPSELDMIEEFGLTCPRAQDLMIIPIFRL  497



>ref|XP_009615258.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 190/228 (83%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SGE+  QF R H+KAI+LDML  +MDTSAT VEWI++EL RHP +MK L++EL
Sbjct  267  TMMEIMQSGEAEFQFDRRHIKAILLDMLMAAMDTSATSVEWILTELLRHPNVMKKLQKEL  326

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG++RMVEE DLE+L+YL+MV+KE  R+H V P++  H AMEDCVV+GFHI K +RI
Sbjct  327  DEVVGIERMVEESDLENLKYLDMVVKEGLRLHSVVPIM-HHEAMEDCVVDGFHIQKGSRI  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +A+  DPNVW +P+KF P RF G++++ RGRDF+L+PFGSGRRSCPG+QLG+T+VR
Sbjct  386  MINCYAVQRDPNVWPEPEKFFPERFVGSSVDIRGRDFQLLPFGSGRRSCPGMQLGVTIVR  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCFDW++PNGM P +L++ E+FGLV  + K LMAIPTYRL+
Sbjct  446  LVVAQLVHCFDWEIPNGMQPLDLEIDEQFGLVTCKEKPLMAIPTYRLK  493



>ref|XP_009629564.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=431

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 189/228 (83%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SGE+  QF R+H+KAI++DML  + DTSAT VEWI++EL RHP +MK L++EL
Sbjct  204  TMMEIMQSGEAEFQFDRQHIKAILVDMLIAATDTSATSVEWILTELIRHPHVMKKLQKEL  263

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG++RMV+E DLE+++YL+MVIKE  R+H + P+L  H AMEDCVV+GFHI K +RI
Sbjct  264  DEVVGIERMVDESDLENMKYLDMVIKEGLRLHSIVPVL-HHEAMEDCVVDGFHIQKGSRI  322

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +AI  DPNVW +P+KF P RF G++++ RGRDF+L+PFGSG+RSCPG+QLGIT+VR
Sbjct  323  MINCYAIQRDPNVWPEPEKFFPERFVGSSVDIRGRDFQLLPFGSGKRSCPGMQLGITIVR  382

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCFDW+L NGM P +LD+ E+FG+V  + K LMAIPTYRL+
Sbjct  383  LVVAQLVHCFDWELQNGMQPLDLDIDEQFGMVACKEKPLMAIPTYRLK  430



>ref|XP_006428071.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
 ref|XP_006464323.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41311.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
Length=498

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 186/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M     S E+  +  REH+KAI+LDML+ +MDTSAT VEW +SEL +HP++MK L++ELE
Sbjct  271  MLSFEGSEETEHKIEREHIKAIILDMLSAAMDTSATAVEWALSELIKHPKVMKKLQKELE  330

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VGL RMVEE DLE+LEYL+MV+KE+ R+HPVAPLL+PH + EDC VNGF+IPK +R+I
Sbjct  331  KIVGLCRMVEESDLENLEYLDMVVKETLRLHPVAPLLIPHESTEDCTVNGFYIPKNSRVI  390

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG D   WSDP+ F P RF G++I+ RG DF+L+PFGSGRR CPG+QLG+T+V+ 
Sbjct  391  VNVWAIGRDTESWSDPEIFFPERFVGSSIDLRGHDFQLLPFGSGRRGCPGMQLGLTIVKQ  450

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            ++AQLVHCFDW+LP GM P ELD+TEEF LV  +AKHL+AIP+YRL +
Sbjct  451  VIAQLVHCFDWELPGGMLPTELDLTEEFSLVTPKAKHLLAIPSYRLNI  498



>ref|XP_002310007.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90457.2| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 183/228 (80%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + S E+     R+++KAI+LDML GSMDTSAT +EW +SEL +HP +MK +++ELE
Sbjct  270  MLDFLGSEETEYSIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIKHPRVMKKVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             ++G+DR VEE DLE LEYL MVIKE+FR+HPVAPLL+PH +MEDC ++GF IP++ R+I
Sbjct  330  EKIGMDRTVEESDLEGLEYLHMVIKEAFRLHPVAPLLIPHESMEDCTIDGFLIPQKTRVI  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG D + W+D  KFIP RF+G+NI+ RGRDF+L+PFG+GRR CPG+ LG+T+V  
Sbjct  390  VNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPGMHLGLTMVLQ  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            +VAQLVHCFDW+LPN M P+ELDMTE FGLV  RA HL A PTYR  L
Sbjct  450  IVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRHHL  497



>emb|CDP12933.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 183/226 (81%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M  IM+SGE+  +F R HVKAI+LD+L  SMDTS T VEW +SEL RHPE M+ L++ELE
Sbjct  270  MMGIMQSGEAEFEFDRRHVKAILLDLLVASMDTSVTAVEWAISELLRHPEAMRKLQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             +VGL+R+VEE D+E LEYL+MVIKES R+HPVAPLLLPH +MEDC V+ FHI K++RII
Sbjct  330  EKVGLERIVEESDIEGLEYLDMVIKESMRLHPVAPLLLPHESMEDCTVDDFHIQKKSRII  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +NI+ IG DPNVW DP+ F P RF  +NI+ RG+DF LIPFGSGRRSCPGLQLG+ +VR 
Sbjct  390  INIYTIGRDPNVWPDPETFNPERFKDSNIDLRGQDFRLIPFGSGRRSCPGLQLGLLLVRF  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            ++AQLVHCF+W+L + + P +LDM+E FG+V +RA HL  IPTYRL
Sbjct  450  VLAQLVHCFNWELADNIRPTDLDMSEAFGIVTSRATHLRVIPTYRL  495



>ref|XP_006380460.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
 gb|ERP58257.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
Length=497

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + S E+  +  R ++KAI+LDML GSMDT A  +EW +SEL +HP +MK +++ELE
Sbjct  270  MLDFLGSEETEYRIGRGNIKAIILDMLVGSMDTPAAAIEWTLSELIKHPRVMKKVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             ++G+DRMVEE DLE LEYL MVIKE+FR+HPVAPLL+PH +MEDC ++GF IP++ R++
Sbjct  330  EKIGMDRMVEESDLEGLEYLHMVIKEAFRLHPVAPLLVPHESMEDCTIDGFLIPQKTRVL  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG D + W+D  KFIP RF+G+NI+ RGRDF+L+ FG+GRRSCPG+ LG+T+VR 
Sbjct  390  VNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLTFGAGRRSCPGMHLGLTMVRQ  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            +VAQLVHCFDW+LPN M P+ELDMTE FGLV  RA HL A PTYRL L
Sbjct  450  IVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLHL  497



>ref|XP_004162327.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=504

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D++ S ++  Q  R  +KAIMLDMLAG+MDTS+T + W MSEL RHP++MK +++EL+
Sbjct  273  MLDLIDSQQTEYQIDRSAIKAIMLDMLAGAMDTSSTTIGWAMSELIRHPDVMKKMQDELQ  332

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL RMV+E DL +LEYLEMV+KE  R++P  PL +P  ++EDC V+GFHIPK++R+I
Sbjct  333  EVVGLHRMVQESDLVNLEYLEMVVKEIMRLYPAGPLSIPRESLEDCTVDGFHIPKKSRVI  392

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG DP+VW+DP KF P RF G+ I+ +G DFELIPFG GRR CPG+QLG+T+VRL
Sbjct  393  VNVWAIGRDPSVWNDPHKFFPERFIGSQIDLKGNDFELIPFGGGRRGCPGMQLGLTMVRL  452

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+AQLVHCFDW+LPNGM P ELDMTEEFGL   RA+ LM IPT+RL
Sbjct  453  LLAQLVHCFDWELPNGMLPPELDMTEEFGLTCPRAEDLMVIPTFRL  498



>ref|XP_002532045.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF30335.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=505

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 185/228 (81%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M S  S     R+++KAI+LDMLAGSMDTSA V+EW +SEL +HP +MK +++ELE
Sbjct  278  MLGFMGSEVSEYHIGRDNIKAIILDMLAGSMDTSAAVIEWALSELLKHPGVMKKVQKELE  337

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             +VG+ RMVEE D+E LEYLEMVIKE+FR+HPVAPLLLPH A ED  ++G+ IPK++ II
Sbjct  338  EKVGMTRMVEESDVEKLEYLEMVIKETFRLHPVAPLLLPHEAAEDTTIDGYLIPKKSHII  397

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N +AIG DP+ W++ +KF+P RF G NI+ RGRDF+L+PFG+GRR CPG+QLG+TVVRL
Sbjct  398  INTFAIGRDPSAWTEAEKFLPERFLGRNIDIRGRDFQLLPFGAGRRGCPGIQLGMTVVRL  457

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            +VAQLVHCFDW+LPNGM P ELDMTEEF LV  RAKHL AIP YRL +
Sbjct  458  VVAQLVHCFDWELPNGMLPTELDMTEEFSLVTPRAKHLEAIPNYRLHI  505



>ref|XP_004143568.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=509

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D++ S ++  Q  R  +KAIMLDMLAG+MDTS+T + W MSEL RHP++MK +++EL+
Sbjct  273  MLDLIGSQQTEYQIDRSAIKAIMLDMLAGAMDTSSTTIGWAMSELIRHPDVMKKMQDELQ  332

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL RMV+E DL +LEYLEMV+KE  R++P  PL +P  ++EDC V+GFHIPK++R+I
Sbjct  333  EVVGLHRMVQESDLVNLEYLEMVVKEIMRLYPAGPLSIPRESLEDCTVDGFHIPKKSRVI  392

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG DP+VW+DP KF P RF G+ I+ +G DFELIPFG GRR CPG+QLG+T+VRL
Sbjct  393  VNVWAIGRDPSVWNDPHKFFPERFIGSQIDLKGNDFELIPFGGGRRGCPGMQLGLTMVRL  452

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+AQLVHCFDW LPNGM P ELDMTEEFGL   RA+ LM IPT+RL
Sbjct  453  LLAQLVHCFDWKLPNGMLPSELDMTEEFGLTCPRAEDLMVIPTFRL  498



>ref|XP_010027781.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54384.1| hypothetical protein EUGRSUZ_I00335 [Eucalyptus grandis]
Length=500

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 183/228 (80%), Gaps = 2/228 (1%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M   E      R H+KAI+LDML+GSMDTSAT ++W M+EL RHP  MK +++ELE
Sbjct  271  MLGFMGLNEGEYHIDRPHIKAIILDMLSGSMDTSATAIDWAMTELVRHPSAMKRVQDELE  330

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VG++R VEE DLE L YL+MVIKE+ R+HPVAPLLLPH A EDC VNGFHIP ++R+I
Sbjct  331  KAVGMNRAVEESDLEGLHYLDMVIKETMRLHPVAPLLLPHEATEDCTVNGFHIPLKSRVI  390

Query  398  VNIWAIGHDPNVWS--DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            VN+W+IG DP VW+  DP++FIP RF G++++ +GRDF+L+PFG+GRR CPG+QLG+T+V
Sbjct  391  VNVWSIGRDPKVWTTHDPEEFIPERFLGSSMDVKGRDFQLLPFGAGRRGCPGMQLGLTIV  450

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            R ++AQLVHCFDWDLP G+SP ELDMTEEFGL   RAKHL+ +P YRL
Sbjct  451  RFVLAQLVHCFDWDLPAGISPSELDMTEEFGLTAPRAKHLVVMPRYRL  498



>ref|XP_009770688.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 186/227 (82%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  QF R HVKAI+LDML  S+DTS+T VEW++SEL ++P +M+ L++EL
Sbjct  268  TMMSIMQSGEAEFQFDRRHVKAILLDMLVASIDTSSTSVEWMLSELLKNPNVMEKLQKEL  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+RMVEE DL++L+YL MV KESFR+H  APLLL H AMEDC+V+ F+I K +++
Sbjct  328  EEVVGLNRMVEESDLDNLKYLNMVFKESFRLHAAAPLLL-HEAMEDCIVDDFYIQKGSQV  386

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN ++I  DPNVW +  KF+P RF  +N++ RGRDF+L+PFGSGRRSCPG+ L + +VR
Sbjct  387  IVNSYSIHMDPNVWPEADKFLPERFLESNVDVRGRDFQLLPFGSGRRSCPGMHLALIIVR  446

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW LPNGM PK+LDMTE+FG+V  RAKHLMAIPTYRL
Sbjct  447  LVVAQLVHCFDWKLPNGMQPKDLDMTEKFGIVTGRAKHLMAIPTYRL  493



>emb|CDP01384.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M  IM+SGE+  +F R HVKAI+LD+L  SMDTS T VEW +SEL RHPE M+ L++ LE
Sbjct  270  MMGIMQSGEAEFEFDRSHVKAILLDLLVASMDTSVTAVEWAISELLRHPEAMRKLQKALE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             +VGL+R+VEE D+E LEYL+MVIKES R+HPVAPLLLPH +MEDC V+ FHI K++RII
Sbjct  330  EKVGLERIVEESDIEGLEYLDMVIKESMRLHPVAPLLLPHESMEDCTVDDFHIQKKSRII  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +NI+ IG DPNVW DP  F P RF  +NI+ RG+DF LIPFGSGRRSCPGLQLG+ +VR 
Sbjct  390  INIYTIGRDPNVWPDPATFNPERFKDSNIDLRGQDFRLIPFGSGRRSCPGLQLGLLLVRF  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++AQLVHCF+WDL + + P +LDM+E FGLV +RAKHL  +PT RL+
Sbjct  450  VLAQLVHCFNWDLADNIQPTDLDMSEAFGLVTSRAKHLKVVPTCRLQ  496



>ref|XP_007048087.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92244.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 189/240 (79%), Gaps = 13/240 (5%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIML-------------DMLAGSMDTSATVVEWIMSELFR  618
            M   M S ES  +  R+ +KAI+L             DML  +MDTSAT +EW +SEL +
Sbjct  270  MLGFMGSEESEYRVERDTIKAIILALSNYICFSRLLQDMLVAAMDTSATAIEWTLSELIK  329

Query  617  HPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCV  438
            HP ++K +++ELE  VG++R+VEE DLE LEYL+MV+KESFRIHPVAPLL+PHA++EDC 
Sbjct  330  HPRVIKKVQKELENVVGMERLVEESDLEKLEYLDMVVKESFRIHPVAPLLVPHASVEDCT  389

Query  437  VNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRS  258
            VNGFHIPK +R+ +N WAIG DPN+W+D +KFIP RF G++I+ RGRDF+LIPFGSGRR 
Sbjct  390  VNGFHIPKNSRVFINAWAIGRDPNIWTDAEKFIPERFVGSDIDLRGRDFQLIPFGSGRRG  449

Query  257  CPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            CPG+ LG+ +VRL+VAQLVHCFDW+LP+GM   ELDMTEEFGLV  RAKHL+A+PT+RL+
Sbjct  450  CPGMPLGLIMVRLVVAQLVHCFDWELPDGMLATELDMTEEFGLVSPRAKHLLAMPTWRLK  509



>ref|XP_010099909.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB80838.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=498

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 185/227 (81%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M  +M+S +S  +  R ++KA+MLDML  SMDTSA+ +EW +SEL + P ++  +++EL
Sbjct  271  VMLSLMESADSEYRIERPNIKAVMLDMLVASMDTSASAIEWAISELIKQPRVLMKVQKEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG++RMVEE DLE LEYL+MV+KE+ R+HPV PL   HAAME+C +NGFHIPK++R+
Sbjct  331  ETVVGMERMVEETDLEMLEYLDMVVKETLRLHPVVPLF-HHAAMEECTINGFHIPKKSRV  389

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN WAIG DPN W+DP+KFIP RF G++I+ +GRDF+LIPFG+GRR CPGLQLG+ VV+
Sbjct  390  IVNAWAIGRDPNAWNDPEKFIPERFLGSSIDLKGRDFQLIPFGAGRRHCPGLQLGLIVVK  449

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW+LPNG+ P ELDMTEEFGL   RA HL+AIPTYRL
Sbjct  450  LVVAQLVHCFDWELPNGVIPTELDMTEEFGLTTPRANHLLAIPTYRL  496



>ref|XP_006493867.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Citrus sinensis]
 ref|XP_006493868.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Citrus sinensis]
Length=498

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M     S ++  +  REH+KA+++DMLAG++DTS TVVEW +SEL +HP +MK L+ ELE
Sbjct  271  MLSFEGSEDTEKKIDREHIKAVVMDMLAGAIDTSPTVVEWALSELIKHPAVMKKLQRELE  330

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL RMVEE DLE LEYL+MV++E+ R+HPV PL+ PH +MEDC VNGFHIPK++R+I
Sbjct  331  NIVGLKRMVEESDLEILEYLDMVVRETLRLHPVTPLMAPHESMEDCTVNGFHIPKKSRVI  390

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAIG DP  W+DP+ F P RF G++++  G DF+L+PFGSGRR CPG+QL +TVV+ 
Sbjct  391  VNAWAIGRDPEAWTDPETFFPERFVGSSVDVLGHDFQLLPFGSGRRGCPGIQLALTVVKQ  450

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            + AQLVHCFDW+LP GM P ELDMTEEFGLV  RAKHL+A+P+YRL
Sbjct  451  VTAQLVHCFDWELPEGMLPTELDMTEEFGLVTPRAKHLLAVPSYRL  496



>ref|XP_006428066.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
 gb|ESR41306.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
Length=498

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M     S ++  +  REH+KA+++DMLAG++DTS TVVEW +SEL +HP +MK L+ ELE
Sbjct  271  MLSFEGSEDTEKKIDREHIKAVVMDMLAGAIDTSPTVVEWALSELIKHPTVMKKLQRELE  330

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL RMVEE DLE+LEYL+MV++E+ R+HPV PL+ PH +MEDC VNGFHIPK++R+I
Sbjct  331  NIVGLKRMVEESDLENLEYLDMVVRETLRLHPVTPLMAPHESMEDCTVNGFHIPKKSRVI  390

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAIG DP  W+DP+ F P RF G++++  G DF+L+PFGSGRR CPG+QL +TVV+ 
Sbjct  391  VNAWAIGRDPEAWTDPETFFPERFVGSSVDVLGHDFQLLPFGSGRRGCPGIQLALTVVKQ  450

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            + AQLVHCFDW+LP GM P ELDMTEEFGLV  RAKHL+A+P+YRL
Sbjct  451  VTAQLVHCFDWELPEGMLPTELDMTEEFGLVTPRAKHLLAVPSYRL  496



>ref|XP_006354704.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=497

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 187/228 (82%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SGE+  QF R HVKA+MLDML  S+DTS++ +EW++SEL R+P+IMK L++EL
Sbjct  269  TMMEIMQSGEAEFQFDRRHVKAVMLDMLVASIDTSSSSIEWMLSELLRNPDIMKKLQKEL  328

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+RMV+E DLE+L+YL MV KESFR+H  APLLL H AMEDC+V+ F+I K +++
Sbjct  329  EEVVGLNRMVQESDLENLKYLNMVFKESFRLHAAAPLLL-HEAMEDCMVDDFYIKKGSQV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN + I  DPN W+D  KF+P RF  +N++ RGRD++L+PFGSGRRS PG+QL + +VR
Sbjct  388  IVNAYTIHRDPNFWTDADKFLPERFLESNVDVRGRDYQLLPFGSGRRSFPGMQLALIIVR  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCFDW+LPN M PK+LDMTE+FG+V  RA HLMA+PTYRL+
Sbjct  448  LVVAQLVHCFDWELPNEMQPKDLDMTEQFGIVTGRANHLMAVPTYRLQ  495



>ref|XP_002310008.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
 gb|EEE90458.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
Length=493

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 184/227 (81%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   MKS E+     +  +KA MLDML GSMDTSATV++W  SEL ++P +MK L++EL
Sbjct  265  VMLSFMKSEENEYLVDQGCMKATMLDMLVGSMDTSATVIDWAFSELIKNPRVMKKLQKEL  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG  RMVEE DLE LEYL+MV+KE+ R+HP  PL++PH A EDCVVN FHIPK++ +
Sbjct  325  EEVVGKQRMVEESDLERLEYLDMVVKETLRLHPAGPLMIPHEATEDCVVNDFHIPKKSHV  384

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N+WAIG DP  W+D +KF P RF G++I+ RGRDF+LIPFG+GRRSCPG+QLG+T+VR
Sbjct  385  IINVWAIGRDPKAWTDAEKFYPERFVGSDIDVRGRDFQLIPFGTGRRSCPGMQLGLTMVR  444

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQ+VHCFDW+LPNG+ P E+DM+EEFGLV+ R+KHL++IPTYRL
Sbjct  445  LVLAQMVHCFDWELPNGILPSEVDMSEEFGLVLCRSKHLVSIPTYRL  491



>ref|XP_006365795.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 183/227 (81%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  +  R  VKA++LD+L  S D  +  ++WI+SEL RHP++MK L+ EL
Sbjct  271  TMMTIMQSGEAEFKIDRRDVKAVLLDLLLASTDNVSIAIDWILSELLRHPKVMKKLQIEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG++RMVEE DLE LEYL+MVI+E  R+HP + LL PH ++EDC+V+GF IPK +R+
Sbjct  331  EQAVGINRMVEESDLERLEYLDMVIREGLRLHPPSTLLTPHESIEDCIVDGFDIPKGSRL  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             VN+WAIG DP  W DP+KF+P RF  +NI+ RG DF+L+PFGSGRRSCPGLQLG+T+VR
Sbjct  391  FVNVWAIGRDPEAWPDPEKFMPERFVDSNIDLRGHDFQLLPFGSGRRSCPGLQLGLTIVR  450

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPNGM P  +DMTE+FGLV  RA+HLMAIPTYRL
Sbjct  451  LVLAQLVHCFDWELPNGMMPNHIDMTEKFGLVTPRAQHLMAIPTYRL  497



>ref|XP_004237505.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 187/227 (82%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIM+SG++  QF R H+KAI+ DML  +MDT+A+  EWI++EL RHP++MK L++EL
Sbjct  267  TMMDIMQSGDAKFQFDRHHIKAILFDMLIAAMDTTASSTEWILTELLRHPQVMKELQKEL  326

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VGLDRMVEE DLE+L+YL+MV+KE  R+HPVAPL   H ++EDCVV+GFHI K  RI
Sbjct  327  QEVVGLDRMVEESDLENLKYLDMVVKEGLRLHPVAPLFY-HESIEDCVVDGFHIQKGTRI  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N +AI  DPNVW DP+KF+P RF G+++++RGRDF+L+PFGSGRRSCPG+QL + VVR
Sbjct  386  IINCYAIHMDPNVWPDPEKFLPERFVGSSVDFRGRDFQLVPFGSGRRSCPGMQLAVMVVR  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCF+W+LPNG+   +LD+ E+FG+V  R K L+AIPTY+L
Sbjct  446  LVVAQLVHCFEWELPNGIESCDLDIDEKFGIVTCREKPLLAIPTYKL  492



>ref|XP_004162313.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=509

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D++ S ++  Q  R  +KAIMLDMLA +MDTS+T + W MSEL RHP++MK +++EL+
Sbjct  273  MLDLIDSQQTEYQIDRSAIKAIMLDMLAAAMDTSSTTIGWAMSELIRHPDVMKKMQDELQ  332

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL RMV+E DL  LEYLEMV+KE  R++P  PLL+P  ++EDC V+GFHIPK++R+I
Sbjct  333  EVVGLHRMVQESDLVSLEYLEMVVKEIMRLYPAGPLLIPRESVEDCTVDGFHIPKKSRVI  392

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+W IG DP+VW+DP KF P RF G+ I+ +G DFELIPFG GRR CPG+QLG+T+VRL
Sbjct  393  VNVWTIGRDPSVWNDPHKFFPERFIGSKIDLKGNDFELIPFGGGRRGCPGIQLGLTMVRL  452

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+AQLVHCFDW LPNGM P ELDM EEFGL   RAK LM IPT+RL
Sbjct  453  LLAQLVHCFDWKLPNGMLPSELDMIEEFGLTCPRAKDLMVIPTFRL  498



>ref|XP_004143567.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=359

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 181/242 (75%), Gaps = 16/242 (7%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D++ S ++  Q  R  +KAIMLDMLA +MDTS+T + W MSEL RHP++MK +++ELE
Sbjct  107  MLDLIGSQQTEYQIDRSAIKAIMLDMLAAAMDTSSTTIGWAMSELIRHPDVMKKMQDELE  166

Query  578  ----------------RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAME  447
                              VGL RMV+E DL +LEYLEMV+KE  R++P  PLL+P  ++E
Sbjct  167  LIRHPDVMKKMQDELQEVVGLHRMVQESDLVNLEYLEMVVKEIMRLYPAGPLLIPRESLE  226

Query  446  DCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSG  267
            DC V+GFHIPK++R+IVN+WAIG DP+VW+DP KF P RF G+ I+ +G DFELIPFG G
Sbjct  227  DCTVDGFHIPKKSRVIVNVWAIGRDPSVWNDPHKFFPERFIGSQIDLKGNDFELIPFGGG  286

Query  266  RRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTY  87
            RR CPG+QLG+T+VRLL+AQLVHCFDW LPNGM P ELDMTEEFGL   RAK LM IPT+
Sbjct  287  RRGCPGIQLGLTMVRLLLAQLVHCFDWKLPNGMLPSELDMTEEFGLTCPRAKDLMVIPTF  346

Query  86   RL  81
            RL
Sbjct  347  RL  348



>gb|EYU31074.1| hypothetical protein MIMGU_mgv1a005121mg [Erythranthe guttata]
Length=496

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 178/227 (78%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM SGE+  +F R HVKA++LDML G  DTS+  ++W ++EL RHP+IMK L++EL
Sbjct  269  TMMAIMDSGEAGFEFDRRHVKAVLLDMLLGGTDTSSATIDWALAELIRHPQIMKKLQQEL  328

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VGLD+ VEE  LE L+YL  V+KE+FR+HPV PL + H A+EDC V  FHI K  RI
Sbjct  329  EQVVGLDQYVEESHLEKLDYLNFVVKETFRLHPVVPLFI-HEALEDCTVEEFHIAKGTRI  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+W++  DPNVW DP+KF P RF G+N++  G DFEL+PFGSGRRSCPGLQLG+T VR
Sbjct  388  MVNVWSMSKDPNVWQDPEKFFPERFIGSNLDLHGHDFELLPFGSGRRSCPGLQLGLTTVR  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPNGMSP ELDM+E FGLV  + KH+MAIP  RL
Sbjct  448  LVLAQLVHCFDWELPNGMSPSELDMSEHFGLVTGKDKHIMAIPVCRL  494



>ref|XP_008440675.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=494

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M +IM S E+  Q  R ++KA++LDML  +MDTSAT + W + EL +HP +MK +++EL
Sbjct  266  VMLEIMGSQETEYQIERSNIKALILDMLVAAMDTSATTIGWAIPELIKHPHVMKKMQDEL  325

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VGLDR VEE DL+HLEYL+MV+KE  R+HP APLL+PH A+EDC+V+GF+IPK++RI
Sbjct  326  EKVVGLDRKVEETDLDHLEYLDMVVKEILRLHPPAPLLVPHEALEDCIVDGFYIPKKSRI  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN WAIG DPN W DP+KF P RF G+ ++ RGRDF+LIPFGSGRR CPG+Q+G+TVVR
Sbjct  386  IVNGWAIGRDPNFWIDPEKFFPERFIGSQVDVRGRDFQLIPFGSGRRGCPGMQMGLTVVR  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPNG  P +LDMTEEFGL   RA+ LM  P YRL
Sbjct  446  LVIAQLVHCFDWELPNGTLPVKLDMTEEFGLTCPRAQDLMVTPIYRL  492



>ref|XP_006354722.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=494

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 183/227 (81%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  QF R H+KAI+ DML  +MDT+A+  EWI++EL RHP++MK L++EL
Sbjct  267  TMMGIMQSGEAEFQFDRRHIKAILFDMLIAAMDTTASSTEWILTELLRHPQVMKKLQKEL  326

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VGL+RMVEE DLE+L+YL MV+KE  R+HPV PL   H +MEDCVV+GFHI K +R+
Sbjct  327  QEVVGLERMVEESDLENLKYLNMVVKEGLRLHPVVPLFY-HESMEDCVVDGFHIQKGSRV  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN +A   DPNVW DP+KF+P RF G+ I++RGRDF+L+PFGSGRRSCPG+QL + VVR
Sbjct  386  MVNCYAAQRDPNVWPDPEKFLPERFVGSCIDFRGRDFQLVPFGSGRRSCPGMQLAVMVVR  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCF+W+LPNGM P +LD+ E+FG+V  R K LMAIPTY L
Sbjct  446  LVVAQLVHCFEWELPNGMQPCDLDIDEKFGIVTCREKPLMAIPTYNL  492



>ref|XP_010027875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54512.1| hypothetical protein EUGRSUZ_I00454 [Eucalyptus grandis]
Length=500

 Score =   299 bits (766),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 181/228 (79%), Gaps = 2/228 (1%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M   E      R H+KAI+LDML GSMDTSAT ++W M+EL RHP  MK +++ELE
Sbjct  271  MLGFMGLNEGEYHIDRPHIKAIILDMLLGSMDTSATAIDWAMTELVRHPSAMKKVQDELE  330

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VG++R VEE DLE L YL+MVIKE+ R+HPVAPLLLPH A EDC VNGFH+P ++R+I
Sbjct  331  KAVGMNRAVEESDLEGLHYLDMVIKETMRLHPVAPLLLPHEATEDCTVNGFHMPLKSRVI  390

Query  398  VNIWAIGHDPNVWS--DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            VN+W+IG DP VW+  +P++FIP RF G +++ +GRDF+L+PFG+GRR CPG+QLG+TVV
Sbjct  391  VNVWSIGRDPKVWTTHNPEEFIPERFLGLSMDVKGRDFQLLPFGAGRRGCPGMQLGLTVV  450

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            R ++AQLVHCFDWDLP G+SP ELDMTEEFGL   RAKHL+ +P YRL
Sbjct  451  RFVLAQLVHCFDWDLPAGISPSELDMTEEFGLTTPRAKHLVVMPQYRL  498



>ref|XP_004237617.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 186/227 (82%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+ +IM+SGE+  +F R HVKAI+LD+L  SMDTS+T +EWI+SEL +HP +MK L+ EL
Sbjct  265  TLMEIMQSGEAEFEFDRRHVKAILLDLLVASMDTSSTSIEWILSELLKHPNVMKKLQSEL  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +       +VEE+DL++L+YL MVIKE FR+HPVAPLLLPH ++EDC ++GF +PK +R+
Sbjct  325  DNVFDQKGIVEEKDLKNLDYLNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFQMPKGSRV  384

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG DP+VW +P+KFIP RF  + I+ RG++F+L+PFGSGRRSCPGLQLG+T+V 
Sbjct  385  LVNVWAIGRDPDVWREPEKFIPERFVESTIDVRGQNFQLLPFGSGRRSCPGLQLGLTIVH  444

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVH FDW+LPNGM P +++MTE+FGLV  RA  LMAIP YRL
Sbjct  445  LVVAQLVHSFDWELPNGMMPNDINMTEKFGLVTARALPLMAIPIYRL  491



>ref|XP_011090597.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=495

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 184/227 (81%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  +F R HVKA++L ++     TS+TVVEW +SEL RHP+ MK L++EL
Sbjct  268  TMITIMESGEAGFEFDRRHVKAVLLVIILAXXXTSSTVVEWALSELIRHPKAMKKLQQEL  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG+D++VEE  L+ LEYL+MV+KE+ R+HP  PLL+ H ++EDCVV+ FH+PK +R+
Sbjct  328  EQAVGMDQIVEESHLDRLEYLDMVVKETLRLHPAVPLLI-HESLEDCVVDQFHVPKGSRV  386

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+W+IG DPN W +P+KF+P RF G+NI+ RG+DF+LIPFGSGRR CPGLQLG+TVVR
Sbjct  387  IVNVWSIGKDPNAWREPQKFLPERFIGSNIDLRGQDFQLIPFGSGRRGCPGLQLGLTVVR  446

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LP+GM   ELDM E FGLV  R  HL+A+PTYRL
Sbjct  447  LVLAQLVHCFDWELPDGMVASELDMAEHFGLVTCRENHLLAVPTYRL  493



>gb|ACM89788.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89833.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D+M S E+     R ++KAI LDM+A SMDTSAT +EW +SEL +HP +MK ++ ELE
Sbjct  268  MLDLMGSEETEYNIQRANIKAISLDMMAASMDTSATTIEWALSELIKHPPMMKKVRNELE  327

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VG++RMVEE DLE LEYL MV+KE+ R+HPV PLL+PH ++EDC V+GFHIP+++R+I
Sbjct  328  KVVGMERMVEESDLESLEYLNMVVKETLRLHPVVPLLIPHESIEDCTVDGFHIPQKSRVI  387

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG DPN W+D  KF+P RF  ++I++RG+ F+ IPFGSGRR CPG+QLG+TVVRL
Sbjct  388  VNVWAIGRDPNAWTDADKFLPERFMESDIDFRGQHFQFIPFGSGRRGCPGMQLGLTVVRL  447

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            ++AQLVHCFDW+LP+ M   ELDM EEFGL + RAKHL+AIPT R 
Sbjct  448  VLAQLVHCFDWELPDNMLASELDMNEEFGLTLPRAKHLVAIPTCRF  493



>gb|ACM89789.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89832.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D+M S E+     R ++KAI LDM+A SMDTSAT +EW +SEL +HP +MK ++ ELE
Sbjct  268  MLDLMGSEETEYNIQRANIKAISLDMMAASMDTSATTIEWALSELIKHPPMMKKVRNELE  327

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VG++RMVEE DLE LEYL MV+KE+ R+HPV PLL+PH ++EDC V+GFHIP+++R+I
Sbjct  328  KVVGMERMVEESDLESLEYLNMVVKETLRLHPVVPLLIPHESIEDCTVDGFHIPQKSRVI  387

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG DPN W+D  KF+P RF  ++I++RG+ F+ IPFGSGRR CPG+QLG+TVVRL
Sbjct  388  VNVWAIGRDPNAWTDADKFLPERFMESDIDFRGQHFQFIPFGSGRRGCPGMQLGLTVVRL  447

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            ++AQLVHCFDW+LP+ M   ELDM EEFGL + RAKHL+AIPT R 
Sbjct  448  VLAQLVHCFDWELPDNMLASELDMNEEFGLTLPRAKHLVAIPTCRF  493



>ref|XP_008364814.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=498

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 181/223 (81%), Gaps = 0/223 (0%)
 Frame = -3

Query  746  MKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVG  567
            M S  S  +  R ++KA+M DM A S DTS+T V+W +SEL RHP++MK +++ELE  VG
Sbjct  275  MGSEGSDYRIERLNIKAMMSDMFAASADTSSTTVQWALSELLRHPQVMKKVQKELENVVG  334

Query  566  LDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIW  387
            L RMVEE D+E LEYL+MV+KE+ R+HPV PLLLPHAA+EDC V+G+HIPK++R+IVN W
Sbjct  335  LKRMVEESDMEKLEYLDMVVKETMRLHPVVPLLLPHAAIEDCTVDGYHIPKKSRVIVNAW  394

Query  386  AIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQ  207
            AIG DP+ W D +KF+P RF G N++ RG  F+L+PFGSGRR C G+QLGITVV  ++AQ
Sbjct  395  AIGRDPSAWEDAEKFVPERFEGNNVDVRGHHFQLVPFGSGRRRCVGMQLGITVVHFVLAQ  454

Query  206  LVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            LVHCFDW+LP+ M P ELDMTEEFGLVV+RAK+L+AIP+YRL+
Sbjct  455  LVHCFDWELPDNMLPNELDMTEEFGLVVSRAKNLLAIPSYRLQ  497



>ref|XP_009631573.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=227

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 184/226 (81%), Gaps = 1/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M +IM+SGE+  QF   H+KAI+LDML  +MDTSAT VEWI++EL RH + MK L+ ELE
Sbjct  1    MMEIMQSGEAEFQFDCRHIKAILLDMLIAAMDTSATSVEWILTELLRHTQAMKKLQRELE  60

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+DRMVEE DLE+L+YL+MV+KE  R+H +  L++ H AMEDCVV+GFHI K +RI+
Sbjct  61   EVVGMDRMVEESDLENLKYLDMVVKEGLRLHSIV-LVMHHEAMEDCVVDGFHIQKGSRIM  119

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N +AI  DPNVW +P+KF+P RF G++++ RG  F+L+PF SGRRSCPG+QLGIT+VRL
Sbjct  120  INCYAIQRDPNVWPEPEKFLPERFVGSSVDIRGCHFQLLPFSSGRRSCPGMQLGITIVRL  179

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +VAQLVHCFDW++PNGM P +LD+ EEFG+V+ + K LMAIPTYRL
Sbjct  180  VVAQLVHCFDWEIPNGMQPLDLDVDEEFGIVLCKEKPLMAIPTYRL  225



>ref|XP_009782203.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=494

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 188/228 (82%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SGE+  QF   ++KAI+LDML  ++DTSAT VEWI++EL RHP +MK L++EL
Sbjct  267  TMMEIMQSGEAEFQFDCRNIKAILLDMLMAAIDTSATSVEWILTELLRHPHVMKKLQKEL  326

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG+++MVEE DLE+L+YL+MV+KE  R+H + P++  H AMEDCVV+GFHI K +RI
Sbjct  327  EELVGIEKMVEESDLENLKYLDMVVKEGLRLHSIVPIM-HHEAMEDCVVDGFHIQKGSRI  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +A+  DPNVW +P+KF P RF G+N++ RGRDF+L+PFGSGRRSCPG+QLGIT+V 
Sbjct  386  MINCYAVQRDPNVWPEPEKFFPERFVGSNVDTRGRDFQLLPFGSGRRSCPGMQLGITIVS  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCFDW++PNGM P +LD+ E+FGLV  + K LMAIPTYRL+
Sbjct  446  LVVAQLVHCFDWEIPNGMQPLDLDIDEQFGLVTCKEKPLMAIPTYRLK  493



>gb|EYU31078.1| hypothetical protein MIMGU_mgv1a004963mg [Erythranthe guttata]
Length=502

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 184/228 (81%), Gaps = 2/228 (1%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+  IM+SGE+   F R HVKA++LDML   MDTSA  VEW +S+L ++P +MK L++EL
Sbjct  274  TLMSIMESGEAGFDFDRRHVKAVLLDMLLAGMDTSAAAVEWALSDLVKNPTVMKKLQKEL  333

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG+D+MVEE  L +L+YL+ V++ES RIHPV PLL+ H +MEDC V+GFHIPK+ R+
Sbjct  334  EEIVGMDQMVEESHLPNLKYLDYVVRESMRIHPVGPLLI-HESMEDCEVDGFHIPKKTRV  392

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRF-SGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            ++N+WAIG DPN W+ P+KF P RF    N++ RGRD++LIPFG+GRR CPGLQLG+T+V
Sbjct  393  LINVWAIGRDPNAWAHPEKFWPERFVESPNVDLRGRDYQLIPFGTGRRGCPGLQLGLTIV  452

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +L+VAQLVHCFDW+LP+G+S  ELDM+E FGLV +RAKHLM IPTYRL
Sbjct  453  QLIVAQLVHCFDWELPHGVSASELDMSENFGLVTSRAKHLMVIPTYRL  500



>ref|XP_002310009.2| hypothetical protein POPTR_0007s06300g [Populus trichocarpa]
 gb|EEE90459.2| hypothetical protein POPTR_0007s06300g [Populus trichocarpa]
Length=371

 Score =   293 bits (749),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 182/228 (80%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + S E+  +  R+++KAI++DML GSMDTSAT +EW +SEL +HP +MK +++ELE
Sbjct  144  MLDFLGSEETEYRIVRDNIKAIIMDMLVGSMDTSATAIEWTLSELIKHPRVMKKVQKELE  203

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
             ++G+DRMVEE DLE LEYL MVIKE+FR+HPVAPLL+PH +MEDC ++GF IP++ R+I
Sbjct  204  EKIGMDRMVEESDLEGLEYLHMVIKEAFRLHPVAPLLIPHESMEDCTIDGFLIPQKTRVI  263

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN+WAIG + + W+D  KFIP RF+G+NI+ RGRDF+L+PFG+GRR CPG+ LG+T+   
Sbjct  264  VNVWAIGREQSAWTDSNKFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPGMHLGLTMDLQ  323

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            +VAQLVHCFDW+L   M  +E+DMTE FGLV  RA HL A PTYRL L
Sbjct  324  IVAQLVHCFDWELRKNMLREEVDMTEAFGLVTPRANHLCATPTYRLHL  371



>ref|XP_006367702.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=542

 Score =   298 bits (763),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 184/228 (81%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIMKSGE+   F R H+KAI+LDML  SMDT+A+  +WI++EL RHP++MK L++EL
Sbjct  311  TMMDIMKSGEAEFPFDRTHIKAILLDMLLASMDTTASSTDWILAELLRHPQVMKKLQKEL  370

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG++RMVEE DL +L YLEMV+KE  R+HPV PL   H AMEDCVV+GF I K +R 
Sbjct  371  QEVVGVERMVEESDLVNLNYLEMVVKEGMRLHPVGPLFY-HEAMEDCVVDGFQIHKGSRT  429

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +A+  DPNVW +P+KF P RF G++I++RG DF+L+PFGSGRRSCPG+QLG+TVVR
Sbjct  430  VINCYAVQRDPNVWPEPEKFFPERFFGSSIDFRGNDFQLVPFGSGRRSCPGMQLGVTVVR  489

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCF+W+LPNG+ P +LD+ E FG+V  R K L+AIPTYRL+
Sbjct  490  LVVAQLVHCFEWELPNGIQPCDLDIDEHFGIVTCREKPLLAIPTYRLK  537



>ref|XP_004504031.1| PREDICTED: cytochrome P450 750A1-like [Cicer arietinum]
Length=502

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R ++KAIMLDMLAGSMDTSAT VEW +SEL R+P +MK +++ELE
Sbjct  272  MLGFVGTQESEYRIERPNIKAIMLDMLAGSMDTSATSVEWAISELLRNPRVMKKVQKELE  331

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL R V E DL+ LEYL+MVIKE+FR+HPVAPLL+PH ++EDC+V  F IPK++R+I
Sbjct  332  IVVGLKRKVVESDLDKLEYLDMVIKENFRLHPVAPLLIPHQSLEDCMVEDFFIPKKSRVI  391

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN W++  DPN W+DP+KF P RF G+NI+ +GRDF+ IPFGSGRR CPG+QLG+TVVRL
Sbjct  392  VNAWSVMRDPNAWTDPEKFWPERFEGSNIDVKGRDFQFIPFGSGRRGCPGIQLGLTVVRL  451

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +VAQLVHCFDW L N M P +LDM EEFGL + RA HL+AIPTYRL
Sbjct  452  VVAQLVHCFDWRLCNHMLPSDLDMEEEFGLTMPRANHLIAIPTYRL  497



>gb|EYU31075.1| hypothetical protein MIMGU_mgv1a005090mg [Erythranthe guttata]
Length=497

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 178/228 (78%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM SGE+  +F R HVKA++LDML G  DTS+  ++W ++EL RHP+IMK L++EL
Sbjct  270  TMMAIMDSGEAGFEFDRRHVKAVLLDMLLGGTDTSSATIDWALAELIRHPQIMKKLQQEL  329

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VGLD+ VEE  LE L+YL  V+KE+FR+HPV PL + H A+EDC V  FHI K  RI
Sbjct  330  EQVVGLDQYVEESHLEKLDYLNFVVKETFRLHPVVPLFI-HEALEDCTVEEFHIAKGTRI  388

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+W++  DPNVW DP+KF P RF G++++  G DFEL+PFGSGRRSCPGLQLG+T VR
Sbjct  389  MVNVWSMSKDPNVWQDPEKFFPERFIGSDLDLLGHDFELLPFGSGRRSCPGLQLGLTTVR  448

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L++AQLVHCFDW+L NGMSP ELDM+E FGLV  + KH+MAIP  RLR
Sbjct  449  LVLAQLVHCFDWELTNGMSPNELDMSEHFGLVTGKDKHIMAIPVCRLR  496



>ref|XP_006354705.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=504

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIM+SGE   QF R HVKA+MLDML  S+ TS++ +EW++SEL ++P+IMK L++EL
Sbjct  276  TMMDIMQSGEVEFQFDRRHVKAVMLDMLVASIGTSSSSIEWMLSELLKNPDIMKKLQKEL  335

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+RMVEE DLE+L+YL MV KESFR+H  APLLL H AMEDC+V+ F++ K +++
Sbjct  336  EEVVGLNRMVEESDLENLKYLNMVFKESFRLHVAAPLLL-HEAMEDCMVDDFYVKKGSQV  394

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN + I  DPN W++  KF+P RF  +N++ RGRD++L+PFGSGRRSCPG+QL + +VR
Sbjct  395  IVNAYTIHRDPNFWTNADKFLPERFLESNVDVRGRDYQLLPFGSGRRSCPGMQLALIIVR  454

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLV CFDW+LPN M PK+LDMTE+FG+V  RA HLMA+PTYRL+
Sbjct  455  LVVAQLVQCFDWELPNEMQPKDLDMTEQFGMVTGRASHLMAVPTYRLQ  502



>ref|XP_011090604.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=497

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 177/227 (78%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+   F R HVKA++LDML   +DTS   VEW +SE+ RHP + K L++EL
Sbjct  270  TMMGIMESGEAGFDFDRRHVKAVLLDMLLAGIDTSTAAVEWALSEVIRHPVVTKKLQKEL  329

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGLD+ V E  L  L+YL+ V++ES R+HPV+PLL+    MEDC V+GFHI K++++
Sbjct  330  EEVVGLDQTVNESHLSSLKYLDYVVRESMRLHPVSPLLI-REGMEDCEVDGFHIQKKSQV  388

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN+WAIG DP+ W+DP+ F P RF G+N++ RGRD +LIPFG+GRR CPGLQLG+T+V+
Sbjct  389  LVNVWAIGRDPDAWTDPETFFPERFLGSNVDVRGRDSQLIPFGTGRRGCPGLQLGLTIVQ  448

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW+LP GM P ELDM+E FGL+  RAKHL+AIP YRL
Sbjct  449  LMVAQLVHCFDWELPEGMQPDELDMSENFGLITARAKHLVAIPKYRL  495



>ref|XP_009372721.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 180/223 (81%), Gaps = 0/223 (0%)
 Frame = -3

Query  746  MKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVG  567
            M S  S  +  R ++KA+M DM A S DTS+T V+W +SEL RHP++MK +++ELE  VG
Sbjct  273  MGSEGSDYRIERLNIKAMMSDMFAASADTSSTTVQWALSELLRHPQVMKKVQKELENVVG  332

Query  566  LDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIW  387
            L RMVEE D+E LEYL+MV+KE+ R+HPV PLLLPHAA+EDC V+G+HIPK++RII+N W
Sbjct  333  LKRMVEESDMEKLEYLDMVLKETMRLHPVVPLLLPHAAIEDCTVDGYHIPKKSRIIINAW  392

Query  386  AIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQ  207
            AIG DP+ W D +KF+P RF   N++ RG  F+L+PFGSGRR C G+QLGITVV  ++AQ
Sbjct  393  AIGRDPSAWEDAEKFVPERFEDNNVDVRGHHFQLVPFGSGRRRCVGMQLGITVVHFVLAQ  452

Query  206  LVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            LVHCFDW+LP+ M P ELDMTEEFGLVV+RAK+L+AIP+YRL+
Sbjct  453  LVHCFDWELPDNMLPNELDMTEEFGLVVSRAKNLLAIPSYRLQ  495



>ref|XP_009631554.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=503

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 184/227 (81%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  QF R HVKA++LDML  S+DTS+T VEW++SEL ++P +M+ L++EL
Sbjct  276  TMMSIMQSGEAEFQFDRRHVKAVLLDMLVASIDTSSTSVEWMLSELLKNPNVMEKLQKEL  335

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  V LDRMVEE DL+ L+YL MV KESFR+H  APLLL H AMEDC+V+ F+I K +++
Sbjct  336  EEVVVLDRMVEESDLDKLKYLNMVFKESFRLHAAAPLLL-HEAMEDCMVDDFYIQKGSQV  394

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN ++I  DPNVW +  KF+P RF  +N++ RGRDF+L+PFGSGRRSCPG+ L + +VR
Sbjct  395  IVNSYSIHMDPNVWPEADKFLPERFLESNVDVRGRDFQLLPFGSGRRSCPGMHLALIIVR  454

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW LPNG+ PK+LDMTE+FG+V  RAK+LMAIPTYRL
Sbjct  455  LVVAQLVHCFDWKLPNGIQPKDLDMTEKFGIVTGRAKNLMAIPTYRL  501



>ref|XP_003630097.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=457

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R  +KAIMLDML GSMDTSAT +EW +SEL ++P +MK +++ELE
Sbjct  227  MLGFVGTEESEYRIERNDIKAIMLDMLGGSMDTSATAIEWAISELLKNPRVMKNVQKELE  286

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R VEE DL+ L+YLEMVIKES R+HPVAPLL+P+ ++EDC+V    IPK++R+I
Sbjct  287  TVVGMKRKVEESDLDKLKYLEMVIKESLRLHPVAPLLIPYQSLEDCMVEDLFIPKKSRVI  346

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN W+I  DPN W+DP+KF P RF G NI+ +GRDF+LIPFGSGRR CPGLQLG+TV+RL
Sbjct  347  VNAWSIMRDPNAWTDPEKFWPERFEGNNIDVKGRDFQLIPFGSGRRGCPGLQLGLTVIRL  406

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +VAQLVHCFDW LPN M P +LDMTE+FGL + RA +L+AIP YRL
Sbjct  407  VVAQLVHCFDWKLPNHMLPSDLDMTEDFGLTMPRANNLIAIPAYRL  452



>ref|XP_002310005.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
 gb|EEE90455.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
Length=500

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 180/222 (81%), Gaps = 0/222 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M  +MKS E+     +  +KA MLDML GSMDTSATV++W  SEL ++P +MK L++E+
Sbjct  265  VMLSLMKSEENEYLVDQGCMKATMLDMLVGSMDTSATVIDWAFSELIKNPRVMKKLQKEI  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG  RMVEE DLE LEYL+MV+KE+ R+HP  PL++PH A EDCVVNGFHIPK++ +
Sbjct  325  EEVVGKQRMVEESDLERLEYLDMVVKETLRLHPAGPLMIPHEATEDCVVNGFHIPKKSHV  384

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N+WAIG DP  W+D +KF P RF G++I+ RGRDF+LIPFG+GRRSCPG+QLG+TVVR
Sbjct  385  IINVWAIGRDPKAWTDAEKFYPERFVGSDIDVRGRDFQLIPFGTGRRSCPGMQLGLTVVR  444

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAI  96
            L++AQLVHCFDW+LPNG+ P E+DMTEEFGLV+ R+KHL+ I
Sbjct  445  LVLAQLVHCFDWELPNGILPSEVDMTEEFGLVLCRSKHLIKI  486



>ref|XP_006366158.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=498

 Score =   293 bits (751),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 180/228 (79%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIM+SGE+  QF R H+KAI+ DML  +M TS + +EWI++EL RHP +MK L++EL
Sbjct  269  TMLDIMQSGEAEFQFDRRHIKAILFDMLIAAMGTSPSAIEWILTELLRHPHVMKKLQKEL  328

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL++MV+E DLE+L YL+MV+KE  R+H VAPL  PH AMEDCVVN F+I K +RI
Sbjct  329  EEVVGLEKMVKESDLENLNYLDMVVKEGLRLHAVAPLA-PHEAMEDCVVNSFNIQKGSRI  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +A+  DPN+W +P+KF+P RF G++I+ RG DF+L+PFGSGRR CP +QL I +V 
Sbjct  388  MINFYAVQRDPNIWPEPEKFLPERFVGSSIDIRGHDFQLLPFGSGRRRCPAMQLAIVLVY  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCFDW+LPNGM P +LD+ E FGL  +R  HLMAIPTYRL+
Sbjct  448  LIVAQLVHCFDWELPNGMQPCDLDVEEHFGLATSRENHLMAIPTYRLK  495



>emb|CBI21489.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 189/250 (76%), Gaps = 25/250 (10%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIML-------------------------DMLAGSMDTSA  654
            M   M S E+  Q  R ++KA++L                         DMLAGSMDTSA
Sbjct  299  MLGYMGSKENEFQIERSNIKALVLVSIHTLIIHISKPSSSQYICCLNFQDMLAGSMDTSA  358

Query  653  TVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAP  474
            T +EW ++EL ++P IMK ++EELE+ VG++R VEE DLE LEYL+MV+KE+ R+HPVAP
Sbjct  359  TAIEWALAELLKNPRIMKKVQEELEKVVGMERKVEESDLESLEYLDMVVKETLRLHPVAP  418

Query  473  LLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRD  294
            LL+PH ++EDC VNGFHIP+++R++VN +AIG DPNVW+D +KF+P RF G++I+ RGRD
Sbjct  419  LLIPHESLEDCTVNGFHIPQKSRVMVNTYAIGRDPNVWTDAEKFLPERFIGSSIDLRGRD  478

Query  293  FELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRA  114
            F+LIPFGSGRR CPG+QLG+TVVRL++AQLVHCFDW+LPNGM P ELDMTEEFGL V RA
Sbjct  479  FQLIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPNGMMPSELDMTEEFGLTVPRA  538

Query  113  KHLMAIPTYR  84
            KH++A  + R
Sbjct  539  KHILAYISQR  548



>gb|KJB37876.1| hypothetical protein B456_006G224400 [Gossypium raimondii]
Length=353

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 180/228 (79%), Gaps = 1/228 (0%)
 Frame = -3

Query  758  MXDIMKSGEST-IQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            M   M S E+   +  R+ +KAI+LDML  SMDTSA  ++W ++EL RHP++MK +++EL
Sbjct  125  MLGFMGSEETDEYRVERDTIKAIILDMLTASMDTSAAAIDWTLAELIRHPQVMKKVQKEL  184

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  +G+ RMVEE DLE L+YL+MV+KESFR+HPVAPLL PHA+ ED  VNGF IPK ARI
Sbjct  185  KNVIGMKRMVEESDLEKLKYLDMVVKESFRLHPVAPLLAPHASREDFTVNGFDIPKGARI  244

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             VN WAI  D  VW+D ++F P RF G++I+ RGR+FELIPFG+GRR CPG+QLG+TVVR
Sbjct  245  FVNAWAISRDERVWTDAERFYPERFIGSDIDLRGRNFELIPFGAGRRGCPGMQLGLTVVR  304

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQ+VHCFDW+LPNGM   ELDM EEFGLV  RA HL+AIPT+RL+
Sbjct  305  LVVAQMVHCFDWELPNGMLGSELDMREEFGLVCPRANHLLAIPTWRLK  352



>ref|XP_009588170.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=494

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 187/228 (82%), Gaps = 1/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM +IM+SGE+  QF R+H+KAI+ DML  +MDTSAT VEWI++EL RHP +MK L++EL
Sbjct  267  TMMEIMQSGEAEFQFDRQHIKAIIQDMLMAAMDTSATSVEWILTELLRHPNVMKKLQKEL  326

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG++++V+E DLE+L+YL+MV KE  R+H V PL+  H AME+CVVNGFHI K +RI
Sbjct  327  DEVVGIEKIVKEPDLENLKYLDMVAKEGLRLHSVVPLM-HHEAMEECVVNGFHIQKGSRI  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +A+  DPNVW +P+KF P RF G++I+ R RDF+L+PFGSGRRSCPG+QLG+T++R
Sbjct  386  MINCYAVQRDPNVWPEPEKFFPERFVGSSIDIRRRDFQLLPFGSGRRSCPGMQLGVTIIR  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCFDW++ NGM P +L++ E+FGLV  + K LMAIPTYRL+
Sbjct  446  LVVAQLVHCFDWEISNGMQPLDLEIDEQFGLVTCKEKPLMAIPTYRLK  493



>ref|XP_008385983.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008359286.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 180/223 (81%), Gaps = 0/223 (0%)
 Frame = -3

Query  746  MKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVG  567
            M S ES  +  R HVKA+MLDM A S+DT +TV+ W  SEL RHP++MK L++ELE  VG
Sbjct  276  MGSEESDYRIERXHVKALMLDMFAASVDTPSTVILWAFSELLRHPQVMKKLQKELENVVG  335

Query  566  LDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIW  387
            L+RMVEE DLE LEYL+MV+KE+ R+HP  PLLLPH ++EDC V+G+HIPK +R+I+N W
Sbjct  336  LNRMVEESDLEKLEYLDMVVKETLRLHPAVPLLLPHLSIEDCTVDGYHIPKNSRLIINAW  395

Query  386  AIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQ  207
            AIG DP+ W D +KF+P RF G+NI+ +G+ F+LIPFGSGRR C G+QLG+TV++ ++AQ
Sbjct  396  AIGRDPSAWEDAEKFVPERFEGSNIDVKGKHFQLIPFGSGRRRCAGMQLGLTVIQFVLAQ  455

Query  206  LVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            +VHCFDW+LP+ M P ELDMTE FGLVV+R+K L+ IP+YRL+
Sbjct  456  IVHCFDWELPDNMLPNELDMTEVFGLVVSRSKDLLLIPSYRLQ  498



>gb|AJD25257.1| cytochrome P450 CYP736A122 [Salvia miltiorrhiza]
Length=502

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 181/227 (80%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M  IM+SG +   F R HVKA++LDML G +DT++T V+WIMSEL ++P +MK L++E+
Sbjct  275  VMMGIMESGAAGFDFDRRHVKAMLLDMLIGGIDTTSTAVDWIMSELMKNPTVMKKLQKEI  334

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG+D+MVE+  L  L+YL+ V+KES R+HPVAPLL  HAA  DC V GF IP +  +
Sbjct  335  EEVVGMDQMVEKSHLSSLKYLDCVVKESLRLHPVAPLL-AHAAQGDCQVAGFDIPDKTHV  393

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             VN+WAIG DP+VW +P+ F P+RF  +N+++RGRDF+L+PFGSGRRSCPGLQLG+T+VR
Sbjct  394  FVNVWAIGRDPHVWPNPETFCPDRFLRSNVDFRGRDFQLLPFGSGRRSCPGLQLGLTIVR  453

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             +VAQLVHCFDW+LP+GM   ELDM E++G+V+TRAKHL AIPTYRL
Sbjct  454  SVVAQLVHCFDWELPDGMLADELDMFEKYGMVITRAKHLRAIPTYRL  500



>ref|XP_009378500.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 180/223 (81%), Gaps = 0/223 (0%)
 Frame = -3

Query  746  MKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVG  567
            M S ES  +  R HVKA+MLDM A S+DT +T + W  SEL RHP++MK +++ELE  VG
Sbjct  276  MGSEESDYRIERVHVKALMLDMFAASVDTPSTAILWAFSELLRHPQVMKKVQKELENVVG  335

Query  566  LDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIW  387
            L+RMVEE DLE LEYL+MV+KE+ R+HPV PLLLPH ++EDC V+G+HIPK +R+I+N W
Sbjct  336  LNRMVEESDLEKLEYLDMVVKETLRLHPVVPLLLPHLSIEDCTVDGYHIPKNSRLIINAW  395

Query  386  AIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQ  207
            AIG DP+ W DP+KF+P RF G+NI+ +G+ F+L+PFGSGRR C G+QLG+TV++ ++AQ
Sbjct  396  AIGRDPSAWEDPEKFVPERFEGSNIDVKGKHFQLVPFGSGRRRCAGMQLGLTVIQFVLAQ  455

Query  206  LVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            +VHCFDW+LP+ M P ELDMTE FGLVV+R K L+ IP+YRL+
Sbjct  456  IVHCFDWELPDNMLPNELDMTEVFGLVVSRTKDLLLIPSYRLQ  498



>gb|KJB37875.1| hypothetical protein B456_006G224300 [Gossypium raimondii]
Length=499

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 183/228 (80%), Gaps = 1/228 (0%)
 Frame = -3

Query  758  MXDIMKSGEST-IQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            M   M S E+   +  R+ +KAI+LDMLAGSMDTSA  ++W ++EL RHP++MK +++EL
Sbjct  271  MLGFMGSEETNEYRVERDTIKAIILDMLAGSMDTSAVAIDWTLTELIRHPQVMKKVQKEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG++RMV+E DLE LEYL+MV+KESFR+HPV PLL PHAA EDC V+GFHIPK +RI
Sbjct  331  ENVVGMERMVKESDLEKLEYLDMVVKESFRLHPVGPLLTPHAAREDCTVDGFHIPKNSRI  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             +N WAIG D  VW++ ++F P RF G++I+ RG +FELIPFG+GRR CPG+QLG++VVR
Sbjct  391  FINAWAIGRDERVWTNAERFYPERFIGSDIDLRGCNFELIPFGAGRRGCPGMQLGLSVVR  450

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQLVHCF+W LPN M   ELDM+E+FGLV  RA HL+AIPT+RL+
Sbjct  451  LVVAQLVHCFNWKLPNDMLGSELDMSEDFGLVCPRANHLLAIPTWRLK  498



>gb|EYU24037.1| hypothetical protein MIMGU_mgv1a005167mg [Erythranthe guttata]
Length=494

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM SGE+  +F R HVKA++LD+L   MDTS+T VEW +SEL RHP +MK L+ EL
Sbjct  266  TMMAIMDSGEAGFEFDRRHVKAVLLDLLIAGMDTSSTAVEWAISELIRHPRVMKKLQNEL  325

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG+DR VEE  L++LEYL++V+KE+ R+HPVAPLL+PH +MEDC ++G+HIPK++R 
Sbjct  326  ESTVGIDRTVEESHLDNLEYLDLVVKETLRLHPVAPLLIPHESMEDCTIDGYHIPKKSRA  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+WAIG DP+VW+ P+ F P RFSG++I+ RGRDF+L+PFGSGRRSCP LQLG+ +V+
Sbjct  386  IVNVWAIGRDPSVWAHPETFSPERFSGSDIDLRGRDFQLLPFGSGRRSCPALQLGLVLVK  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPNGM P +LDM+E FG+V +RA+H+MAIP YRL
Sbjct  446  LVLAQLVHCFDWELPNGMLPSDLDMSEHFGIVTSRAEHIMAIPKYRL  492



>ref|XP_008385728.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=356

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 177/221 (80%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E    F R + KAI+LDM++GS DTSAT + W ++EL RHPE+MK L++EL+  VG+D
Sbjct  136  NDEEVYMFERTNAKAILLDMISGSFDTSATAIVWTLAELLRHPEVMKRLQKELQSVVGMD  195

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L+YL MV+KESFR+HPV PLL+PH +MED +V+G+HIPK++R+ +NIW I
Sbjct  196  RMVEESDLPKLDYLSMVVKESFRLHPVGPLLIPHQSMEDVIVDGYHIPKKSRVFINIWTI  255

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DPNVWSD  ++F P RF  +N++ +G DF+LIPFGSGRR CP +QLG+T VRL +  L
Sbjct  256  GRDPNVWSDNVEEFYPERFMNSNVDLQGXDFQLIPFGSGRRGCPAMQLGLTTVRLALGNL  315

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            V CF+W+LP GM PK+LDMTE+FGL +++AKHL+A+PT+RL
Sbjct  316  VXCFNWELPTGMLPKDLDMTEKFGLSLSKAKHLLAMPTHRL  356



>ref|XP_003627829.1| Cytochrome P450, partial [Medicago truncatula]
Length=591

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R  +KAIMLDML GSMDTSAT +EW +SEL ++P +MK +++ELE
Sbjct  270  MLGFVGTEESEYRIERNDIKAIMLDMLGGSMDTSATAIEWAISELLKNPRVMKNVQKELE  329

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R VEE DL+ L+YLEMVIKES R+HPVAPLL+P+ ++EDC+V    IPK++R+I
Sbjct  330  TVVGMKRKVEESDLDKLKYLEMVIKESLRLHPVAPLLIPYQSLEDCMVEDLFIPKKSRVI  389

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN W+I  DPN W+DP+KF P RF G NI+ +GRDF+LIPFGSGRR CPGLQLG+TV+RL
Sbjct  390  VNAWSIMRDPNAWTDPEKFWPERFEGNNIDVKGRDFQLIPFGSGRRGCPGLQLGLTVIRL  449

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +VAQLVHCFDW LPN M P +LDMTE+FGL + RA +L+AIP YRL
Sbjct  450  VVAQLVHCFDWKLPNHMLPSDLDMTEDFGLTMPRANNLIAIPAYRL  495



>gb|KHN29102.1| Cytochrome P450 71A1 [Glycine soja]
Length=493

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 174/226 (77%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R ++KAI+LDMLAGSMDTSATV+EW +SEL ++P +MK L+ ELE
Sbjct  266  MLGFLGTEESEYRIERSNIKAILLDMLAGSMDTSATVIEWTLSELLKNPRVMKKLQMELE  325

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R V E DL+ L+YLEMV+KES R+HPV PLL+PH + EDC+V  F IPK++R+I
Sbjct  326  TVVGMKRKVGESDLDKLKYLEMVVKESMRLHPVVPLLIPHQSTEDCIVGDFFIPKKSRVI  385

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N WAI  DP+ W + +KF P RF G+NI+ RGRDFELIPFGSGRR+CPGLQLG+  VR 
Sbjct  386  INAWAIMRDPSAWVEAEKFWPERFEGSNIDVRGRDFELIPFGSGRRACPGLQLGLITVRQ  445

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             VAQLVHCFDW LPN M P +LDMTE FGL + RA HL AIPTYRL
Sbjct  446  TVAQLVHCFDWKLPNNMFPDDLDMTEAFGLTMPRANHLHAIPTYRL  491



>ref|XP_007159747.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
 gb|ESW31741.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
Length=497

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 177/228 (78%), Gaps = 0/228 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M     + ES  +  R ++KAI+ DMLAGSMDTSAT +EW +SEL ++P +MK L+ ELE
Sbjct  266  MLGFYGTQESEYRIERSNIKAILTDMLAGSMDTSATAIEWTLSELLKNPRVMKKLQMELE  325

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+++ VEE DLE LEYL+MVIKES R+HPVAPLL+PH + EDC+V  F IPK++R+I
Sbjct  326  SVVGMEKKVEESDLEKLEYLDMVIKESLRLHPVAPLLIPHQSTEDCMVGDFFIPKKSRLI  385

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAI  DP+ W + +KF P RF G+NI+ RGR+FELIPFGSGRR CPG+QLG+TV+R 
Sbjct  386  VNAWAIMRDPDAWIEAEKFWPERFEGSNIDVRGREFELIPFGSGRRGCPGIQLGLTVIRH  445

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
             VAQLVHCFDW LPN M P ELDM +EFGL + RA HL+AIPTYRL +
Sbjct  446  TVAQLVHCFDWKLPNDMMPDELDMADEFGLTMPRANHLLAIPTYRLSI  493



>ref|XP_011090598.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 181/232 (78%), Gaps = 6/232 (3%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIML-----DMLAGSMDTSATVVEWIMSELFRHPEIMKT  597
            TM  IM+SGE+  +F R HVKA++L     D+         TVVEW +SEL RHP+ MK 
Sbjct  268  TMITIMESGEAGFEFDRRHVKAVLLVIILQDLXXXXXXXXXTVVEWALSELIRHPKAMKK  327

Query  596  LKEELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIP  417
            L++ELE+ VG+D++VEE  L+ LEYL+MV+KE+ R+HP  PLL+ H ++EDCVV+ FH+P
Sbjct  328  LQQELEKVVGMDQIVEESHLDRLEYLDMVVKETLRLHPAVPLLI-HESLEDCVVDQFHVP  386

Query  416  KRARIIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLG  237
            K +R+IVN+W+IG DPN W +P+KF+P RF G+NI+ RG+DF+LIPFGSGRR CPGLQLG
Sbjct  387  KGSRLIVNVWSIGKDPNAWREPQKFLPERFIGSNIDLRGQDFQLIPFGSGRRGCPGLQLG  446

Query  236  ITVVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +TVVRL++AQLVHCFDW+LP+GM   ELDM E FGLV  R  HL+A+PTYRL
Sbjct  447  LTVVRLVLAQLVHCFDWELPDGMVASELDMAEHFGLVTCRENHLLAVPTYRL  498



>gb|KDP20096.1| hypothetical protein JCGZ_05865 [Jatropha curcas]
Length=510

 Score =   289 bits (740),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 175/217 (81%), Gaps = 2/217 (1%)
 Frame = -3

Query  731  STIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMV  552
            STI   R H+KAI +DM+ GS DTSAT +EW +SEL RHP  MK L++EL+  VG+D MV
Sbjct  294  STID--RTHIKAISIDMIIGSFDTSATTIEWTLSELLRHPHAMKCLQDELQSVVGMDNMV  351

Query  551  eeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHD  372
            EE+ L  L YL+MVIKES R+HP+APLL+P  AMED +V+G++IPK++R+IVN WAIG D
Sbjct  352  EEKHLSKLPYLDMVIKESLRLHPIAPLLVPREAMEDVMVDGYYIPKKSRVIVNAWAIGRD  411

Query  371  PNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCF  192
            P+ WSD +KF+P RF   NI+ RG+DF+LIPFGSGRR CPG+QLG+T++++++AQLVHCF
Sbjct  412  PDAWSDTEKFLPERFIDMNIDLRGQDFQLIPFGSGRRGCPGIQLGLTIIKIIIAQLVHCF  471

Query  191  DWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            DW+LPNG+ P ELDM E+FGL + RA HL+ +P YRL
Sbjct  472  DWELPNGLLPGELDMNEKFGLSLPRANHLLVVPKYRL  508



>ref|XP_006346619.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=493

 Score =   288 bits (738),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 182/227 (80%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIM+SG+   QF R H+KA++ DM+  ++DTSAT ++WI++EL RHP +MK L+ EL
Sbjct  265  TMLDIMQSGKMEFQFDRIHIKAVLFDMIVAAIDTSATSIDWILTELLRHPHVMKKLQNEL  324

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VGL+RMV+E DLE+L+YL+MV+KE  R+H V P+     AMEDCVV+GF+I K  RI
Sbjct  325  EQVVGLERMVKESDLENLKYLDMVVKEGMRLHSVVPVT-QREAMEDCVVDGFNIRKGTRI  383

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +AI  DPNVWS+P+KF P RF G++++ RGRDF+L+PF SGRRSCP +QLGI VVR
Sbjct  384  MINHYAIQRDPNVWSEPEKFFPERFIGSSVDVRGRDFQLLPFNSGRRSCPAIQLGIIVVR  443

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW+LPN M P +LD+ E FG+V ++ KHLMAIPTYRL
Sbjct  444  LVVAQLVHCFDWELPNDMQPCDLDLEEHFGIVTSKEKHLMAIPTYRL  490



>ref|XP_003531374.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
Length=493

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 173/226 (77%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R ++KAI+LDMLAGSMDTSAT +EW +SEL ++P +MK L+ ELE
Sbjct  266  MLGFLGTEESEYRIERSNIKAILLDMLAGSMDTSATAIEWTLSELLKNPRVMKKLQMELE  325

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R V E DL+ L+YLEMV+KES R+HPV PLL+PH + EDC+V  F IPK++R+I
Sbjct  326  TVVGMKRKVGESDLDKLKYLEMVVKESMRLHPVVPLLIPHQSTEDCIVGDFFIPKKSRVI  385

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            +N WAI  DP+ W + +KF P RF G+NI+ RGRDFELIPFGSGRR+CPGLQLG+  VR 
Sbjct  386  INAWAIMRDPSAWVEAEKFWPERFEGSNIDVRGRDFELIPFGSGRRACPGLQLGLITVRQ  445

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             VAQLVHCFDW LPN M P +LDMTE FGL + RA HL AIPTYRL
Sbjct  446  TVAQLVHCFDWKLPNNMFPDDLDMTEAFGLTMPRANHLHAIPTYRL  491



>gb|KJB37877.1| hypothetical protein B456_006G224400 [Gossypium raimondii]
Length=499

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 180/228 (79%), Gaps = 1/228 (0%)
 Frame = -3

Query  758  MXDIMKSGEST-IQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            M   M S E+   +  R+ +KAI+LDML  SMDTSA  ++W ++EL RHP++MK +++EL
Sbjct  271  MLGFMGSEETDEYRVERDTIKAIILDMLTASMDTSAAAIDWTLAELIRHPQVMKKVQKEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  +G+ RMVEE DLE L+YL+MV+KESFR+HPVAPLL PHA+ ED  VNGF IPK ARI
Sbjct  331  KNVIGMKRMVEESDLEKLKYLDMVVKESFRLHPVAPLLAPHASREDFTVNGFDIPKGARI  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             VN WAI  D  VW+D ++F P RF G++I+ RGR+FELIPFG+GRR CPG+QLG+TVVR
Sbjct  391  FVNAWAISRDERVWTDAERFYPERFIGSDIDLRGRNFELIPFGAGRRGCPGMQLGLTVVR  450

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            L+VAQ+VHCFDW+LPNGM   ELDM EEFGLV  RA HL+AIPT+RL+
Sbjct  451  LVVAQMVHCFDWELPNGMLGSELDMREEFGLVCPRANHLLAIPTWRLK  498



>gb|KHN38214.1| Cytochrome P450 71A1 [Glycine soja]
Length=436

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 175/226 (77%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + + ES  +  R ++KAI+LDMLAGSMDTSAT +EW +SEL ++P +MK ++ ELE
Sbjct  206  MLDFVGTEESEYRIERPNIKAILLDMLAGSMDTSATAIEWTLSELLKNPRVMKKVQMELE  265

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R VEE DL+ L YL+MV+KES R+HPVAPLL+PH + EDC+V    IPK++R+I
Sbjct  266  TVVGMKRKVEESDLDKLVYLDMVVKESMRLHPVAPLLIPHQSTEDCMVGDLFIPKKSRVI  325

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAI  DP+ W + +KF P RF G++I+ RGR+FELIPFGSGRR CPGLQLG+TVVRL
Sbjct  326  VNAWAIMRDPSAWDEAEKFWPERFEGSSIDVRGREFELIPFGSGRRGCPGLQLGLTVVRL  385

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             VAQ+VHCFDW LP  + P +LDM EEFGL + RA HL AIPTYRL
Sbjct  386  TVAQIVHCFDWKLPKDILPDDLDMKEEFGLTMPRANHLHAIPTYRL  431



>ref|XP_004237615.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=492

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 180/227 (79%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SG +  Q  R H+KAI+ DML  +MDT+A+  EWI++EL RHP++MK L++EL
Sbjct  264  TMMGIMQSGVAEFQLDRRHIKAILFDMLIAAMDTTASSTEWILTELLRHPQVMKKLQKEL  323

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VGL+R VEE DLE+L+YL+MV+KE  R+HPV PL   H +MEDCVV+GFHI K +R+
Sbjct  324  QEVVGLERTVEESDLENLKYLDMVVKEGLRLHPVVPLFY-HESMEDCVVDGFHIKKGSRV  382

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +VN +A   DPNVW +P+ F+P RF G+ I++RGRDF+L+PFGSGRRSCPG+QL + VVR
Sbjct  383  MVNCYAAQRDPNVWPEPEMFLPERFVGSCIDFRGRDFQLVPFGSGRRSCPGMQLAVIVVR  442

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCF+W+LPNGM P +LD+ E+FG+V  R K LMAIPTY L
Sbjct  443  LVVAQLVHCFEWELPNGMQPCDLDIDEKFGMVTCREKPLMAIPTYNL  489



>emb|CBI15435.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 177/219 (81%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E +    +E++K I+ D++ G++DTSAT +EW++SELFRHP +M+ L+EELE  +G++RM
Sbjct  137  EPSYLIEQENIKGIVWDIIIGAIDTSATTIEWLLSELFRHPRVMRQLQEELENVIGMERM  196

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL +L YL+MV+KE  R+HP  PLLLPH ++ED  +NG++IPK++RII+N WAIG 
Sbjct  197  VEEVDLANLVYLDMVLKEGLRLHPAGPLLLPHESIEDITLNGYYIPKKSRIIINAWAIGR  256

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DPN+WS+  + F P RF G+NI+++G+DF+ IPFGSGRR CPG+QLG+  VRL++AQLVH
Sbjct  257  DPNIWSNNVEDFFPERFIGSNIDFQGKDFQFIPFGSGRRKCPGMQLGLINVRLVLAQLVH  316

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CFDW LPNGM P ELDM+EEFGL + RA HL A+PTYRL
Sbjct  317  CFDWKLPNGMLPSELDMSEEFGLALPRATHLHALPTYRL  355



>ref|XP_010027782.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54386.1| hypothetical protein EUGRSUZ_I00339 [Eucalyptus grandis]
Length=498

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 173/228 (76%), Gaps = 2/228 (1%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M  IM   E      R H+KAI+LDML+ SMDTSAT ++W ++EL RHP +MK L++ELE
Sbjct  269  MLGIMGLNEGEYHIDRSHIKAIILDMLSASMDTSATTIDWAITELTRHPSVMKKLQDELE  328

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
            + VG++R VEE DLE L YL MVIKE  R+HP +P LLP  A EDC VNGFHIP ++ +I
Sbjct  329  KAVGMNRAVEESDLEGLHYLNMVIKEIMRLHPASPFLLPREATEDCTVNGFHIPSKSTVI  388

Query  398  VNIWAIGHDPNVWS--DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            VN+W+IG DP VW+  +P++FIP RF G +++  G DF+L+PFG+GRR CPG+QLG+TVV
Sbjct  389  VNVWSIGRDPKVWTTHNPEEFIPERFLGLSVDVMGHDFQLLPFGAGRRGCPGIQLGLTVV  448

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            R ++AQLVHCFDWDLP G+SP ELDMTEEFGL   RA HL+  P YRL
Sbjct  449  RFVLAQLVHCFDWDLPGGISPSELDMTEEFGLTAPRANHLVVTPRYRL  496



>ref|XP_003524281.2| PREDICTED: cytochrome P450 71A1-like isoform X1 [Glycine max]
 ref|XP_006580303.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Glycine max]
 ref|XP_006580304.1| PREDICTED: cytochrome P450 71A1-like isoform X3 [Glycine max]
Length=497

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 175/226 (77%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + + ES  +  R ++KAI+LDMLAGSMDTSAT +EW +SEL ++P +MK ++ ELE
Sbjct  267  MLDFVGTEESEYRIERPNIKAILLDMLAGSMDTSATAIEWTLSELLKNPRVMKKVQMELE  326

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R VEE DL+ L YL+MV+KES R+HPVAPLL+PH + EDC+V    IPK++R+I
Sbjct  327  TVVGMKRKVEESDLDKLVYLDMVVKESMRLHPVAPLLIPHQSTEDCMVGDLFIPKKSRVI  386

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAI  DP+ W + +KF P RF G++I+ RGRDFELIPFGSGRR CPGLQLG+TVVRL
Sbjct  387  VNAWAIMRDPSAWDEAEKFWPERFEGSSIDVRGRDFELIPFGSGRRGCPGLQLGLTVVRL  446

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             VAQ+VHCFDW LP  + P +LDM EEFGL + RA HL AIPTYRL
Sbjct  447  TVAQIVHCFDWKLPKDILPDDLDMKEEFGLTMPRANHLHAIPTYRL  492



>ref|XP_007036492.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY20993.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=512

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 177/219 (81%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E T    R ++KAI+LDM+A +++TSA V+EW ++E+ RHP +   L++ELE  VG++RM
Sbjct  289  EQTYIIDRTNIKAIILDMIAAALETSAVVIEWALAEIIRHPRVKSRLQKELEAVVGMNRM  348

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL +L YL+MVIKES R+HPVAPLL+PH +MED  +NG+HIPK++RI++NIWAIG 
Sbjct  349  VEEADLANLTYLDMVIKESLRLHPVAPLLIPHESMEDVTINGYHIPKKSRILINIWAIGR  408

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DPNVWSD  + F+P RF G+N++ RG DF+LIPFGSGRR CPGLQLG+T VRL +AQLVH
Sbjct  409  DPNVWSDNVEDFLPERFVGSNVDLRGHDFQLIPFGSGRRGCPGLQLGLTTVRLALAQLVH  468

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CF+W+LPNGM P +L M+E+FGL   RA+HL+A P YRL
Sbjct  469  CFEWELPNGMLPNDLSMSEKFGLSAPRAEHLLARPVYRL  507



>ref|XP_007221131.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
 gb|EMJ22330.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
Length=494

 Score =   286 bits (732),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 176/227 (78%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   M S +S  +  R H+KAI+ DML GS+DT +  VEW +SEL R+P+ MK +++EL
Sbjct  266  VMVAFMGSEQSEYRIERPHIKAIIFDMLVGSIDTLSVTVEWALSELMRNPKAMKKVQKEL  325

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL RMVEE DL  L+YL MV+KE+ R+HPV PLL+PHAA EDC VNG+HIPK++ +
Sbjct  326  EDVVGLGRMVEESDLGKLDYLSMVVKETMRLHPVGPLLIPHAATEDCTVNGYHIPKKSHV  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            I+N WAIG DP+ W D ++FIP RF G++++ RG  F+LIPFGSGRR CPG+QL + VV+
Sbjct  386  IINAWAIGRDPSAWIDAEEFIPERFDGSDVDVRGNHFQLIPFGSGRRRCPGIQLALIVVQ  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPN M P+ELDMTE FG+ V RAK L+AIP+YRL
Sbjct  446  LMLAQLVHCFDWELPNDMLPEELDMTEVFGITVARAKRLIAIPSYRL  492



>gb|EYU31077.1| hypothetical protein MIMGU_mgv1a024906mg [Erythranthe guttata]
Length=230

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 179/228 (79%), Gaps = 5/228 (2%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T+  IM+SGE+  +F R +VKA++LD+L   +DTSAT +EW +SE+  HP + K L+ E+
Sbjct  6    TLMSIMESGEAGFEFDRRNVKAVLLDLLVAGLDTSATAMEWTLSEVINHPSVTKKLQIEI  65

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG +++V+E  L HL+YL+ V++ES R+HPV PLL+ H +MEDC VNG HIPK+AR+
Sbjct  66   EETVGKNQLVDESHLPHLKYLDYVVRESLRLHPVGPLLI-HESMEDCEVNGLHIPKKARV  124

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRF-SGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            +VN+WAIG DPNVW+DP++F P+RF    N++ RGRDF+LIPFGSGRR CPG+QL +T+V
Sbjct  125  LVNVWAIGRDPNVWADPERFWPDRFVESPNVDLRGRDFQLIPFGSGRRGCPGMQLALTIV  184

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +L+VAQLVHCFDW++P G    ++DM EEFGLV  RAKHLM  PTYRL
Sbjct  185  QLVVAQLVHCFDWEIPGG---GDVDMAEEFGLVTGRAKHLMVRPTYRL  229



>ref|XP_009337209.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   286 bits (732),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 177/221 (80%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E    F R + KAI+LDM++GS DTSAT + W ++EL RHPE+MK L++EL+  VG+D
Sbjct  286  NDEEVYMFERTNAKAILLDMISGSFDTSATAIVWTLAELLRHPEVMKRLQKELQSVVGVD  345

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L+YL MV+KE+ R+HPV PLL+PH +MED +V+G+HIPK++R+ +NIW I
Sbjct  346  RMVEESDLPKLDYLSMVVKETLRLHPVGPLLIPHQSMEDVIVDGYHIPKKSRVFINIWTI  405

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DPNVWSD  ++F P RF  +N++ +G DF+LIPFGSGRR CP +QLG+T VRL +  L
Sbjct  406  GRDPNVWSDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNL  465

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            VHCF+W+LP GM PK+LDMTE+FGL +++AKHL+A+PT+RL
Sbjct  466  VHCFNWELPTGMLPKDLDMTEKFGLSLSKAKHLLAMPTHRL  506



>gb|EYU24036.1| hypothetical protein MIMGU_mgv1a005182mg [Erythranthe guttata]
Length=494

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  +M+SGE+  +F R HVKA++LD+L   MDTS+T VEW +SEL RHP +MK L+ EL
Sbjct  266  TMMAVMESGEAGFEFDRRHVKAVLLDLLVAGMDTSSTAVEWAISELIRHPRVMKKLQNEL  325

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG+DR VEE  L  LEYL+ V+KE+ R+HPV PLL+PH +MEDC ++G+HIPK++R 
Sbjct  326  ESTVGIDRTVEESHLNKLEYLDSVVKETLRLHPVVPLLVPHESMEDCTIDGYHIPKKSRA  385

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+WAIG DP+VW+ P+ F P RFSG+ I+ RGRDF+L+PFGSGRR+CP LQLG+ +V+
Sbjct  386  IVNMWAIGRDPSVWAHPETFSPERFSGSGIDLRGRDFQLVPFGSGRRTCPALQLGVVLVK  445

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCFDW+LPNGM P +LDM+E FGLV +RA+H+MAIP YRL
Sbjct  446  LVLAQLVHCFDWELPNGMLPCDLDMSEHFGLVTSRAEHIMAIPKYRL  492



>ref|XP_008440670.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=497

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 178/229 (78%), Gaps = 2/229 (1%)
 Frame = -3

Query  758  MXDIMKSGEST--IQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEE  585
            + DIM S +     Q  R ++KAI LD+L+ +MDTSAT ++W ++EL +HP+ MK L+ E
Sbjct  268  LLDIMMSSQEADEYQIDRSNIKAIALDVLSAAMDTSATAIDWALAELIKHPQAMKELQVE  327

Query  584  LERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRAR  405
            LE+ VGL+RMVEE  LEHL+YLEMVIKE  R+HP APLL+PH ++EDC V+GFHIPK++R
Sbjct  328  LEKVVGLNRMVEESHLEHLKYLEMVIKEVLRLHPPAPLLVPHESLEDCTVDGFHIPKKSR  387

Query  404  IIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            IIVN W+IG DPNVW+DP+KF P RF  +  + +GRDF+LIPFGSGRR CPG+QLG+ +V
Sbjct  388  IIVNAWSIGQDPNVWTDPQKFFPERFIHSLTDVKGRDFQLIPFGSGRRGCPGIQLGLLIV  447

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
             L+VA LVHCFDW+LPN M   +LDM EEFGL   RA+ LM IP YRLR
Sbjct  448  SLVVANLVHCFDWELPNCMLAIDLDMEEEFGLTCPRAQELMLIPAYRLR  496



>ref|XP_002275826.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=506

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 177/219 (81%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E +    +E++K I+ D++ G++DTSAT +EW++SELFRHP +M+ L+EELE  +G++RM
Sbjct  284  EPSYLIEQENIKGIVWDIIIGAIDTSATTIEWLLSELFRHPRVMRQLQEELENVIGMERM  343

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL +L YL+MV+KE  R+HP  PLLLPH ++ED  +NG++IPK++RII+N WAIG 
Sbjct  344  VEEVDLANLVYLDMVLKEGLRLHPAGPLLLPHESIEDITLNGYYIPKKSRIIINAWAIGR  403

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DPN+WS+  + F P RF G+NI+++G+DF+ IPFGSGRR CPG+QLG+  VRL++AQLVH
Sbjct  404  DPNIWSNNVEDFFPERFIGSNIDFQGKDFQFIPFGSGRRKCPGMQLGLINVRLVLAQLVH  463

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CFDW LPNGM P ELDM+EEFGL + RA HL A+PTYRL
Sbjct  464  CFDWKLPNGMLPSELDMSEEFGLALPRATHLHALPTYRL  502



>emb|CDP12932.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -3

Query  686  DMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVI  507
            D+L  SMDTS T VEW +SEL RHPE M+ L++ELE +VGL+R+VEE D+E LEYL+MVI
Sbjct  6    DLLVASMDTSVTAVEWAISELLRHPEAMRKLQKELEEKVGLERIVEESDVEGLEYLDMVI  65

Query  506  KESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRF  327
            KES R+HPVAPLLLPH +MEDC V+ FHI K ARII+N++AIG DP+VW DP+ F+P RF
Sbjct  66   KESMRLHPVAPLLLPHESMEDCTVDDFHIQKNARIIINVYAIGRDPSVWRDPEIFVPERF  125

Query  326  SGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDM  147
              +NI  RG+DF LIPFGSGRR CPGLQLG+TVVR ++AQLVHCF+W+L + + P +LDM
Sbjct  126  RDSNIYLRGQDFRLIPFGSGRRICPGLQLGLTVVRFVLAQLVHCFNWELADNIQPTDLDM  185

Query  146  TEEFGLVVTRAKHLMAIPTYRL  81
            +E FG+V +RAKHL  +P YRL
Sbjct  186  SEAFGIVTSRAKHLKVVPAYRL  207



>ref|XP_004143571.1| PREDICTED: cytochrome P450 71A1-like, partial [Cucumis sativus]
Length=414

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 178/230 (77%), Gaps = 4/230 (2%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKA----IMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLK  591
            M +IM S  +  Q  R   ++    + +DML  +MDTSAT + W + EL +HP +MK ++
Sbjct  183  MLEIMDSHGTEYQIERSIKESRRIWLTVDMLVAAMDTSATTIGWAIPELIKHPHVMKKMQ  242

Query  590  EELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKR  411
            +EL++ VGLDR VEE DL+HL+YL+MV+KE  R+HP APLL+PH A+EDC+V+GF+IPK+
Sbjct  243  DELQKVVGLDRKVEETDLDHLQYLDMVVKEILRLHPPAPLLVPHEALEDCIVDGFYIPKK  302

Query  410  ARIIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGIT  231
            +RIIVN WAIG DPN W DP+KF P RF G+ ++ RG+DF+LIPFGSGRR CPG+Q+G+T
Sbjct  303  SRIIVNGWAIGRDPNFWIDPEKFFPERFIGSQVDVRGKDFQLIPFGSGRRGCPGMQMGLT  362

Query  230  VVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            VVRL++AQLVHCFDW+LPNG  P ELDMTEEFGL   RA+ LM  P YRL
Sbjct  363  VVRLVIAQLVHCFDWELPNGTLPVELDMTEEFGLTCPRAQDLMVTPIYRL  412



>ref|XP_004252295.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=496

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 184/227 (81%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM + M+SG++  QF R H+KA++ DM+  ++DTSAT ++WI++EL RHP +MK L+ E+
Sbjct  268  TMLEFMQSGKAEFQFDRIHIKAVLFDMIVAAIDTSATTIDWILTELLRHPHVMKKLQIEI  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            ++ VGL+RMV+E DLE+L+YL+MV+KE  R+H V P+     AMEDCV++GF+I K +RI
Sbjct  328  KQVVGLERMVKESDLENLKYLDMVVKEGMRLHSVVPVT-QREAMEDCVIDGFNIRKGSRI  386

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +AI  DPN+WS+P+KF+P RF G+NI+ RGRDF+L+PF SGRRSCP +QLGI VVR
Sbjct  387  MINHYAIQRDPNLWSEPEKFLPERFIGSNIDVRGRDFQLLPFNSGRRSCPAIQLGIIVVR  446

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFDW+LPNGM P +LD+ E FG+V ++ KHLMAIPT RL
Sbjct  447  LVVAQLVHCFDWELPNGMQPCDLDLEEHFGIVTSKEKHLMAIPTCRL  493



>ref|XP_009337257.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E    F R + KAI+LDM++GS DTSA  + W ++EL RHPE+MK L++EL+  VG+DRM
Sbjct  288  EEVYMFERTNAKAILLDMISGSFDTSAMAIVWTLAELLRHPEVMKRLQKELQSVVGMDRM  347

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL  L+YL MV+KES R+HPV PLL+PH +MED +V+G+HIPK++R+ +NIW IG 
Sbjct  348  VEESDLPKLDYLSMVVKESLRLHPVGPLLIPHQSMEDVIVDGYHIPKKSRVFINIWTIGR  407

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DPNVWSD  ++F P RF  +N++ +G DF+LIPFGSGRR CP +QLG+T VRL +  LVH
Sbjct  408  DPNVWSDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNLVH  467

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CF+W+LP GM PK+LDMTE+FGL +++AKHL+A+PT+ L
Sbjct  468  CFNWELPTGMLPKDLDMTEKFGLSLSKAKHLLAMPTHHL  506



>gb|EYU27291.1| hypothetical protein MIMGU_mgv1a023536mg [Erythranthe guttata]
Length=497

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 171/227 (75%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM SGE+  +F   HVKA++LDML G  DTSA  V W ++EL RHP+IMK L++EL
Sbjct  270  TMIAIMDSGEAGFEFDHRHVKAVLLDMLIGGTDTSAVTVNWALAELIRHPQIMKKLQQEL  329

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            ++ VG+D  +EE  L+ L+YL  VIKE+FR+HP+ PL+  H  MED  V  FH+PK + +
Sbjct  330  DKVVGMDEYIEESHLDKLDYLNFVIKETFRLHPIVPLI-GHKTMEDLTVENFHVPKGSSV  388

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             VN+W+I  DPNVW DP+KF P RFS TN++ +GRDF L+PFGSGRR CPG QLG+TVVR
Sbjct  389  FVNVWSIHKDPNVWEDPEKFWPERFSETNVDLQGRDFRLLPFGSGRRVCPGYQLGLTVVR  448

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++A+LVHCFDW+LPNGM P ELDM E F  V++R K LMAIP YRL
Sbjct  449  LVLARLVHCFDWELPNGMLPNELDMAEHFRFVMSREKPLMAIPVYRL  495



>ref|XP_009336569.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E      R + KAI+LDM+AG+ DTSAT + W ++EL RHP++MK L+EEL+  +G+DRM
Sbjct  285  EEVYMLERTNAKAILLDMIAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRM  344

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL  L+YL MV+KES R+HPVAPLL+PH +MED  V+G+HIPK++RI +NIW IG 
Sbjct  345  VEESDLPKLDYLSMVVKESLRLHPVAPLLVPHQSMEDITVDGYHIPKKSRIFINIWTIGR  404

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DP+VWSD  ++F P RF  +N++ RG DF+LIPFGSGRR CP +QLG+T VRL +  L+H
Sbjct  405  DPSVWSDNVEEFYPERFMNSNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRLALGNLLH  464

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CF+W+LP+GM PK+LDMTE+FGL +++AKHL+A+PT RL
Sbjct  465  CFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRL  503



>ref|XP_004153472.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 ref|XP_004162329.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 gb|KGN48795.1| hypothetical protein Csa_6G501350 [Cucumis sativus]
Length=498

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 175/229 (76%), Gaps = 2/229 (1%)
 Frame = -3

Query  758  MXDIMKSGES--TIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEE  585
            + DIM S +     Q  R ++KAI LD+L+ +MDTSAT ++W ++EL +HP+ MK L+ E
Sbjct  269  LLDIMMSSQDPDGYQIDRSNIKAIALDVLSAAMDTSATAIDWALAELIKHPQAMKELQVE  328

Query  584  LERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRAR  405
            LE+ VGL+RMVEE  LEHL+YL MVIKE  R+HP APLL+PH ++EDC V+GFHIPK++R
Sbjct  329  LEKVVGLNRMVEESHLEHLQYLGMVIKEVLRLHPPAPLLVPHESLEDCTVDGFHIPKKSR  388

Query  404  IIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            I VN W+IG DPNVW DP+KF P RF  +  + +GRDF LIPFGSGRRSCPG+ LG+ +V
Sbjct  389  IFVNAWSIGQDPNVWIDPQKFFPERFIHSLADVKGRDFHLIPFGSGRRSCPGIHLGLLIV  448

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
             L+VA LVHCFDW+LPN M   +LDM EEFGL   RA+ LM IPTYRLR
Sbjct  449  SLVVANLVHCFDWELPNCMLATDLDMEEEFGLTCPRAQELMLIPTYRLR  497



>ref|XP_004299223.2| PREDICTED: cytochrome P450 CYP736A12-like [Fragaria vesca subsp. 
vesca]
Length=535

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = -3

Query  749  IMKSGESTIQF-TREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQ  573
            ++   +  + F  RE+VKAI+LDM+  + DTSAT + W ++EL RHP IMK L+EEL+  
Sbjct  310  LLNPNDEQVHFLDRENVKAILLDMITAAFDTSATTIIWSLAELMRHPRIMKQLQEELQTV  369

Query  572  VGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVN  393
            VG+DRMVEE DL  L+YL +V+KESFR+HPVAPLL+PH +++D  ++G+ IPK++R+IVN
Sbjct  370  VGMDRMVEESDLPKLDYLNLVVKESFRLHPVAPLLVPHESIKDITIDGYDIPKKSRLIVN  429

Query  392  IWAIGHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLL  216
             W+I  DPNVWS+  ++F P RF+ +NI+ RG D++LIPFG+GRR CPG+QLG+T VRL+
Sbjct  430  FWSIARDPNVWSENVEEFYPERFTNSNIDLRGHDYQLIPFGTGRRGCPGMQLGLTTVRLV  489

Query  215  VAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +AQLVHCF+W+LPNGM P++L+MTE+FGL +++AKHL+A PTYRL
Sbjct  490  LAQLVHCFNWELPNGMLPQDLNMTEKFGLSLSKAKHLLAKPTYRL  534



>ref|XP_009337201.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=519

 Score =   281 bits (720),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 174/214 (81%), Gaps = 1/214 (0%)
 Frame = -3

Query  719  FTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeed  540
            F R + KAI+LDM++GS DTSAT + W ++EL RHP++MK L++EL+  VG+DRMVEE D
Sbjct  306  FERTNAKAILLDMISGSFDTSATAIVWTLAELLRHPKVMKRLQKELQSVVGMDRMVEESD  365

Query  539  lehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVW  360
            L  L+YL MV+KES R+HPV PLL+PH +MED +V+G+HIPK++ I +NIW IG DPNVW
Sbjct  366  LPKLDYLSMVVKESLRLHPVGPLLIPHQSMEDVIVDGYHIPKKSIIFINIWTIGRDPNVW  425

Query  359  SDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWD  183
            SD  ++F P RF  +N++ +G DF+LIPFGSGRR CP +QLG+T VRL +  LVHCF+W+
Sbjct  426  SDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNLVHCFNWE  485

Query  182  LPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            LP GM PK+LDMTE+FGL +++AKHL+A+PT+RL
Sbjct  486  LPTGMLPKDLDMTEKFGLSMSKAKHLLAMPTHRL  519



>ref|XP_009346975.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E      R + KAI+LDM+AG+ DTSAT + W ++EL RHP++MK L+EEL+  +G+DRM
Sbjct  285  EEVYMLERTNAKAILLDMIAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRM  344

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL  L+YL MV+KES R+HPVAPLL+PH +MED  V+G+HIPK++RI +NIW IG 
Sbjct  345  VEESDLPKLDYLSMVVKESLRLHPVAPLLVPHQSMEDITVDGYHIPKKSRIFINIWTIGR  404

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DP+VWSD  ++F P RF  +N++ RG DF+LIPFGSGRR CP +QLG+T VR  +  L+H
Sbjct  405  DPSVWSDNVEEFYPERFMNSNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRFALGNLLH  464

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CF+W+LP+GM PK+LDMTE+FGL +++AKHL+A+PT RL
Sbjct  465  CFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRL  503



>gb|KEH15707.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=430

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 171/225 (76%), Gaps = 0/225 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D + + +S  +  R ++KAIM+DML G+MDTSAT +EW +SEL ++P +MK +++ELE
Sbjct  205  MLDFVGTEQSEYRIERSNIKAIMMDMLIGAMDTSATSIEWTISELLKNPRVMKKVQKELE  264

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R VEE DL+ LEYL +VIKES RIHPV PLL+PH +MEDC V  F IPK + I+
Sbjct  265  TVVGMKRKVEESDLDKLEYLNIVIKESLRIHPVVPLLVPHQSMEDCTVEEFFIPKNSMIV  324

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAI  DPN W+DP+KF P RF G NI+  G DF+LIPF SGRR CPGLQLG+T+VRL
Sbjct  325  VNAWAIMRDPNSWTDPEKFWPERFEGNNIDVGGHDFQLIPFSSGRRGCPGLQLGLTMVRL  384

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYR  84
            +VAQLVHCFD+ LPN M P +LDM E FG+ + RA HL+AIP YR
Sbjct  385  VVAQLVHCFDFKLPNHMLPSDLDMAEAFGVTMRRANHLIAIPVYR  429



>gb|KEH15895.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=323

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 169/226 (75%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R ++KAI++DML G+ DTSAT +EW +SEL ++P +MK +++ELE
Sbjct  98   MLGFVGTEESDYRIERSNIKAIIMDMLIGATDTSATAIEWTISELLKNPRVMKKVQKELE  157

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R VEE DLE LEYL MVIKES R HPV PL +PH +MEDC V  F IPK +RI+
Sbjct  158  IVVGMKRKVEESDLEKLEYLNMVIKESLRFHPVVPLSVPHQSMEDCTVEEFFIPKNSRIM  217

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAI  DPN W+DP+KF P RF G NI+  G+ F LIPFGSGRR CPGLQLG+T+VRL
Sbjct  218  VNAWAIMRDPNSWTDPEKFWPERFEGNNIDVGGQHFHLIPFGSGRRGCPGLQLGLTMVRL  277

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             VAQLVHCFD+ LPN M P +LDMTE FG+ + RA HL+AIP YRL
Sbjct  278  AVAQLVHCFDFKLPNDMLPSDLDMTESFGVTMPRANHLIAIPVYRL  323



>ref|XP_003596030.1| Cytochrome P450 [Medicago truncatula]
 gb|AES66281.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 170/226 (75%), Gaps = 0/226 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R ++K IM+DML GS DTSAT +EW +SEL ++P +MK +++ELE
Sbjct  248  MLGFVGTEESDYRIERSNIKGIMMDMLIGSTDTSATSIEWTISELLKNPRVMKKVQKELE  307

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R VEE DL+ LEYL MVIKES RIHPV PLL+PH +MEDC V  F IPK +RII
Sbjct  308  TVVGMKRKVEESDLDKLEYLNMVIKESLRIHPVVPLLVPHQSMEDCTVEDFFIPKNSRII  367

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAI  DPN W+DP+KF P RF G NI+  G DF+LIPFGSGRR CPGL LG+T+VRL
Sbjct  368  VNGWAIMRDPNSWTDPEKFWPERFEGNNIDVGGHDFQLIPFGSGRRGCPGLHLGLTMVRL  427

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +VAQ+VHCFD  LPN M P +LDMTE FG+ + RA HL+A+P YRL
Sbjct  428  VVAQIVHCFDLKLPNDMLPSDLDMTEAFGITMPRANHLIALPVYRL  473



>gb|EYU31073.1| hypothetical protein MIMGU_mgv1a004944mg [Erythranthe guttata]
Length=503

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 172/227 (76%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM SGE+     R HVKA++ DML G  DT+A   +W ++EL RHP+IM  L++EL
Sbjct  276  TMMAIMDSGEAGFDLDRRHVKAVLADMLIGGTDTTAVTTDWALAELIRHPQIMNKLQQEL  335

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG+++ VEE  LE L+YL++VIKE+FR+HP+ PLL  H AM+DC V+ FHIPK  R+
Sbjct  336  EQVVGMEQYVEESHLEKLDYLDLVIKETFRLHPIVPLL-NHKAMQDCTVDEFHIPKGTRV  394

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+ +I  DPNVW +P+KF P RF G + +YRG DF  IPFGSGRR CPG+ LG+T +R
Sbjct  395  IVNLLSISRDPNVWQEPEKFSPERFVGIDTDYRGMDFRFIPFGSGRRMCPGIHLGLTSLR  454

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQL+HCFDW+LPNG SP EL+M E FGLV +R +HLMAIP YRL
Sbjct  455  LMLAQLIHCFDWELPNGTSPNELNMAEHFGLVTSRDEHLMAIPIYRL  501



>ref|XP_004291274.1| PREDICTED: cytochrome P450 CYP736A12-like [Fragaria vesca subsp. 
vesca]
Length=505

 Score =   279 bits (713),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 177/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            RE+ KAI+L+M+ G+ DTS T + W ++EL RHP IMK L+EEL+  VG+DRMVEE DL 
Sbjct  293  RENAKAILLEMITGAFDTSTTTIIWSLAELMRHPRIMKRLQEELQTVVGMDRMVEESDLP  352

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L+YL +V+KESFR+HPVAPLL+P  +++D  ++G+ IPK+ R+IVN+W+IG DPNVWS+
Sbjct  353  KLDYLNLVVKESFRLHPVAPLLVPRESIKDITIDGYDIPKKLRLIVNLWSIGRDPNVWSE  412

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF+ +NI+ RG D++LIPFG+GRR CPG+QLG+T VRL++AQLVHCF+W+LP
Sbjct  413  NVEEFCPERFTNSNIDLRGHDYQLIPFGTGRRGCPGMQLGLTTVRLVLAQLVHCFNWELP  472

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            NGM P++LDMTE+FGL +++AKHL+A PTYRL
Sbjct  473  NGMLPQDLDMTEQFGLSMSKAKHLLAKPTYRL  504



>ref|XP_009337244.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   279 bits (714),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E   +  R  VKAI+LDM+ GS DTSAT + W ++EL RHP +MK L+EEL+R +G D
Sbjct  300  NDEQGYRIERTDVKAILLDMITGSFDTSATAIVWNLAELLRHPRVMKHLQEELQRVIGTD  359

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L YL  VIKESFR+HP+AP L+P  +M+D  V+G++IPK+++I++N WAI
Sbjct  360  RMVEESDLRKLSYLNAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAI  419

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DPNVWSD   KF P RF  +N++ RG DF+L+PFGSGRR CPG+QLG+T VRL++A +
Sbjct  420  GRDPNVWSDNVGKFYPERFINSNVDLRGHDFQLLPFGSGRRGCPGVQLGLTTVRLVLANI  479

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            VHCF+WDLP+G+ P++LDMTE FG V T+A+HL+A PTYRL
Sbjct  480  VHCFNWDLPSGLLPQDLDMTETFGSVPTKAQHLLATPTYRL  520



>dbj|BAD15331.1| cytochrome P450 [Panax ginseng]
Length=500

 Score =   278 bits (712),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 172/212 (81%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R  +KAIM+D+++ ++DTS T +EWI++EL +HP  MK  +EE++  VG+DRMVEE DL 
Sbjct  289  RSVIKAIMIDIISAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRMVEETDLP  348

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
            +LEY+ MV+KE  R+HPVAPLL PH +MED  +NG+ IPK++R+IVN WA+G DPNVWS 
Sbjct  349  NLEYVYMVVKEGLRLHPVAPLLGPHESMEDITINGYFIPKQSRVIVNSWALGRDPNVWSE  408

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            D  +F+P RF G+NI+ RGRDF+L+PFGSGRR CPG+QLG+  V+L+VA+LVHCFDW+LP
Sbjct  409  DADEFLPERFEGSNIDVRGRDFQLLPFGSGRRGCPGMQLGLITVQLVVARLVHCFDWNLP  468

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            NG++P  LDMTE+FGL   R KHL+A+P YRL
Sbjct  469  NGITPDNLDMTEKFGLTTPRVKHLLAVPKYRL  500



>ref|XP_002511968.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF50637.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=501

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 175/216 (81%), Gaps = 2/216 (1%)
 Frame = -3

Query  722  QFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeee  543
            +  R ++KAI++D++  ++DTSAT +EW ++EL RHP+ MKTL++EL+  VGLD+MVEE+
Sbjct  284  EIDRSNIKAILIDIIVAAVDTSATAIEWTLAELIRHPQAMKTLQDELQNVVGLDKMVEEK  343

Query  542  dlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNV  363
            DL  L YL+MVIKES R+HPVAPLL+PH ++++  ++G+HIPKR+RI+VNIWAIG D NV
Sbjct  344  DLSKLTYLDMVIKESSRLHPVAPLLVPHESIDEITIDGYHIPKRSRILVNIWAIGRDSNV  403

Query  362  WSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDW  186
            WSD   +F+P RF GTN++  G DF LIPFGSGRR CPG+ LG+T VR+ +AQLVHCF+W
Sbjct  404  WSDNVDEFLPERFIGTNVDLHGHDFRLIPFGSGRRGCPGIHLGLTTVRMAIAQLVHCFNW  463

Query  185  DLPNG-MSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             LP+G +SP ELDM+E+FGL V+RA HL  +P YRL
Sbjct  464  KLPDGDVSPSELDMSEQFGLTVSRASHLFLVPEYRL  499



>ref|XP_003531375.1| PREDICTED: cytochrome P450 750A1-like isoform X1 [Glycine max]
Length=498

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 176/227 (78%), Gaps = 0/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   + S E   +  R ++KAI+LDML GSMDTSATV+EW +SEL ++P +MK ++ EL
Sbjct  267  VMLGFVGSEEYEYRIERPNIKAILLDMLLGSMDTSATVIEWTLSELLKNPRVMKKVQMEL  326

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG+ R V+E DL+ LEYL+MVIKE+ R+HPVAPLL+PH + EDC+V  F IP+++R+
Sbjct  327  ETVVGMQRKVKESDLDKLEYLDMVIKENMRLHPVAPLLIPHQSREDCMVGDFFIPRKSRV  386

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N WAI  D +VWS+ +KF P RF G+NI+ RG DF+ IPFGSGRR+CPG+Q+G+T+VR
Sbjct  387  VINAWAIMRDSSVWSEAEKFWPERFEGSNIDVRGHDFQFIPFGSGRRACPGMQMGLTMVR  446

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L VAQLVHCF W LP+ M P  LDMTEEFGL + RA HL+A+PTYRL
Sbjct  447  LTVAQLVHCFHWKLPSDMLPDHLDMTEEFGLTMPRANHLLAVPTYRL  493



>ref|XP_009337218.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E   +  R  VKAI+LDM+ GS DTSAT + W ++EL RHP +MK L+EEL+R +G D
Sbjct  300  NDEQGYRIERTDVKAILLDMITGSFDTSATAIVWNLAELLRHPRVMKHLQEELQRVIGTD  359

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L YL  VIKESFR+HP+AP L+P  +M+D  V+G++IPK+++I++N WAI
Sbjct  360  RMVEESDLRKLSYLNAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAI  419

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DPNVWSD   KF P RF  +N++ RG DF+L+PFGSGRR CPG+QLG+T VRL +A +
Sbjct  420  GRDPNVWSDNVGKFYPERFINSNVDLRGHDFQLLPFGSGRRGCPGMQLGLTTVRLALANI  479

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            VHCF+WDLP+G+ P++LDMTE FG V T+A+HL A+PTYRL
Sbjct  480  VHCFNWDLPSGLLPQDLDMTETFGSVPTKAQHLFAMPTYRL  520



>gb|KJB78920.1| hypothetical protein B456_013G025400 [Gossypium raimondii]
Length=507

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 171/212 (81%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            RE++KAIM+DM+A S DT+AT +EW ++EL RHP +M  L++ELER VG  RMVEE DL 
Sbjct  294  RENIKAIMVDMVAASFDTTATAIEWTLAELLRHPSVMVALQQELERIVGRHRMVEESDLP  353

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL+MVIKES R+HPVAPLL+P  + ED  ++G+ IPK++RI+VN+W+IG D  VWS+
Sbjct  354  KLAYLDMVIKESLRLHPVAPLLIPRESTEDITIDGYFIPKKSRILVNVWSIGRDHKVWSN  413

Query  353  -PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF  +NI+ RG DF+LIPFGSGRR CPG+QLG+T +RL++AQLVHCFDW+LP
Sbjct  414  NAEEFFPERFKDSNIDLRGHDFQLIPFGSGRRGCPGMQLGLTTMRLIIAQLVHCFDWELP  473

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GM P ELDMTE+FGL + RA HL+A PTYRL
Sbjct  474  DGMLPNELDMTEKFGLSLPRANHLLANPTYRL  505



>ref|XP_004301061.2| PREDICTED: cytochrome P450 CYP736A12-like [Fragaria vesca subsp. 
vesca]
Length=536

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 177/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            RE+VKAI+LDM+  + DTSAT + W ++EL RHP IMK L+EEL+  VG+DR VEE DL 
Sbjct  324  RENVKAILLDMITAAFDTSATTIIWSLAELMRHPRIMKQLQEELQIVVGMDRGVEESDLP  383

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L+YL +V+KESFR+HPVAPLLLPH +++D  ++G+ IPK++R+IVN W+I  DPNVWS+
Sbjct  384  KLDYLNLVVKESFRLHPVAPLLLPHESIKDITIDGYDIPKKSRLIVNFWSIARDPNVWSE  443

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF+ +NI+ +G D++LIPFG+GRR CPG+QLG+T VRL++AQL+HCF+W+LP
Sbjct  444  NVEEFCPERFTNSNIDLQGHDYQLIPFGTGRRGCPGMQLGLTTVRLVLAQLMHCFNWELP  503

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            NGM P++LDMTE+FGL +++AKHL+A PTYRL
Sbjct  504  NGMLPQDLDMTEKFGLSLSKAKHLLAKPTYRL  535



>ref|XP_004252382.1| PREDICTED: cytochrome P450 CYP736A12 [Solanum lycopersicum]
Length=493

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 175/227 (77%), Gaps = 1/227 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM DIM S +   QF R ++KAI++DML  ++DTSAT V+WI++EL RHP +M  L++EL
Sbjct  266  TMLDIMHSRDREFQFDRTNIKAILIDMLVAAIDTSATSVDWIVTELLRHPHVMTKLQKEL  325

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+RMV+E D E L+YL+MV+KE  R+H V P+     AMEDCVV+G+HI K +RI
Sbjct  326  EEVVGLERMVKESDFEKLKYLDMVVKEGMRLHSVVPVT-QREAMEDCVVDGYHIRKGSRI  384

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            ++N +AI  DPNVW +P+KF P RF G++I+ RGRDFEL+PF SGRRSCP +QLGI VVR
Sbjct  385  MINHYAIQRDPNVWPEPEKFFPERFVGSSIDIRGRDFELLPFSSGRRSCPAIQLGIIVVR  444

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L+VAQLVHCFD +LPNGM P +LD+ E FG+V ++  HLM +P YRL
Sbjct  445  LMVAQLVHCFDLELPNGMQPCDLDVDEHFGIVTSKENHLMVVPKYRL  491



>sp|H2DH18.1|C7A12_PANGI RecName: Full=Cytochrome P450 CYP736A12 [Panax ginseng]
 gb|AEY75215.1| cytochrome P450 CYP736A12 [Panax ginseng]
Length=500

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 172/212 (81%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R  +KAIM+D+++ ++DTS T +EWI++EL +HP  MK  +EE++  VG+DRMVEE DL 
Sbjct  289  RSVIKAIMIDIISAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRMVEETDLP  348

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
            +LEY+ MV+KE  R+HPVAPLL PH +MED  +NG+ IPK++R+IVN WA+G DPNVWS 
Sbjct  349  NLEYVYMVVKEGLRLHPVAPLLGPHESMEDITINGYFIPKQSRVIVNSWALGRDPNVWSE  408

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F+P RF G+N++ RGRDF+L+PFGSGRR CPG+QLG+  V+L+VA+LVHCFDW+LP
Sbjct  409  NAEEFLPERFEGSNVDVRGRDFQLLPFGSGRRGCPGMQLGLITVQLVVARLVHCFDWNLP  468

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            NG +P  LDMTE+FGL   R KHL+A+P YRL
Sbjct  469  NGTTPDNLDMTEKFGLTTPRVKHLLAVPKYRL  500



>ref|XP_008460602.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=528

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = -3

Query  749  IMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQV  570
            +M S  +        +KA++L+M+  +MDT+AT ++W + EL RHP IMK +++EL++ V
Sbjct  304  LMGSQNNEYNIDPSTIKALILEMVITAMDTTATNIDWAIVELIRHPHIMKKMQQELDKVV  363

Query  569  GLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNI  390
            GL RMV E DLEHL+YL MVIKE  R+HP  PLL+PH +++DC  NGFHIPK++RIIVN 
Sbjct  364  GLQRMVLESDLEHLQYLNMVIKEVLRLHPPVPLLVPHESLQDCTTNGFHIPKQSRIIVNA  423

Query  389  WAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVA  210
            WAIG DP VW+DP+KF P RF  + ++ +G+DFELIPFGSGRR CPG+ LG+T+VRLL+A
Sbjct  424  WAIGRDPTVWNDPQKFFPERFIDSEVDLKGKDFELIPFGSGRRCCPGMHLGLTMVRLLLA  483

Query  209  QLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            QLVH F W+LPNG+ P +LDMTEEFGL   RA+HLM  P YRL L
Sbjct  484  QLVHAFYWELPNGILPNQLDMTEEFGLTCPRAQHLMVTPIYRLIL  528



>gb|AAL66194.1|AF386512_1 cytochrome P450 [Pyrus communis]
Length=506

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 168/218 (77%), Gaps = 0/218 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E      R + KA +LDM+AG+ DTSAT + W ++EL RHP++MK L+EEL+  +G+DRM
Sbjct  285  EEVYMLERTNAKATLLDMIAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRM  344

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL  L+YL MV+KESFR+HPVAPLL+PH +MED  V+G+H PK++RI +NIW IG 
Sbjct  345  VEESDLPKLDYLSMVVKESFRLHPVAPLLVPHQSMEDITVDGYHTPKKSRIFINIWTIGR  404

Query  374  DPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHC  195
            DP  W + ++F P RF   N++ RG DF+LIPFGSGRR CP +QLG+T VRL +  L+HC
Sbjct  405  DPKSWDNAEEFYPERFMNRNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRLALGNLLHC  464

Query  194  FDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             +W+LP+GM PK+LDMTE+FGL +++AKHL+A PT RL
Sbjct  465  SNWELPSGMLPKDLDMTEKFGLSLSKAKHLLATPTCRL  502



>ref|XP_008374739.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=508

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 174/221 (79%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E      R + KAI+LDM+AG+ DTSAT + W ++EL RHP++MK L+EEL+  +G+D
Sbjct  284  NBEEVYMLERTNXKAILLDMIAGAXDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMD  343

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L+YL MV+KES R+ PVAPLL+PH +MED  V+G+HIPK++R+ +NIW I
Sbjct  344  RMVEESDLPKLDYLSMVVKESLRLXPVAPLLVPHQSMEDITVDGYHIPKKSRVFINIWTI  403

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DP+VWSD  ++F P RF   N++ RG DF+LIPFGSGRR C  +QLG+T VRL++  L
Sbjct  404  GRDPSVWSDNVEEFYPERFMNNNVDLRGHDFQLIPFGSGRRGCXAMQLGLTTVRLVLGNL  463

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +HCF+W+LP+GM PK+LDMTE+FGL +++AKHL+A+PT RL
Sbjct  464  LHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRL  504



>ref|XP_003532846.1| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=500

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 167/225 (74%), Gaps = 0/225 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M D + + ES  +  R ++KAI+LDML GS+DTSAT +EW +SEL ++P +MK L+ EL
Sbjct  268  AMLDFVGTEESEYRIERPNIKAILLDMLVGSIDTSATAIEWTISELLKNPRVMKKLQREL  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VG+ R V E DL+ L+YLEMV+KE  R+HPVAPLLLPH + EDC+V  + IPK +R+
Sbjct  328  ETVVGMKRKVGESDLDKLKYLEMVVKEGLRLHPVAPLLLPHHSREDCMVGEYFIPKNSRV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN W I  DP+ W + +KF P RF G+NI+ RG+DF  +PFGSGRR CPGLQLG+  V 
Sbjct  388  IVNAWTIMRDPSAWDEAEKFWPERFEGSNIDVRGKDFRFLPFGSGRRVCPGLQLGLNTVL  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTY  87
            L VAQLVHCFDW LPN M P ELDMTEEFGL + RA HL+ IPTY
Sbjct  448  LTVAQLVHCFDWKLPNNMLPCELDMTEEFGLSMPRANHLLVIPTY  492



>ref|XP_008360900.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=504

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 171/212 (81%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R +VKAI+LDM++G+ DTSAT + W ++EL RHP +MK L++EL+  +G+DR VEE DL 
Sbjct  291  RTNVKAILLDMISGAFDTSATAIVWNLAELLRHPRVMKLLQQELQTVIGMDRTVEESDLP  350

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL  VIKESFR+HPVAPLL+PHA+MED  V+G+HIPK++ I VNIW IG DP+VWSD
Sbjct  351  KLAYLNKVIKESFRLHPVAPLLIPHASMEDITVDGYHIPKKSTIFVNIWTIGRDPSVWSD  410

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF+ ++++ +G DF+L+PFGSGRR CP +QLG+T VRL +A LVHCF++DLP
Sbjct  411  NVEEFYPERFNDSDVDLKGHDFQLLPFGSGRRGCPAMQLGLTTVRLALANLVHCFNFDLP  470

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +G+ P ELDMTE FGL +++ KHL+ +PTYRL
Sbjct  471  SGLLPNELDMTETFGLSLSKTKHLLVVPTYRL  502



>gb|KGN49699.1| hypothetical protein Csa_5G076690 [Cucumis sativus]
Length=305

 Score =   267 bits (683),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = -3

Query  749  IMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQV  570
            +M S  +  +  R  +KA++L+M+  +MDT+AT ++W + EL RHP IM  +++EL++ V
Sbjct  81   LMGSQNNEYKIDRSTIKALILEMVITAMDTTATSIDWAIVELIRHPHIMNKMQQELDKVV  140

Query  569  GLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNI  390
            GL RMV E DLEHL+YL MVIKE  R+HP  PLL+PH +++DC +NG HIPK++RIIVN 
Sbjct  141  GLQRMVLESDLEHLQYLNMVIKEILRLHPPVPLLVPHESLQDCTINGLHIPKQSRIIVNA  200

Query  389  WAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVA  210
            WAIG DP +W+DP+ F P RF  + ++ +G+DFELIPFGSGRR CPG+ LG+TVVRLL+A
Sbjct  201  WAIGQDPTIWNDPQNFFPERFIDSEVDLKGKDFELIPFGSGRRGCPGMHLGLTVVRLLLA  260

Query  209  QLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            QLVH F W+LPN + P +LD+ EEFGL   RA+ LM  P YRL++
Sbjct  261  QLVHAFHWELPNDILPNQLDVREEFGLTCPRAQQLMVTPIYRLKI  305



>ref|XP_008346790.1| PREDICTED: cytochrome P450 CYP736A12-like isoform X1 [Malus domestica]
Length=399

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E      R + KAI+LDM+AG+ DTSAT + W ++EL RHP++MK L+EEL+  +G+D
Sbjct  175  NDEEVYMLERTNAKAILLDMIAGAFDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMD  234

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L+YL MV+KES R++PVAPLL+PH +MED  V+G+HIPK++R+  NIW I
Sbjct  235  RMVEESDLPKLDYLSMVVKESLRLNPVAPLLVPHQSMEDITVDGYHIPKKSRVFXNIWTI  294

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DP+VWSD  ++F P  F   N++ RG DF+LIPFGSGRR CP +QLG+T VR ++  L
Sbjct  295  GRDPSVWSDNVEEFYPEXFMNNNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRXVLGNL  354

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +HCF+W+LP+GM PK+LDMTE+FGL +++AKHL+A+ T RL
Sbjct  355  LHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMXTCRL  395



>ref|XP_008346791.1| PREDICTED: cytochrome P450 CYP736A12-like isoform X2 [Malus domestica]
Length=399

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E      R + KAI+LDM+AG+ DTSAT + W ++EL RHP++MK L+EEL+  +G+D
Sbjct  175  NDEEVYMLERTNAKAILLDMIAGAFDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMD  234

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L+YL MV+KES R++PVAPLL+PH +MED  V+G+HIPK++R+  NIW I
Sbjct  235  RMVEESDLPKLDYLSMVVKESLRLNPVAPLLVPHQSMEDITVDGYHIPKKSRVFXNIWTI  294

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DP+VWSD  ++F P  F   N++ RG DF+LIPFGSGRR CP +QLG+T VR ++  L
Sbjct  295  GRDPSVWSDNVEEFYPEXFMNNNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRXVLGNL  354

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +HCF+W+LP+GM PK+LDMTE+FGL +++AKHL+A+ T RL
Sbjct  355  LHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMXTCRL  395



>ref|XP_008374965.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=622

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 174/221 (79%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E      R + KAI+LDM+AG+ DTSAT + W ++EL RHP++MK L+EEL+  +G+D
Sbjct  398  NDEEVYMLERTNXKAILLDMIAGAXDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMD  457

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L+YL MV+KES R+HPVAPLL+PH +MED  V+G+HIPK++R+ +NIW I
Sbjct  458  RMVEESDLPKLDYLXMVVKESLRLHPVAPLLVPHQSMEDITVDGYHIPKKSRVFINIWTI  517

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DP+VWSD  ++F P RF   N++ RG DF+LIPFGSGRR CP +QLG+T VRL +  L
Sbjct  518  GRDPSVWSDNVEEFYPERFMNXNVDLRGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNL  577

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +HCF+W+LP+GM PK+LDMTE+F L +++AKHL+A+PT RL
Sbjct  578  LHCFNWELPSGMLPKDLDMTEKFRLSLSKAKHLLAMPTCRL  618



>ref|XP_007159750.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
 gb|ESW31744.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
Length=497

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 165/209 (79%), Gaps = 0/209 (0%)
 Frame = -3

Query  707  HVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehl  528
            ++KAI+LD+L GS+DTSAT +EW +SEL ++P +MK L+ ELE  VG+ R VEE DLE L
Sbjct  284  NIKAILLDLLVGSIDTSATAIEWTLSELLKNPRVMKKLQVELESVVGMKRKVEESDLEKL  343

Query  527  eylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPK  348
            EYL+MVIKES R+HPVAPLL+PH   EDC+V  F IPK +R+IVN WAI  DP  W + +
Sbjct  344  EYLDMVIKESLRLHPVAPLLVPHQTTEDCMVGDFFIPKNSRLIVNAWAIMRDPGAWIEAE  403

Query  347  KFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGM  168
            KF P RF G+NI+ RGR+FELIPFGSGRR CPG+QLG+TV+R  VAQLVHCFDW LPN M
Sbjct  404  KFWPERFEGSNIDVRGREFELIPFGSGRRGCPGIQLGLTVIRHTVAQLVHCFDWKLPNDM  463

Query  167  SPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             P ELDM +EFGL + RA HL+AIP+ RL
Sbjct  464  MPDELDMADEFGLTMPRANHLLAIPSQRL  492



>ref|XP_008240284.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=509

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E      R +VKAI+LDM++G+ DTSAT + W ++EL RHP +MK L+EEL+  +G+DRM
Sbjct  286  EKVYMMERTNVKAILLDMISGAFDTSATTIVWTLAELLRHPRVMKHLQEELQSVIGMDRM  345

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL  L YL MV+KES R+HPVAPLL+PH +MED  V GF IPK++RI +N WAIG 
Sbjct  346  VEESDLPKLCYLSMVVKESLRLHPVAPLLIPHESMEDITVEGFDIPKKSRIFINTWAIGR  405

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DP VWS+  ++F   RF   NI+ RG DF+L+PFGSGRR CP +QLG+T V L +A LVH
Sbjct  406  DPKVWSENVEEFYTERFIDGNIDLRGHDFQLLPFGSGRRGCPAMQLGLTTVCLALANLVH  465

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CF+W+LP+G+ PK+LDMTE+FGL +++AKHL A+PTYRL
Sbjct  466  CFNWELPSGLKPKDLDMTEKFGLSLSKAKHLFAMPTYRL  504



>ref|XP_009337234.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=504

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 171/212 (81%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R +VKAI+LDM++G+ DTSAT + W ++EL RHP +MK L++EL+  +G+DR VEE DL 
Sbjct  291  RTNVKAILLDMISGAFDTSATAIVWNLAELLRHPRVMKLLQQELQTVIGMDRTVEESDLP  350

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL  V+KESFR+HPVAPLL+PHA+MED  V+G+HIPK++ I VNIW IG DP+VWSD
Sbjct  351  KLAYLNKVVKESFRLHPVAPLLIPHASMEDITVDGYHIPKKSTIFVNIWTIGRDPSVWSD  410

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF+ ++++ +G DF+L+PFGSGRR CP +QLG+T VRL +A LVHCF++DLP
Sbjct  411  NVEEFYPERFNDSDVDLKGHDFQLLPFGSGRRGCPAMQLGLTTVRLALANLVHCFNFDLP  470

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +G+ P ELDMTE FGL +++ KHL+ +PTYRL
Sbjct  471  SGLLPNELDMTETFGLSLSKTKHLLVVPTYRL  502



>ref|XP_008393300.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=523

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E   +  R  VKAI+LDM+ GS DTSAT + W ++EL RHP ++K L+EEL+R +G D
Sbjct  300  NDEQGYRIERTDVKAILLDMITGSFDTSATAIVWNLAELLRHPRVLKHLQEELQRVIGTD  359

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L YL  VIKESFR+HP+AP L+P  +M+D  V+G++IPK+++I++N WAI
Sbjct  360  RMVEESDLRMLSYLNAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAI  419

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DPNVWSD   +F P RF  +N++ RG DF+L+PFGSGRR CPG+QLG+T VRL +A +
Sbjct  420  GRDPNVWSDNVGEFYPERFINSNVDLRGHDFQLLPFGSGRRGCPGMQLGLTTVRLALANI  479

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            VHCF+WDLP+G+ P++LDMTE FG V T+A+ L+A+PTYRL
Sbjct  480  VHCFNWDLPSGLLPQDLDMTETFGSVPTKAQPLLAMPTYRL  520



>ref|XP_010042459.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=204

 Score =   262 bits (669),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = -3

Query  680  LAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIKE  501
            +  S+DTSATV+EW +SEL RHP+ MK L+ EL++ VG++R+VEE D+E L+YL+MV+KE
Sbjct  1    MGASIDTSATVIEWAISELIRHPQAMKKLQHELKKVVGMNRIVEESDIESLDYLDMVVKE  60

Query  500  SFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFSG  321
            + R+HP  PLLLPH ++EDC V GFHIP+++R+IVN WAIG DP+VWSDP+KFIP RF G
Sbjct  61   TLRLHPPVPLLLPHKSIEDCTVGGFHIPRKSRVIVNAWAIGRDPHVWSDPEKFIPERFEG  120

Query  320  TNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMTE  141
            T+I+ RG DF+L+PFGSGRR CPG+QLG+ V+RL++AQL HCFDW+LP+ MSP ELDM+E
Sbjct  121  TSIDVRGHDFQLVPFGSGRRGCPGMQLGLIVIRLVLAQLAHCFDWELPDNMSPSELDMSE  180

Query  140  EFGLVVTRAKHLMAIPTYRLR  78
            EFGL + RAKHL+AIP++RL+
Sbjct  181  EFGLTLPRAKHLVAIPSFRLK  201



>ref|XP_008385725.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=510

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E      R  VKAI+LDM+ GS DTSAT + W ++EL RHP + K L+EEL+R +G D
Sbjct  287  NDEQGYXIERTDVKAILLDMITGSFDTSATAIVWNLAELLRHPRVXKXLQEELQRVIGTD  346

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L YL  VIKESFR+HP+AP L+P  +M+D  V+G++IPK+++I++N WAI
Sbjct  347  RMVEESDLRXLSYLNAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAI  406

Query  380  GHDPNVWSDPK-KFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DPNVWSD    F P RF  +N++ RG DF+L+PFGSGRR CPG+QLG+T VRL +A +
Sbjct  407  GRDPNVWSDNXGXFYPERFINSNVDLRGHDFQLLPFGSGRRGCPGMQLGLTTVRLALANI  466

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            VHCF+WDLP+G+ P++LDMTE FG V T+A+ L+A+PTYRL
Sbjct  467  VHCFNWDLPSGLLPQDLDMTETFGSVPTKAQPLLAMPTYRL  507



>ref|XP_002275714.2| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 168/219 (77%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            ES+    R +VKAI+LDML G +D+S+T +EW+ SEL RHP +M+ L+ EL+  V +DRM
Sbjct  282  ESSYIIDRTNVKAILLDMLVGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMDRM  341

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            V+E DLE+L YL MV+KE  R+HP+ P L+PHA+ ED  + G  IPKR+ I++N WAIG 
Sbjct  342  VDESDLENLVYLNMVVKEVLRLHPIGPFLVPHASTEDITIEGHFIPKRSTILINTWAIGR  401

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DPN WSD   +F+P RF  +NI+ +GRDFELIPFGSGRR CPG+QLG+  VRL++AQL+H
Sbjct  402  DPNFWSDNVDEFLPERFINSNIDLQGRDFELIPFGSGRRGCPGIQLGLRTVRLVLAQLLH  461

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CF+W+LPN MS  +LDM+E+FGL + R  HL AIPTYRL
Sbjct  462  CFNWELPNDMSSDDLDMSEKFGLTMPRVNHLYAIPTYRL  500



>ref|XP_006354703.1| PREDICTED: cytochrome P450 84A1-like [Solanum tuberosum]
Length=203

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = -3

Query  683  MLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIK  504
            ML  S+DTS++ +EW++SEL R+P+IMK L++ELE  VGL+RMV+E DLE+L+YL MV K
Sbjct  1    MLVASIDTSSSSIEWMLSELLRNPDIMKKLQKELEEVVGLNRMVQESDLENLKYLNMVFK  60

Query  503  ESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFS  324
            ESFR+H  APLLL H AMEDC+V+ F+I K ++ IVN + I  DPN W+D  KF+P RF 
Sbjct  61   ESFRLHAAAPLLL-HEAMEDCMVDDFYIKKGSQAIVNAYTIHRDPNFWTDADKFLPERFL  119

Query  323  GTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMT  144
             +N+  RGRD++L+PFGSGRRSC G+QL + +VRL+VAQLVHCFDW+LPN M PK+LDMT
Sbjct  120  ESNVYVRGRDYQLLPFGSGRRSCLGMQLALIIVRLVVAQLVHCFDWELPNEMQPKDLDMT  179

Query  143  EEFGLVVTRAKHLMAIPTYRLR  78
            E+FG+V  RA HLM +PTYRL+
Sbjct  180  EQFGIVAGRANHLMVVPTYRLQ  201



>ref|XP_010094782.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB56947.1| Cytochrome P450 71A1 [Morus notabilis]
Length=507

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 169/212 (80%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAI+LDM+A S DTSA ++EW  SEL +HP +M  L+ ELER VG+D+MVEE+DLE
Sbjct  291  RTNIKAILLDMVAASFDTSAALIEWTFSELLKHPRVMNNLQRELERVVGMDKMVEEQDLE  350

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L+YL+MV+KESFR+HPVAPLL+P  +MED  + G+ IPK++RIIVN W IG DPNVWS+
Sbjct  351  KLDYLDMVVKESFRLHPVAPLLVPRESMEDITIEGYFIPKKSRIIVNAWTIGRDPNVWSE  410

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F+P RF   NI+ RG DF L+PFGSGRR CPG+ LG+  +RL++AQLVHCF W+LP
Sbjct  411  NVEEFLPERFVDKNIDLRGHDFRLLPFGSGRRGCPGVHLGLVNIRLVLAQLVHCFSWELP  470

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            NG+  K++DM+E+FGL + RA  L+A PTYRL
Sbjct  471  NGVETKDVDMSEKFGLSMGRANQLLAKPTYRL  502



>ref|XP_004153471.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
 ref|XP_004162314.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=497

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 179/230 (78%), Gaps = 1/230 (0%)
 Frame = -3

Query  761  TMXDIMKSGEST-IQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEE  585
             M ++M   E T  Q  R  +KAIMLDML+  MDTSATV+ W MSEL +HP IMK L+EE
Sbjct  268  VMLELMNFQEETDYQIDRSAIKAIMLDMLSAGMDTSATVIGWAMSELIKHPHIMKKLQEE  327

Query  584  LERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRAR  405
            LE ++GLD++VEE DLE LEYL+MV+KE FR++P APLLLPH +++DC+V+GFHIPK++R
Sbjct  328  LENEIGLDKIVEESDLERLEYLKMVVKEIFRLYPPAPLLLPHESLQDCIVDGFHIPKKSR  387

Query  404  IIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            II+N+WAIG D N W DP KF P RF  + ++ +GRDF+LIPFGSGRR CPG+QLG+T+V
Sbjct  388  IIINVWAIGRDRNSWIDPHKFDPERFIDSQVDVKGRDFQLIPFGSGRRGCPGMQLGLTLV  447

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            + ++AQLVHCFDW L NGM   +LDMTEEFGL   R   L+ IP YRLR+
Sbjct  448  QFVLAQLVHCFDWMLSNGMPASQLDMTEEFGLTCPRLHDLIVIPRYRLRI  497



>ref|XP_008374738.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=529

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            + E      R +VKAI+LDM+ G++DTS T + W ++EL RHP++MK L+EEL+  + +D
Sbjct  305  NNEEVYMLERTNVKAILLDMIVGALDTSTTAIVWTLAELLRHPKVMKRLQEELKSVIRMD  364

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            RMVEE DL  L+YL  V+K+S R+HP+APLL+PH +MED  V+G+HIPK++R+ +NIW I
Sbjct  365  RMVEESDLPKLDYLSTVVKDSLRLHPIAPLLVPHQSMEDITVDGYHIPKKSRVFINIWTI  424

Query  380  GHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G DP+VWSD  ++F   RF   N++ RG DF+LIPFGSGRR CP +QLG+T VRL++  L
Sbjct  425  GRDPSVWSDNVEEFYNERFMNNNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRLVLGNL  484

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +HCF+W+LP+GM PK+LDMTE+FGL +++AKHL+A+PT RL
Sbjct  485  LHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRL  525



>ref|XP_008344234.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=496

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 180/228 (79%), Gaps = 0/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   M S ES  +  R ++KA+M DML  S DTS+T V W++SEL RHP++MK +++EL
Sbjct  268  AMLSYMGSEESDYRIERLNIKAMMSDMLVASADTSSTTVLWVLSELMRHPQVMKKVQKEL  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E  VGL+RMVEE D E LEYL+MV+KE+ R+HPV PLLLPHAA+EDC V+G+HIPK++ +
Sbjct  328  ENVVGLNRMVEESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKKSSV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+WAIG DP  W D +KF+P RF  +N++ RG  F+++PFGSGRR C G+QLGITVV 
Sbjct  388  IVNVWAIGRDPIAWGDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCIGMQLGITVVH  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
             + AQLVHCFDW+LP+ M P ELDMTEEFGL V+RAK+L+AIP+YRL+
Sbjct  448  FVSAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIPSYRLQ  495



>ref|XP_007209911.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
 gb|EMJ11110.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
Length=513

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 167/219 (76%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E      R +VKAI+LDM++G+ DTSAT + W ++EL RHP +MK L+ E++  +G DRM
Sbjct  290  EQVYMMERTNVKAILLDMISGAFDTSATAIVWTLAELLRHPRVMKHLQGEIQSVIGTDRM  349

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL  L YL MV+KES R+HPVAP L+PH +MED  V GF +PK++RI +N WAIG 
Sbjct  350  VEESDLPKLGYLSMVVKESLRLHPVAPFLIPHESMEDITVEGFDVPKKSRIFINTWAIGR  409

Query  374  DPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            DP VWS+  ++F P RF   NI+ RG DF+L+PFGSGRR CP +QLG+  VRL +A LVH
Sbjct  410  DPKVWSENVEEFYPERFIDGNIDLRGHDFQLLPFGSGRRGCPAMQLGLITVRLALANLVH  469

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CF+W+LP+G+ P++LDMTE+FGL +++AKHL A+PTYRL
Sbjct  470  CFNWELPSGLKPEDLDMTEKFGLSLSKAKHLFAMPTYRL  508



>gb|KHF97324.1| Cytochrome P450 [Gossypium arboreum]
 gb|KHG09556.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 165/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            RE++KAIM+DM+A S DT+ T +EW  SEL RHP +M  L++ELE  VG +RMVEE DL 
Sbjct  306  RENIKAIMVDMVAASFDTTTTAIEWTFSELLRHPRVMVALQKELESVVGRNRMVEESDLP  365

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVW-S  357
             L YL+MVIKESFR+HPVAPLL+PH + ED  +NG+ IPK++R++VN W++G +P +W S
Sbjct  366  KLAYLDMVIKESFRLHPVAPLLVPHESTEDVTINGYFIPKKSRLLVNTWSMGRNPKIWSS  425

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F P RF    I+ RG DFELIPFG+GRR CPG+QL +  +RL++AQ  HCFDW+LP
Sbjct  426  NAEEFFPERFKDRKIDLRGHDFELIPFGTGRRGCPGMQLALISMRLILAQSAHCFDWELP  485

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GM P ELDMTE+FGL + RA HL+A PTYRL
Sbjct  486  DGMLPNELDMTEKFGLTLPRANHLLAKPTYRL  517



>ref|XP_006585306.1| PREDICTED: cytochrome P450 750A1-like isoform X2 [Glycine max]
Length=410

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = -3

Query  686  DMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVI  507
            DML GSMDTSATV+EW +SEL ++P +MK ++ ELE  VG+ R V+E DL+ LEYL+MVI
Sbjct  204  DMLLGSMDTSATVIEWTLSELLKNPRVMKKVQMELETVVGMQRKVKESDLDKLEYLDMVI  263

Query  506  KESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRF  327
            KE+ R+HPVAPLL+PH + EDC+V  F IP+++R+++N WAI  D +VWS+ +KF P RF
Sbjct  264  KENMRLHPVAPLLIPHQSREDCMVGDFFIPRKSRVVINAWAIMRDSSVWSEAEKFWPERF  323

Query  326  SGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDM  147
             G+NI+ RG DF+ IPFGSGRR+CPG+Q+G+T+VRL VAQLVHCF W LP+ M P  LDM
Sbjct  324  EGSNIDVRGHDFQFIPFGSGRRACPGMQMGLTMVRLTVAQLVHCFHWKLPSDMLPDHLDM  383

Query  146  TEEFGLVVTRAKHLMAIPTYRL  81
            TEEFGL + RA HL+A+PTYRL
Sbjct  384  TEEFGLTMPRANHLLAVPTYRL  405



>ref|XP_011465681.1| PREDICTED: cytochrome P450 CYP736A12-like [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = -3

Query  749  IMKSGESTIQF-TREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQ  573
            ++   +  + F  RE+VKAI+LDM+  + DTSAT + W ++EL RHP IMK L+EEL+  
Sbjct  273  LLNPNDEQVHFLDRENVKAILLDMITAAFDTSATTIIWSLAELMRHPRIMKRLQEELQTV  332

Query  572  VGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVN  393
            VG+DRMVEE DL +L+YL++V+KESFR+HPVAPLL PH +++D  ++G+ +PK++R+IVN
Sbjct  333  VGMDRMVEESDLPNLDYLDLVVKESFRLHPVAPLLDPHESIKDITIDGYDVPKKSRLIVN  392

Query  392  IWAIGHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLL  216
             W+I  DPNVWS+  ++F P RF+  N+  +G  ++LIPFG+GRR CPG+QLG+T VR++
Sbjct  393  FWSIARDPNVWSENVEEFCPERFTNINVYRQGHHYQLIPFGTGRRGCPGMQLGLTTVRIV  452

Query  215  VAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +AQLVHCF+W+LPNGM P +LDMTE+FGL ++ AKHL+A PT+RL
Sbjct  453  LAQLVHCFNWELPNGMLPLDLDMTEKFGLSMSMAKHLLAKPTFRL  497



>ref|XP_004488758.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=496

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 168/218 (77%), Gaps = 0/218 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E   +  R ++KAIM+D+   S DTS+T +EW +SEL ++P +MK +++ELE  VGL R 
Sbjct  276  EYDYRIERSNIKAIMMDIFIASTDTSSTTIEWTISELLKNPRVMKKVQKELESVVGLKRK  335

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL+ LEYL+MVIKESFRIHP  PLL+PH ++EDC+V  F IPK +R+IVN W+I  
Sbjct  336  VEESDLDKLEYLDMVIKESFRIHPAGPLLIPHQSLEDCMVEDFFIPKNSRVIVNAWSIMR  395

Query  374  DPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHC  195
            D   WSDP+KF P RF G+NI+ +G  FELIPFGSGRR CPGL+LG+T+VRL+VAQLVHC
Sbjct  396  DKMAWSDPEKFWPERFEGSNIDAKGSYFELIPFGSGRRGCPGLKLGLTIVRLVVAQLVHC  455

Query  194  FDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            FD+ LP+ +   +LDMTE+FGL + RA HL+ IPTYRL
Sbjct  456  FDFKLPDNILSYDLDMTEKFGLNLIRANHLLVIPTYRL  493



>ref|XP_004143566.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=506

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 173/231 (75%), Gaps = 2/231 (1%)
 Frame = -3

Query  761  TMXDIMKSGESTIQF--TREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKE  588
             M D+M +   + ++   R +VKAI+LDML  +MDTSATV+ W + EL RHP++MK +K+
Sbjct  276  VMLDLMNTECLSYEYRIDRSNVKAIILDMLGAAMDTSATVIGWALPELIRHPQVMKKVKD  335

Query  587  ELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRA  408
            ELE  VGLD +VEE  L HL+YL+MVIKE  R++P  PLL+PH +++DCVV+GF IP+++
Sbjct  336  ELENVVGLDTIVEESHLIHLQYLDMVIKEILRLYPPVPLLVPHESLQDCVVDGFFIPRKS  395

Query  407  RIIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITV  228
            R+IVN WAIG DP  W  P KF P RF  + ++ +GRDF+LIPFG+GRR CPG+ LG+TV
Sbjct  396  RVIVNAWAIGRDPTAWIHPLKFHPERFMDSQLDVKGRDFQLIPFGAGRRGCPGIHLGLTV  455

Query  227  VRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            VRL++AQL+HCFDW L  GMS  ELDMTE FGL   RA+ L+ IP YRL +
Sbjct  456  VRLVLAQLLHCFDWKLLGGMSIDELDMTENFGLTCPRAQDLILIPVYRLHI  506



>ref|XP_004162326.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=507

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 173/231 (75%), Gaps = 2/231 (1%)
 Frame = -3

Query  761  TMXDIMKSGESTIQF--TREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKE  588
             M D+M +   + ++   R +VKAI+LDML  +MDTSATV+ W + EL RHP++MK +K+
Sbjct  277  VMLDLMNTECLSYEYRIDRSNVKAIILDMLGAAMDTSATVIGWALPELIRHPQVMKKVKD  336

Query  587  ELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRA  408
            ELE  VGLD +VEE  L HL+YL+MVIKE  R++P  PLL+PH +++DCVV+GF IP+++
Sbjct  337  ELENVVGLDTIVEESHLIHLQYLDMVIKEILRLYPPVPLLVPHESLQDCVVDGFFIPRKS  396

Query  407  RIIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITV  228
            R+IVN WAIG DP  W  P KF P RF  + ++ +GRDF+LIPFG+GRR CPG+ LG+TV
Sbjct  397  RVIVNAWAIGRDPTAWIHPLKFHPERFMDSQLDVKGRDFQLIPFGAGRRGCPGIHLGLTV  456

Query  227  VRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            VRL++AQL+HCFDW L  GMS  ELDMTE FGL   RA+ L+ IP YRL +
Sbjct  457  VRLVLAQLLHCFDWKLLGGMSIDELDMTENFGLTCPRAQDLILIPVYRLHI  507



>ref|XP_009372715.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 180/228 (79%), Gaps = 0/228 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   M S ES  +  R ++KA+M DML  S DTS+T V W +SEL RHP++MK +++E+
Sbjct  268  AMLAYMGSEESDYRIERLNIKAMMSDMLVASADTSSTTVLWALSELMRHPQVMKKVQKEI  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VGL+RMVEE D E LEYL+MV+KE+ R+HPV PLLLPHAA+EDC V+G+HIPK++R+
Sbjct  328  KNVVGLNRMVEESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKKSRV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+WAIG DP+ W D +KF+P RF  +N++ RG  F+++PFGSGRR C G+QLGITVV 
Sbjct  388  IVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCVGMQLGITVVH  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
             ++AQLVHCFDW+LP+ M P ELDM EEFGL V+RAK+L+AIP YRL+
Sbjct  448  FVLAQLVHCFDWELPDNMLPNELDMAEEFGLAVSRAKNLLAIPLYRLQ  495



>ref|XP_004172515.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase 1-like 
[Cucumis sativus]
Length=475

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 165/227 (73%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M +IM+S ++  Q  R  +KAIMLD+L   MDT+ T + W ++EL RHPEIMK ++ ELE
Sbjct  248  MLEIMESQQTDYQIDRSTIKAIMLDLLFAGMDTTTTTIGWAIAELIRHPEIMKKVQNELE  307

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL RMV+E +L HL+YLEMV+KE FR+HP APLL+PH  ++DC+VN FHIPK +R+I
Sbjct  308  EVVGLKRMVQESELSHLKYLEMVVKEVFRLHPPAPLLIPHQPLKDCIVNNFHIPKMSRVI  367

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAIG DP  W+D  +F P RF G+ ++ +G  FELIPFGSGRR C G+Q+G+  V  
Sbjct  368  VNAWAIGRDPCAWTDAHRFFPERFIGSKVDVKGNHFELIPFGSGRRGCVGIQMGLLKVHF  427

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++A L+HCFDW LPNGM P +LD TEEFG+    A  +M  P YRL+
Sbjct  428  VLAXLLHCFDWKLPNGMLPVDLDTTEEFGISCPLAHDVMVTPIYRLK  474



>ref|XP_004156155.1| PREDICTED: cytochrome P450 84A1-like [Cucumis sativus]
Length=203

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -3

Query  683  MLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIK  504
            M+  +MDT+AT ++W + EL RHP IM  +++EL++ VGL RMV E DLEHL+YL MVIK
Sbjct  1    MVITAMDTTATSIDWAIVELIRHPHIMNKMQQELDKVVGLQRMVLESDLEHLQYLNMVIK  60

Query  503  ESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFS  324
            E  R+HP  PLL+PH +++DC +NG HIPK++RIIVN WAIG DP VW+DP+ F P RF 
Sbjct  61   EILRLHPPVPLLVPHESLQDCTINGLHIPKQSRIIVNAWAIGQDPTVWNDPQNFFPERFI  120

Query  323  GTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMT  144
             + ++ +G+DFELIPFGSGRR CPG+ LG+TVVRLL+AQLVH F W+LPN + P +LD+ 
Sbjct  121  DSEVDLKGKDFELIPFGSGRRGCPGMHLGLTVVRLLLAQLVHAFHWELPNDILPNQLDVR  180

Query  143  EEFGLVVTRAKHLMAIPTYRLRL  75
            EEFGL   RA+ LM  P YRL++
Sbjct  181  EEFGLTCPRAQQLMVTPIYRLKI  203



>ref|XP_003530005.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
 gb|KHN20713.1| Cytochrome P450 71A1 [Glycine soja]
Length=503

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAI+LDM+AG+ DTSA  VEW MSEL RHP +MK L++EL   VG DR VEE DL 
Sbjct  288  RINIKAILLDMIAGAYDTSAIGVEWAMSELLRHPRVMKKLQDELNIVVGTDRPVEESDLA  347

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL MV+KE+ R++PV PLL+P  ++ED  +NG++I K++RI++N WAIG DP VWSD
Sbjct  348  KLPYLNMVVKETLRLYPVGPLLVPRESLEDITINGYYIKKKSRILINAWAIGRDPKVWSD  407

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              + F P RF  +NI+ RG++F+LIPFGSGRR CPG+QLGIT   L++AQLVHCF+W+LP
Sbjct  408  NVEMFYPERFLNSNIDMRGQNFQLIPFGSGRRGCPGIQLGITTFSLVLAQLVHCFNWELP  467

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             GMSP ++DMTE FGL + R+KHL+A+PT+RL
Sbjct  468  FGMSPDDIDMTENFGLSLPRSKHLLAVPTHRL  499



>ref|XP_006354702.1| PREDICTED: cytochrome P450 84A1-like [Solanum tuberosum]
Length=203

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 161/202 (80%), Gaps = 1/202 (0%)
 Frame = -3

Query  683  MLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIK  504
            ML  S+DTS++ +EW++SEL R+P+IMK L++ELE  VG +RMV+E DLE+L+YL MV K
Sbjct  1    MLVASIDTSSSSIEWMLSELLRNPDIMKKLQKELEEVVGQNRMVQESDLENLKYLNMVFK  60

Query  503  ESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFS  324
            ESFR+H  APLLL H AMEDC+V+ F+I K ++ IVN + I  DPN W+D  KF+  RF 
Sbjct  61   ESFRLHAAAPLLL-HEAMEDCMVDDFYIKKGSQAIVNAYTIHRDPNFWTDADKFLLERFL  119

Query  323  GTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMT  144
             +N+  RGRD++L+PFGSGRRSC G+QL + +VRL+VAQLVHCFDW+LPN M PK+LDMT
Sbjct  120  ESNVYVRGRDYQLLPFGSGRRSCLGMQLALIIVRLVVAQLVHCFDWELPNEMQPKDLDMT  179

Query  143  EEFGLVVTRAKHLMAIPTYRLR  78
            E+FG+V  RA HLM +PTYRL+
Sbjct  180  EQFGIVTGRANHLMVVPTYRLQ  201



>ref|XP_009795378.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=375

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 169/211 (80%), Gaps = 2/211 (1%)
 Frame = -3

Query  719  FTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeed  540
            FTR+ +K +  DML  +MDTSAT VEWI++EL R+P+ MK L+ ELE  VG+DRMVEE D
Sbjct  107  FTRK-LKDLSKDMLIAAMDTSATSVEWILTELLRYPQAMKKLQRELEEVVGMDRMVEESD  165

Query  539  lehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVW  360
            LE+L+YL MV+KE  R+H + PL+  H AMEDCVVNGFHI K +RI++N +AI  DPNVW
Sbjct  166  LENLKYLGMVVKEGLRLHSIVPLM-HHEAMEDCVVNGFHIQKGSRIMINCYAIQRDPNVW  224

Query  359  SDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDL  180
             +P+KF+P RF G++I+ RGR F+L+PF SGRRSCP +QLGIT+VRL+VAQLVHC DW++
Sbjct  225  PEPEKFLPERFVGSSIDIRGRHFQLLPFSSGRRSCPEMQLGITIVRLVVAQLVHCLDWEI  284

Query  179  PNGMSPKELDMTEEFGLVVTRAKHLMAIPTY  87
            PNGM P +LD+ E+FG+V+ + K LM IPT+
Sbjct  285  PNGMQPLDLDVDEQFGIVLCKEKPLMVIPTF  315



>ref|XP_006350392.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=507

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 177/231 (77%), Gaps = 5/231 (2%)
 Frame = -3

Query  758  MXDIMKSGE----STIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLK  591
            + DIM S +    S+    R  +KAI+ DM+ G++DTS T +EW+ +E+ +HP +M  L+
Sbjct  275  LVDIMLSYQDNPNSSYSIDRATMKAILSDMIVGAIDTSHTWIEWVFAEIIKHPTVMNKLQ  334

Query  590  EELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKR  411
            +EL   VGLDRMVEE+DL  LEYLE+V+KE+FR+HPVAPLL+P  ++ED V+N  +IPK 
Sbjct  335  DELTSIVGLDRMVEEDDLPKLEYLELVLKETFRLHPVAPLLVPRESIEDVVINECYIPKG  394

Query  410  ARIIVNIWAIGHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGI  234
            +R+++N WA+GHDP +WSD  +KFIP RF G NI  RG DF L+PFG GRRSCPG+ LG+
Sbjct  395  SRVMINCWALGHDPKIWSDNVEKFIPERFIGKNINLRGHDFHLLPFGYGRRSCPGINLGL  454

Query  233  TVVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
              V+L+VAQLVHCF+WDLP+G+ P +LDMTE+FGL   RA++L+ IPTYRL
Sbjct  455  ITVKLIVAQLVHCFNWDLPDGILPDDLDMTEKFGLAAPRAQNLLVIPTYRL  505



>ref|XP_004142334.1| PREDICTED: cytochrome P450 84A1-like [Cucumis sativus]
Length=203

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -3

Query  683  MLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIK  504
            M+  +MDT+AT ++W + EL RHP IM  +++EL++ VGL RMV E DLEHL+YL MVIK
Sbjct  1    MVITAMDTTATSIDWAIVELIRHPHIMNKMQQELDKVVGLQRMVLESDLEHLQYLNMVIK  60

Query  503  ESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFS  324
            E  R+HP  PLL+PH +++DC +NG HIPK++RIIVN WAIG DP +W+DP+ F P RF 
Sbjct  61   EILRLHPPVPLLVPHESLQDCTINGLHIPKQSRIIVNAWAIGQDPTIWNDPQNFFPERFI  120

Query  323  GTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMT  144
             + ++ +G+DFELIPFGSGRR CPG+ LG+TVVRLL+AQLVH F W+LPN + P +LD+ 
Sbjct  121  DSEVDLKGKDFELIPFGSGRRGCPGMHLGLTVVRLLLAQLVHAFHWELPNDILPNQLDVR  180

Query  143  EEFGLVVTRAKHLMAIPTYRLRL  75
            EEFGL   RA+ LM  P YRL++
Sbjct  181  EEFGLTCPRAQQLMVTPIYRLKI  203



>ref|XP_004143572.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase 1-like 
[Cucumis sativus]
Length=500

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 165/227 (73%), Gaps = 0/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M +IM+S ++  Q  R  +KAIMLD+L   MDT+ T + W ++EL RHPEIMK ++ ELE
Sbjct  273  MLEIMESQQTDYQIDRSTIKAIMLDLLFAGMDTTTTTIGWAIAELIRHPEIMKKVQNELE  332

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL RMV+E +L HL+YLEMV+KE FR+HP APLL+PH  ++DC+VN FHIPK +R+I
Sbjct  333  EVVGLKRMVQESELSHLKYLEMVVKEVFRLHPPAPLLIPHQPLKDCIVNNFHIPKMSRVI  392

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN WAIG DP  W+D  +F P RF G+ ++ +G  FELIPFGSGRR C G+Q+G+  V  
Sbjct  393  VNAWAIGRDPCAWTDAHRFFPERFIGSKVDVKGNHFELIPFGSGRRGCVGIQMGLLKVHF  452

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            ++A L+HCFDW LPNGM P +LD TEEFG+    A  +M  P YRL+
Sbjct  453  VLAXLLHCFDWKLPNGMLPVDLDTTEEFGISCPLAHDVMVTPIYRLK  499



>gb|KHG07950.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            RE++KAIM+DM+A S DT+ T +EW  SEL RHP +M  L++ELE  VG +RMVEE DL 
Sbjct  306  RENIKAIMVDMVAASFDTTTTAIEWTFSELLRHPRVMVALQKELESVVGRNRMVEESDLP  365

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVW-S  357
             L YL+MVIKESFR+HPVAPLL+PH + ED  +NG+ IPK++R++VN W++G +P +W S
Sbjct  366  KLAYLDMVIKESFRLHPVAPLLVPHESTEDVTINGYFIPKKSRLLVNTWSMGRNPKIWSS  425

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F P RF    I+ RG DFELIPFG+GRR CPG+QL +  +RL++AQL HCFDW+LP
Sbjct  426  NAEEFFPERFKDRKIDLRGHDFELIPFGTGRRGCPGMQLVLISMRLILAQLAHCFDWELP  485

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GM P ELDM+E+FGL + RA HL+A  TYRL
Sbjct  486  DGMLPNELDMSEKFGLSLPRANHLLAKSTYRL  517



>ref|XP_009617817.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 176/230 (77%), Gaps = 4/230 (2%)
 Frame = -3

Query  758  MXDIMKSGES---TIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKE  588
            + D+M S ++   +    R  +KAI+ DM+ G++DTS T +EW+ +E+ +H  +M  L+E
Sbjct  270  LVDVMLSHQNCPKSYSIDRATMKAILSDMIVGAIDTSHTWIEWVFAEIVKHSRVMNKLQE  329

Query  587  ELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRA  408
            EL   VGLDRMVEE+DL  LEYLE+V+KE+FR+HPVA LL+P  +MED V+NG++IPKR+
Sbjct  330  ELISVVGLDRMVEEQDLPKLEYLELVLKETFRLHPVATLLVPRESMEDVVINGYYIPKRS  389

Query  407  RIIVNIWAIGHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGIT  231
            R++ N WA+GHDP +WSD  ++F+P RF G NI+ RG  F L+PFG GRRSCPG+ LG+ 
Sbjct  390  RVMTNCWALGHDPKIWSDNVEEFVPERFIGKNIDLRGHAFHLLPFGYGRRSCPGMNLGLI  449

Query  230  VVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             V+L+VAQLVHCF+WDLP GM P +LDMTE+FGL   RA++L+ IPTYRL
Sbjct  450  TVKLIVAQLVHCFNWDLPEGMLPGDLDMTEKFGLAAPRAQNLLVIPTYRL  499



>gb|KHN32024.1| Cytochrome P450 71A1 [Glycine soja]
Length=459

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 165/227 (73%), Gaps = 1/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   +   E      R ++KAI+LDM+AGS DTSA  VEW MSEL R+P  MK L+EEL 
Sbjct  229  MHQAVNQQEQKYVIGRTNIKAIILDMIAGSFDTSAVAVEWAMSELLRNPSDMKKLQEELN  288

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG +++VEE DL  L YL MV+KE+ R++P  PLL+P  ++ED  +NG+HI K+ RI+
Sbjct  289  NVVGENKLVEESDLSKLPYLNMVVKETLRLYPAGPLLVPRESLEDITINGYHIKKKTRIL  348

Query  398  VNIWAIGHDPNVWSDPKK-FIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            VN WAIG DP VWSD    F P RF  +N++ RG DF+L+PFGSGRR CPG+QLG+T   
Sbjct  349  VNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGCPGIQLGLTTFG  408

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCF+W+LP G+SP +LDM+E FGL + R+K L+AIPTYRL
Sbjct  409  LVLAQLVHCFNWELPFGVSPDDLDMSERFGLSLPRSKPLLAIPTYRL  455



>ref|XP_009605506.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=279

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 174/230 (76%), Gaps = 4/230 (2%)
 Frame = -3

Query  758  MXDIMKSGES---TIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKE  588
            + D+M S ++   +    R  +KAI+ DM+  ++DTS T +EW+ +E+ +H  +M  L+E
Sbjct  48   LVDVMLSHQNCPKSYSIDRATMKAILSDMIVAAIDTSHTWIEWVFAEIVKHSRVMNKLQE  107

Query  587  ELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRA  408
            EL   VGLDRMVEE+DL  LEYLE+V+KE+FR+HPVA LL+P  +MED V+NG++IP+++
Sbjct  108  ELISVVGLDRMVEEQDLPKLEYLELVLKETFRLHPVATLLVPRESMEDVVINGYYIPRKS  167

Query  407  RIIVNIWAIGHDPNVWSDP-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGIT  231
            R+++N WA+GHDP +WSD  ++F+P RF G N + RG DF L+PFG GRRSCPG+ LG+ 
Sbjct  168  RVMINCWALGHDPKIWSDNVEEFVPERFIGKNFDLRGHDFHLLPFGYGRRSCPGMNLGLI  227

Query  230  VVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             V+L+VAQLVHCF+WDLP G+ P +LDMTE+FG    RA++L+ IPTY L
Sbjct  228  TVKLIVAQLVHCFNWDLPEGILPGDLDMTEKFGFAAPRAQNLLVIPTYCL  277



>gb|KEH27062.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=273

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 160/209 (77%), Gaps = 1/209 (0%)
 Frame = -3

Query  707  HVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehl  528
            ++KAI+LDM+ G++D+++T +EW MSEL RHP +MK L+ ELE  VGL+  V+E D E+L
Sbjct  59   NIKAIILDMIGGALDSASTTIEWAMSELLRHPNVMKKLQNELENVVGLNNKVKETDFENL  118

Query  527  eylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPK  348
             YL MVIKE+ R++P  PLL P   +ED  ++G++I K +R+I+N WAIG DP +W++  
Sbjct  119  PYLNMVIKETLRLYPAGPLLAPRECLEDATIDGYYIKKNSRVIINAWAIGRDPKIWTNNC  178

Query  347  K-FIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNG  171
              F P RF  +NI+ RG DF+LIPFGSGRR CPG+QLG+  VRL+VAQLVHCFDW+LP G
Sbjct  179  DIFYPERFINSNIDLRGHDFQLIPFGSGRRGCPGIQLGLNTVRLVVAQLVHCFDWELPFG  238

Query  170  MSPKELDMTEEFGLVVTRAKHLMAIPTYR  84
            MSP +LDM+E+FGL + R  HL+A+PT R
Sbjct  239  MSPNDLDMSEKFGLSMPRFNHLLAVPTTR  267



>gb|KJB13389.1| hypothetical protein B456_002G072000 [Gossypium raimondii]
Length=519

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = -3

Query  719  FTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeed  540
            F RE++KAIM+DM+A S DT++T +EW  +EL +HP +M  L++ELE  VG +RMVEE D
Sbjct  304  FGRENIKAIMVDMVAASFDTTSTTIEWTFTELLKHPRVMVALQKELESVVGRNRMVEESD  363

Query  539  lehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVW  360
            L  L YL+MVIKESFR+HPVAPLL+PH + ED  VNG+ IPK++R++VN W++G +P +W
Sbjct  364  LPKLAYLDMVIKESFRLHPVAPLLIPHESTEDVTVNGYFIPKKSRLLVNTWSMGRNPKIW  423

Query  359  -SDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWD  183
             S+ ++F P RF    I+ RG DFELIPFG+GRR CPG+QL +  +R+++AQL HCFDW+
Sbjct  424  SSNAEEFFPERFKDRKIDLRGHDFELIPFGTGRRGCPGMQLALVNMRIILAQLAHCFDWE  483

Query  182  LPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            LP+GM P ELDMTE+FGL + RA  L+   TYRL
Sbjct  484  LPDGMLPNELDMTEKFGLSLPRANRLLVKSTYRL  517



>ref|XP_003630098.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04574.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=477

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 165/226 (73%), Gaps = 16/226 (7%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R ++KAI+LDMLAGSMDTSAT +EW +SEL ++P +MK ++ ELE
Sbjct  266  MLGFLGTQESEYRIERPNIKAILLDMLAGSMDTSATAIEWAISELIKNPIVMKKVQNELE  325

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+ R VEE DLE LEYL+M IKES R+HPV                 F IPK+AR+I
Sbjct  326  TVVGMKRKVEESDLEKLEYLDMAIKESLRLHPVI----------------FSIPKKARVI  369

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
            VN W++  DPN W+DP+ F P RF  +NI+ RGRDF+LIPFGSGRR CPGLQLG+TV+RL
Sbjct  370  VNSWSVMRDPNAWTDPEMFWPERFEESNIDVRGRDFQLIPFGSGRRGCPGLQLGLTVIRL  429

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +VAQLVHCFDW LPN M P +LDMTEEFGL + RA HL AIPTYRL
Sbjct  430  VVAQLVHCFDWKLPNHMLPSDLDMTEEFGLTMPRANHLTAIPTYRL  475



>ref|XP_009372726.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 177/223 (79%), Gaps = 0/223 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   M S ES  +  R ++KA+M DML  S DTS+T V W +SEL RHP++MK +++E+
Sbjct  268  AMLAYMGSEESDYRIERLNIKAMMSDMLVASADTSSTTVLWALSELMRHPQVMKKVQKEI  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VGL+RMVEE D E LEYL+MV+KE+ R+HPV PLLLPHAA+EDC V+G+HIPK++R+
Sbjct  328  KNVVGLNRMVEESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKKSRV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+WAIG DP+ W D +KF+P RF  +N++ RG  F+++PFGSGRR C G+QLGITVV 
Sbjct  388  IVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCVGMQLGITVVH  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIP  93
             ++AQLVHCFDW+LP+ M P ELDMTEEFGL V+RAK+L+AIP
Sbjct  448  FVLAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIP  490



>ref|XP_004169555.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=429

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 173/228 (76%), Gaps = 3/228 (1%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M D+++S E   Q  R ++KA++ D++ G +D+S+T + W +SE+ ++P++MK ++EEL+
Sbjct  201  MLDLIRSEEMEHQIDRSNIKAVIFDLMIGGVDSSSTTIIWALSEIIKNPQVMKKIQEELK  260

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VGL++MVEE  L  L+YL+M IKES RIHPV PL+ P  +++DC VNG+HIPK   II
Sbjct  261  EVVGLNKMVEESHLNQLKYLDMTIKESLRIHPVIPLI-PRKSIQDCNVNGYHIPKNTDII  319

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGR--DFELIPFGSGRRSCPGLQLGITVV  225
            +N WAIG DP  W +P+KF P+RF  T I++ G   +FE+IPFGSGRR CPG+QLG+ +V
Sbjct  320  INDWAIGQDPCYWIEPQKFNPDRFVDTQIDFIGNKNNFEMIPFGSGRRGCPGMQLGLVLV  379

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            R++VAQLVHCFDW+LPNG+ P ELDM+E+FGL   RA++L  +P YR+
Sbjct  380  RMIVAQLVHCFDWELPNGVLPSELDMSEDFGLSCPRAQNLRVVPVYRV  427



>ref|XP_009372727.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 177/223 (79%), Gaps = 0/223 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   M S ES  +  R ++KA+M DML  S DTS+T V W +SEL RHP++MK +++E+
Sbjct  268  AMLAYMGSEESDYRIERLNIKAMMSDMLVASADTSSTTVLWALSELMRHPQVMKKVQKEI  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VGL+RMVEE D E LEYL+MV+KE+ R+HPV PLLLPHAA+EDC V+G+HIPK++R+
Sbjct  328  KNVVGLNRMVEESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKKSRV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+WAIG DP+ W D +KF+P RF  +N++ RG  F+++PFGSGRR C G+QLGITVV 
Sbjct  388  IVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCVGMQLGITVVH  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIP  93
             ++AQLVHCFDW+LP+ M P ELDMTEEFGL V+RAK+L+AIP
Sbjct  448  FVLAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIP  490



>gb|KJB13388.1| hypothetical protein B456_002G071900 [Gossypium raimondii]
Length=519

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            RE++KAIM+DM+A S DT++T +EW  +EL +HP +M  L++ELE  VG +RMVEE DL 
Sbjct  306  RENIKAIMVDMVAASFDTTSTAIEWTFTELLKHPRVMVALQKELESVVGRNRMVEESDLP  365

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVW-S  357
             L YL+MVIKESFR+HP APLL+PH + ED  VNG+ IPK++R++VN W +G +P +W S
Sbjct  366  KLAYLDMVIKESFRLHPTAPLLVPHESTEDVTVNGYFIPKKSRLLVNTWTMGRNPKIWSS  425

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F P RF    I+ RG DFELIPFG+GRR CPG+QL +  +RL++AQL HCFDW+L 
Sbjct  426  NAEEFFPERFKDRKIDLRGHDFELIPFGTGRRGCPGMQLALISMRLILAQLAHCFDWELL  485

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GM P ELDMTE+FGL + RA HL+  PTYRL
Sbjct  486  DGMLPNELDMTEKFGLSLPRANHLLVKPTYRL  517



>ref|XP_010111002.1| Cytochrome P450 71D10 [Morus notabilis]
 gb|EXC29388.1| Cytochrome P450 71D10 [Morus notabilis]
Length=473

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 165/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAI+LDM+  + DTSAT +EW +SE+ ++P + + L+EE+ER  G+D+MVEE DLE
Sbjct  257  RTNIKAILLDMVVAAFDTSATSIEWTLSEVLKNPRVTQNLQEEVERVTGMDKMVEERDLE  316

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L+YL+MV+KESFR+HPVAPLL+P  +MED  V G+ IPK +RIIVN W IG DPNVWS+
Sbjct  317  KLDYLDMVVKESFRLHPVAPLLVPRESMEDITVEGYFIPKNSRIIVNTWTIGRDPNVWSE  376

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF  + I+ RG DF L+PFGSGRR CPG  LGI  ++L++AQLVHCF WDLP
Sbjct  377  NVEEFFPERFINSKIDLRGYDFRLLPFGSGRRGCPGAHLGIVTIQLVLAQLVHCFSWDLP  436

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +G+  K++DM+E+FGL + R  HL+A PTYRL
Sbjct  437  SGVETKDIDMSEKFGLSMGRENHLLAKPTYRL  468



>gb|KHN20714.1| Cytochrome P450 71D10 [Glycine soja]
Length=510

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 168/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAIM+ M+  ++DTSAT +EW MSEL +HP +MK L++ELE  VG++R VEE D+E
Sbjct  292  RTNMKAIMMTMIVAAIDTSATAIEWAMSELLKHPRVMKKLQDELESVVGMNRKVEESDME  351

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL++V+KE+ R++PVAPLL+P    E+  ++G+ I +R+RIIVN WAIG DP VWSD
Sbjct  352  KLPYLDLVVKETLRLYPVAPLLVPRECREEITIDGYCIKERSRIIVNAWAIGRDPKVWSD  411

Query  353  PKK-FIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              + F P RF+ +N++ RG DF L+PFGSGRR CPG+ LG+T V++++AQLVHCF+W+LP
Sbjct  412  NAEVFYPERFANSNVDMRGYDFRLLPFGSGRRGCPGIHLGLTTVKIVLAQLVHCFNWELP  471

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             GMSP +LDMTE+FGL + R+ HL+A+PTYRL
Sbjct  472  LGMSPDDLDMTEKFGLTIPRSNHLLAVPTYRL  503



>ref|XP_007159749.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31743.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=483

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 167/228 (73%), Gaps = 13/228 (6%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   + + ES  +  R ++KAIMLDMLAGSMDTSAT +EW +SEL ++P +MK L+ ELE
Sbjct  266  MLGFVGTEESEYRIERPNIKAIMLDMLAGSMDTSATAIEWTLSELLKNPRVMKKLQVELE  325

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+++ VEE DLE LEYL+MVIKES R+HPVAPLL+PH + EDC+V+           
Sbjct  326  NVVGMEKKVEESDLEKLEYLDMVIKESLRLHPVAPLLIPHQSTEDCMVDS----------  375

Query  398  VNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRL  219
                 I  DP+ W + +KF P RF G+NI+ RGR+FELIPFGSGRR CPG+QLG+TV+R 
Sbjct  376  ---ECIMRDPDAWIEAEKFWPERFEGSNIDVRGREFELIPFGSGRRGCPGIQLGLTVIRH  432

Query  218  LVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
             VAQLVHCFDW LPN M P ELDM +EFGL + RA HL+AIP+YRL L
Sbjct  433  TVAQLVHCFDWKLPNDMMPAELDMADEFGLTMPRANHLLAIPSYRLSL  480



>gb|KHN32022.1| Cytochrome P450 71A1 [Glycine soja]
Length=511

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 169/227 (74%), Gaps = 1/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M   E      R +VKAI+LDM+ GS DTS + +EW M+EL RHP +MKTL++EL 
Sbjct  281  MHQPMDQHEQKHVIDRTNVKAIILDMIGGSFDTSTSAIEWAMTELLRHPRVMKTLQDELN  340

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG+++ VEE DL  L YL MV+KE+ R++PV PLL+P  ++E+  +NG++I K++RI+
Sbjct  341  SVVGINKKVEESDLAKLPYLNMVVKETLRLYPVLPLLVPRESLENITINGYYIEKKSRIL  400

Query  398  VNIWAIGHDPNVW-SDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            +N WAIG DP VW ++ + F P RF   N++ RG DF+LIPFGSGRR CPG+QLG+T V 
Sbjct  401  INAWAIGRDPKVWCNNAEMFYPERFMNNNVDIRGHDFQLIPFGSGRRGCPGIQLGLTSVG  460

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCF+W+LP G+SP +LDMTE+FG+ + R K L+AIPTYRL
Sbjct  461  LILAQLVHCFNWELPLGISPDDLDMTEKFGITIPRCKPLLAIPTYRL  507



>ref|XP_008385982.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 178/223 (80%), Gaps = 0/223 (0%)
 Frame = -3

Query  746  MKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVG  567
            M S ES  +  R HVKA+MLDM A ++DT  + + W +SEL RHP++MK L++ELE  VG
Sbjct  276  MGSEESDYRIERVHVKAVMLDMFAAALDTPPSAILWALSELLRHPQVMKKLQKELENVVG  335

Query  566  LDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIW  387
            L+RMVEE DLE LEYL++V+KE+ R+HPV PLLLPH ++EDC V+G+HIPK +R+IVN W
Sbjct  336  LNRMVEESDLEKLEYLDIVVKETLRLHPVLPLLLPHLSIEDCTVDGYHIPKNSRLIVNAW  395

Query  386  AIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQ  207
            AIG DP+ W D +KF+P RF G+NI+ +G+ F+LIPFGSGRR C G+QLG+TVV+ ++AQ
Sbjct  396  AIGRDPSAWEDAEKFVPERFEGSNIDVKGKHFQLIPFGSGRRRCAGMQLGLTVVQFVLAQ  455

Query  206  LVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            +VHCFDW+LP+ M P ELDMTE FGL V+R K L+ IP+YRL+
Sbjct  456  IVHCFDWELPDNMLPNELDMTEVFGLAVSRTKDLLLIPSYRLQ  498



>gb|KCW83844.1| hypothetical protein EUGRSUZ_B00712 [Eucalyptus grandis]
Length=436

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAI+LDM++GS +T++T ++W  SEL R+P+ M  L+EELE  VGL RMVEE DL 
Sbjct  223  RTNIKAIILDMISGSFETASTSIDWAFSELMRNPQTMAHLQEELETIVGLTRMVEESDLP  282

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             L YL+MV+KES R+HPV PLL+P  +MED V+N   IPK++RIIVNIWAIG DP+VWS 
Sbjct  283  KLNYLDMVVKESMRLHPVVPLLVPRESMEDAVINECFIPKKSRIIVNIWAIGRDPSVWSE  342

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + +KF+P RF    I+ +G  FEL+PFGSGRR CPG+QLG+  V+L++AQLVHCF W++P
Sbjct  343  NTEKFVPERFVDNGIDVKGHHFELLPFGSGRRGCPGIQLGLLQVKLVLAQLVHCFKWEIP  402

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
              M P ++DM+E FGL V RA HL+A+PTYRL
Sbjct  403  EDMVPSDIDMSERFGLSVPRANHLLAVPTYRL  434



>ref|XP_010094781.1| Cytochrome P450 71D8 [Morus notabilis]
 gb|EXB56946.1| Cytochrome P450 71D8 [Morus notabilis]
Length=508

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 172/221 (78%), Gaps = 2/221 (1%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            E+     R ++KAI++D+L  ++DTS+  VEW +SEL ++P +MK  + ELE  +G++R 
Sbjct  283  ENVFIIDRTNIKAILVDLLTAALDTSSASVEWTLSELIKNPRVMKNAQRELESVIGMERT  342

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE+D+E L+YL+MV+KESFR+HPV PLLLP  ++++  + G+HIP ++R+IVN+WAIG 
Sbjct  343  VEEKDVEKLDYLDMVVKESFRLHPVIPLLLPRESLKEITIKGYHIPNKSRVIVNVWAIGR  402

Query  374  DPNVWSDP-KKFIPNRFSGT-NIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLV  201
            DPNVWS+  ++F P RF  + +I++RGRDF L+PFGSGRR CPG+QLG+T +  +VAQLV
Sbjct  403  DPNVWSENVEEFYPERFGESDDIDFRGRDFRLLPFGSGRRGCPGMQLGLTTIHFVVAQLV  462

Query  200  HCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLR  78
            HCF W++P+GM+P E+DM E+FGL V RA HL+  P YRLR
Sbjct  463  HCFSWEVPSGMNPAEIDMIEKFGLSVVRANHLLLKPIYRLR  503



>ref|XP_004143494.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=501

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 179/230 (78%), Gaps = 1/230 (0%)
 Frame = -3

Query  761  TMXDIMKSGES-TIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEE  585
             M D+MKS ++   +  R  VKAI+LD+L  +MDTSATV+ W ++EL RHP++MK +++E
Sbjct  272  VMLDLMKSEDTHEYRIDRSSVKAIILDVLGAAMDTSATVIGWALAELIRHPDVMKKVQDE  331

Query  584  LERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRAR  405
            +E  VGLDRMVEE DL HLEYL+MVIKE  R++P  PLL+PH +++DC+V  F IPK +R
Sbjct  332  VENVVGLDRMVEELDLIHLEYLDMVIKEILRLYPPLPLLVPHESLQDCIVEDFFIPKNSR  391

Query  404  IIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            +IVN WAIG +P+ W  P KF P RF G++++ RGRDF+LIPFG+GRR CPG+QLG+TV+
Sbjct  392  VIVNAWAIGRNPSAWIHPLKFCPERFMGSHLDVRGRDFQLIPFGAGRRGCPGIQLGMTVI  451

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            RL++AQL+HCFDW LPNG S  ELDMTEEFGL   RA+ L+ IP YRL +
Sbjct  452  RLVLAQLLHCFDWKLPNGTSIDELDMTEEFGLTCPRAQDLIVIPIYRLHI  501



>ref|XP_004162312.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=501

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 179/230 (78%), Gaps = 1/230 (0%)
 Frame = -3

Query  761  TMXDIMKSGES-TIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEE  585
             M D+MKS ++   +  R  VKAI+LD+L  +MDTSATV+ W ++EL RHP++MK +++E
Sbjct  272  VMLDLMKSEDTHEYRIDRSSVKAIILDVLGAAMDTSATVIGWALAELIRHPDVMKKVQDE  331

Query  584  LERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRAR  405
            +E  VGLDRMVEE DL HLEYL+MVIKE  R++P  PLL+PH +++DC+V  F IPK +R
Sbjct  332  VENVVGLDRMVEELDLIHLEYLDMVIKEILRLYPPLPLLVPHESLQDCIVEDFFIPKNSR  391

Query  404  IIVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            +IVN WAIG +P+ W  P KF P RF G++++ RGRDF+LIPFG+GRR CPG+QLG+TV+
Sbjct  392  VIVNAWAIGRNPSAWIHPLKFCPERFMGSHLDVRGRDFQLIPFGAGRRGCPGIQLGMTVI  451

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            RL++AQL+HCFDW LPNG S  ELDMTEEFGL   RA+ L+ IP YRL +
Sbjct  452  RLVLAQLLHCFDWKLPNGTSIDELDMTEEFGLTCPRAQDLIVIPIYRLHI  501



>ref|XP_010541895.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=512

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R HVK+I+LDM+A +++TSAT +EWI SE+ ++  IMK L++EL+  VG+DRMV E DL 
Sbjct  299  RTHVKSILLDMVAAALETSATAIEWIFSEILKNTRIMKKLQDELKNIVGMDRMVNETDLS  358

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL+MVIKE FR+HPVAPLL+PH ++ED V++GF+IPK++R++VN+W+IG D +VW D
Sbjct  359  KLTYLDMVIKEGFRLHPVAPLLIPHESVEDVVLDGFYIPKKSRVLVNVWSIGRDRDVWGD  418

Query  353  -PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF   +I+  G DF LIPFGSGRR CPG+Q+G+  +RL++AQLVHCFDW LP
Sbjct  419  NNEEFNPERFENDDIDINGLDFRLIPFGSGRRRCPGMQMGLLNLRLVIAQLVHCFDWVLP  478

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             GM  +ELDM E+FGL V RA ++ A P YRL
Sbjct  479  VGMVREELDMNEKFGLTVGRANNVFATPIYRL  510



>ref|XP_007152786.1| hypothetical protein PHAVU_004G159500g [Phaseolus vulgaris]
 gb|ESW24780.1| hypothetical protein PHAVU_004G159500g [Phaseolus vulgaris]
Length=511

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 165/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R H+KA+++ M+   +DTS+T VEW MSEL +HP +MK L++ELE  VG+ R VEE D+E
Sbjct  293  RTHIKAVVMTMIIAGIDTSSTSVEWAMSELLKHPRVMKKLQDELESVVGMKRKVEETDME  352

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL++V+KE+ R++PV PLL+P    ED  ++G+ I K +R+IVN WA+G DP VWSD
Sbjct  353  KLLYLDLVVKETLRLYPVVPLLVPRECREDVTIDGYFIKKNSRVIVNAWAVGRDPKVWSD  412

Query  353  PKK-FIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              + F P RF+  N++ +G DF LIPFGSGRR CPG+ LG+T V+++++QLVHCF+W+LP
Sbjct  413  NAEMFYPERFTNNNVDIKGFDFRLIPFGSGRRGCPGIHLGLTTVKIVLSQLVHCFNWELP  472

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GMSP ELDMTE+FGL + R+KHL+A+PTYRL
Sbjct  473  SGMSPDELDMTEKFGLTMPRSKHLLAVPTYRL  504



>ref|XP_010663579.1| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R++ KAI+LD+L G +D+S T +EW++SEL RHP +M+ L+EEL+  VG+ RMVEE DLE
Sbjct  289  RQNAKAIILDILVGGIDSSITSIEWVISELLRHPRVMRRLQEELKNVVGMCRMVEESDLE  348

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
            +L YL MV+KE+ R+HP+ P L+P  ++ED V+NG +IPK++RI++N W IG DPNVWS+
Sbjct  349  NLGYLNMVVKETLRLHPIGPFLVPRESIEDIVINGHYIPKKSRILINTWTIGRDPNVWSN  408

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF   NI+ +G DFEL PFGSGRR CPG+QLG+  V+L+V+QLVHCF+W LP
Sbjct  409  NVEEFFPERFVENNIDLQGHDFELTPFGSGRRGCPGIQLGLITVQLVVSQLVHCFNWKLP  468

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            N   P EL+M E+FGL + R  HL+A PTYRL
Sbjct  469  NDTPPSELNMKEKFGLTMPRVDHLLATPTYRL  500



>ref|XP_010045641.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=506

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAI+LDM++GS +T++T ++W  SEL R+P+ M  L+EELE  VGL RMVEE DL 
Sbjct  293  RTNIKAIILDMISGSFETASTSIDWAFSELMRNPQTMAHLQEELETIVGLTRMVEESDLP  352

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             L YL+MV+KES R+HPV PLL+P  +MED V+N   IPK++RIIVNIWAIG DP+VWS 
Sbjct  353  KLNYLDMVVKESMRLHPVVPLLVPRESMEDAVINECFIPKKSRIIVNIWAIGRDPSVWSE  412

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + +KF+P RF    I+ +G  FEL+PFGSGRR CPG+QLG+  V+L++AQLVHCF W++P
Sbjct  413  NTEKFVPERFVDNGIDVKGHHFELLPFGSGRRGCPGIQLGLLQVKLVLAQLVHCFKWEIP  472

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
              M P ++DM+E FGL V RA HL+A+PTYRL
Sbjct  473  EDMVPSDIDMSERFGLSVPRANHLLAVPTYRL  504



>ref|XP_007036496.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY20997.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=514

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAIML+M+A  +++SA  +EW +SEL +HP +M +L++ELE  VG  RMVEE DL 
Sbjct  298  RTNIKAIMLEMIAAGLESSAAAIEWALSELLKHPRVMFSLQQELETVVGRSRMVEESDLP  357

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             L YL++V+KES R+HPV PLL+PH +MED  ++G+ IPK++RIIVN W++G DP+VWS 
Sbjct  358  QLTYLDVVVKESLRLHPVGPLLIPHESMEDITIDGYFIPKKSRIIVNAWSMGRDPDVWSN  417

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F P RF  +NI+ RG+DF+LIPFGSGRR CPG+QLG+  +RL++AQ VHCFDW+LP
Sbjct  418  NAEEFFPERFIDSNIDLRGQDFQLIPFGSGRRGCPGMQLGLITIRLVLAQFVHCFDWELP  477

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GM P +LDM+E FGL ++RA  L+   TYRL
Sbjct  478  DGMLPVQLDMSENFGLSMSRANPLLVKATYRL  509



>ref|XP_007036495.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20996.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=535

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAIML+M+A  +++SA  +EW +SEL +HP +M +L++ELE  VG  RMVEE DL 
Sbjct  319  RTNIKAIMLEMIAAGLESSAAAIEWALSELLKHPRVMFSLQQELETVVGRSRMVEESDLP  378

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             L YL++V+KES R+HPV PLL+PH +MED  ++G+ IPK++RIIVN W++G DP+VWS 
Sbjct  379  QLTYLDVVVKESLRLHPVGPLLIPHESMEDITIDGYFIPKKSRIIVNAWSMGRDPDVWSN  438

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F P RF  +NI+ RG+DF+LIPFGSGRR CPG+QLG+  +RL++AQ VHCFDW+LP
Sbjct  439  NAEEFFPERFIDSNIDLRGQDFQLIPFGSGRRGCPGMQLGLITIRLVLAQFVHCFDWELP  498

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GM P +LDM+E FGL ++RA  L+   TYRL
Sbjct  499  DGMLPVQLDMSENFGLSMSRANPLLVKATYRL  530



>gb|AET05316.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=267

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 165/228 (72%), Gaps = 2/228 (1%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T   I  S E +    R ++KAI LDM+A + DTSAT+VEW +SEL RHP +MK L++EL
Sbjct  36   THQTIDPSDEQSHVIDRTNIKAIALDMIAAAFDTSATIVEWALSELMRHPRVMKNLQQEL  95

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG++++VEE D+  L YL++VI E+ R++P  PL+ P  + ED  V+G+ I K+ R+
Sbjct  96   DSVVGMNKLVEENDMAKLSYLDIVIMETLRLYPAGPLV-PRESTEDATVHGYFIKKKTRV  154

Query  401  IVNIWAIGHDPNVWSD-PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            IVN+WAIG D  +WS+  ++F P RF   N +YRG DF+ IPFG GRR CPG+ LG+  V
Sbjct  155  IVNLWAIGRDSKIWSNNAEEFYPERFVDKNFDYRGHDFQFIPFGFGRRGCPGINLGLATV  214

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +L+VAQL+HCF W LP+ M+  +LDMTE+FGL + RAKHL+A+PTYRL
Sbjct  215  KLVVAQLIHCFSWKLPSNMTINDLDMTEKFGLSIPRAKHLLAVPTYRL  262



>ref|XP_009372722.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=203

 Score =   246 bits (627),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -3

Query  683  MLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedlehleylEMVIK  504
            ML  S DTS+T V W +SEL RHP++MK +++E+E  VGL+RMVEE D E LEYL+MV K
Sbjct  1    MLVASADTSSTTVLWALSELMRHPQVMKKVQKEIENVVGLNRMVEESDTEKLEYLDMVEK  60

Query  503  ESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSDPKKFIPNRFS  324
            E+ R+HPV PLLLPHAA+EDC V+G+HIPK++ +IVN+WAI  DP+ W D +KF+P RF 
Sbjct  61   ETMRLHPVLPLLLPHAAIEDCTVDGYHIPKKSSVIVNVWAIVRDPSAWEDAEKFVPERFE  120

Query  323  GTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPNGMSPKELDMT  144
             +N++ RG  F+++PFGSGRR C G+QLGITVV  ++AQLVHCFDW+LP+ M P ELDMT
Sbjct  121  DSNVDVRGHYFKILPFGSGRRRCVGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMT  180

Query  143  EEFGLVVTRAKHLMAIPTYRLR  78
            EEFGL V+RAK+L+AIP+YRL+
Sbjct  181  EEFGLAVSRAKNLLAIPSYRLQ  202



>gb|KHG22550.1| Cytochrome P450 [Gossypium arboreum]
 gb|KHG28510.1| Cytochrome P450 [Gossypium arboreum]
Length=497

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R  +KAI +DM+ G++DTSA  +EW +SEL RHP +M  L++ELE  VG  RMVEE DL 
Sbjct  286  RNSIKAITIDMMVGALDTSAATLEWALSELLRHPRVMLKLQQELESIVGNKRMVEENDLP  345

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             LEYL+MV+KE FR+HPVAPLL+P  ++ED +++G +IPK++R++VNIWA+G DPN+WS 
Sbjct  346  KLEYLDMVVKEIFRLHPVAPLLVPRESVEDIIIDGCYIPKQSRVLVNIWAMGRDPNIWSN  405

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F P RF  +NI+  G DFELIPFG+GRR CPG +LG+  V+L++AQLVHCF+W+LP
Sbjct  406  NAEEFFPERFIDSNIDLHGHDFELIPFGAGRRLCPGKKLGLITVKLILAQLVHCFNWELP  465

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GMSP ELDMTE FG+ + R  +L   PTYR+
Sbjct  466  SGMSPNELDMTENFGVSLPRKINLCVKPTYRM  497



>gb|KEH21372.1| cytochrome P450 family protein [Medicago truncatula]
Length=286

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 166/221 (75%), Gaps = 2/221 (1%)
 Frame = -3

Query  740  SGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLD  561
            S E T    R ++KAI LDM+AG+ +TSATVVEW +SEL RHP +MK L++EL+  VG +
Sbjct  62   SDEKTHVVDRTNIKAISLDMIAGAFETSATVVEWALSELMRHPRVMKNLQQELDNVVGAN  121

Query  560  RMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAI  381
            ++VEE DL  L YL++VI E+ R++P  PL+ P  + +D  V+G+ I K+ RII+N+WAI
Sbjct  122  KLVEENDLSKLSYLDIVIMETLRLYPPGPLV-PRESTQDSTVHGYFIKKKTRIILNLWAI  180

Query  380  GHDPNVWSD-PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQL  204
            G D  +WS+  ++F P RF   +++YRG DF+ IPFG GRR CPG+ LG+T V+L+VAQL
Sbjct  181  GRDSAIWSNNAEEFFPERFVDKSLDYRGHDFQFIPFGFGRRGCPGINLGLTTVKLVVAQL  240

Query  203  VHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            VHCF W+LP+ M+P +LDMTE+FGL   RAKHL+A+PTYRL
Sbjct  241  VHCFTWELPSNMTPNDLDMTEKFGLSTPRAKHLLAVPTYRL  281



>gb|KJB34360.1| hypothetical protein B456_006G062200 [Gossypium raimondii]
Length=513

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 164/219 (75%), Gaps = 1/219 (0%)
 Frame = -3

Query  734  ESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRM  555
            + T    R+++KAI+LDM+A S +TSA  + W  SE+ RHP +M  L+ ELE  VG +R+
Sbjct  290  DETYIIKRKNIKAILLDMIAASFETSAVAIVWTFSEILRHPRVMVALQHELETVVGRNRL  349

Query  554  VeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGH  375
            VEE DL  L YL+MV+KE  R+HPVAP L+PH ++ED V+NG+ IPK++RI+VNIW++G 
Sbjct  350  VEESDLSKLTYLDMVVKEGLRLHPVAPFLVPHESLEDIVINGYFIPKKSRILVNIWSMGR  409

Query  374  DPNVWS-DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVH  198
            D N+WS + ++F P RF   NI+ RG DF LIPFGSGRR CPG+ L +  V L++AQLVH
Sbjct  410  DRNIWSENAEEFFPERFINNNIDLRGHDFRLIPFGSGRRGCPGMHLALINVSLILAQLVH  469

Query  197  CFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            CF+W+LP+GM P EL+MTE FGL + RA HL+A PTYRL
Sbjct  470  CFNWELPDGMLPDELNMTEIFGLSLPRATHLLAKPTYRL  508



>gb|KJB34359.1| hypothetical protein B456_006G062100 [Gossypium raimondii]
Length=493

 Score =   255 bits (651),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 163/212 (77%), Gaps = 2/212 (1%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R  +KAI +DM+  S+DTSA  +EW +SEL RHP +M+  ++ELE  +G  RMVEE DL 
Sbjct  283  RNSIKAITIDMIVASLDTSAATLEWALSELIRHPSVMRKFQQELESVIG-KRMVEESDLP  341

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             LEYL+MV++E+ R+HP+APLL+P  +MED V++G +IPK++R++VN+W IG DPNVWS 
Sbjct  342  KLEYLDMVVRETLRLHPIAPLLVPRESMEDIVIDGCYIPKKSRVLVNVWTIGRDPNVWSS  401

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F P RF  +NIE  G DFELIPFGSGRR CPG +LG+  V+L++AQLVHCFDW+LP
Sbjct  402  NVEEFFPERFINSNIELHGHDFELIPFGSGRRVCPGKKLGLITVKLILAQLVHCFDWELP  461

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GMSP ELDMTE FG  V R  +L A P YR+
Sbjct  462  SGMSPNELDMTENFGTSVPRKTNLCAKPIYRM  493



>gb|KHG22812.1| Cytochrome P450 [Gossypium arboreum]
Length=493

 Score =   255 bits (651),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 162/212 (76%), Gaps = 2/212 (1%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R  +KAI +DM+ GS+DTSA  +EW +SEL RHP +M   ++ELE  +G  RMVEE DL 
Sbjct  283  RNSIKAITIDMIVGSLDTSAATLEWALSELIRHPRVMLKFQQELESVIG-KRMVEENDLP  341

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             LEYL+MV++E+ R+HPVAPLL+P  +MED V++G +IPK++R++VN+WAIG DPNVWS+
Sbjct  342  KLEYLDMVVRETLRLHPVAPLLVPRESMEDIVIDGCYIPKKSRVLVNVWAIGRDPNVWSN  401

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              + F P RF  +NIE  G DFELIPFGSGRR CPG +LG+  V+L++AQLVHCFDW+LP
Sbjct  402  NVEDFFPERFINSNIELHGHDFELIPFGSGRRVCPGKKLGLITVKLILAQLVHCFDWELP  461

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             GMSP ELDMTE FG  + R  +L A P YR+
Sbjct  462  TGMSPNELDMTENFGSSLPRKTNLCAKPIYRM  493



>ref|XP_003630840.1| Cytochrome P450 [Medicago truncatula]
Length=281

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 165/228 (72%), Gaps = 2/228 (1%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            T   I  S E +    R ++KAI LDM+A + DTSAT+VEW +SEL RHP +MK L++EL
Sbjct  50   THQTIDPSDEQSHVIDRTNIKAIALDMIAAAFDTSATIVEWALSELMRHPRVMKNLQQEL  109

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VG++++VEE D+  L YL++VI E+ R++P  PL+ P  + ED  V+G+ I K+ R+
Sbjct  110  DSVVGMNKLVEENDMAKLSYLDIVIMETLRLYPAGPLV-PRESTEDATVHGYFIKKKTRV  168

Query  401  IVNIWAIGHDPNVWSD-PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVV  225
            IVN+WAIG D  +WS+  ++F P RF   N +YRG DF+ IPFG GRR CPG+ LG+  V
Sbjct  169  IVNLWAIGRDSKIWSNNAEEFYPERFVDKNFDYRGHDFQFIPFGFGRRGCPGINLGLATV  228

Query  224  RLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +L+VAQL+HCF W LP+ M+  +LDMTE+FGL + RAKHL+A+PTYRL
Sbjct  229  KLVVAQLIHCFSWKLPSNMTINDLDMTEKFGLSIPRAKHLLAVPTYRL  276



>gb|KCW79058.1| hypothetical protein EUGRSUZ_C00484 [Eucalyptus grandis]
Length=502

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 161/212 (76%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KA+ LDM+A S ++S+T +EW MSEL RHP  MK L+ ELE  VGL R VEE DL 
Sbjct  289  RTNIKALALDMIAASYESSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLP  348

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             L Y++MV+KESFR++P  PLL+PH + E   + G++IPK  R+IVN WA+G D   W+ 
Sbjct  349  KLNYMDMVVKESFRLYPPGPLLIPHESTEGIEMGGYYIPKGTRVIVNAWALGRDAGTWAE  408

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            DP++F P RF+   ++ +GRDF+LIPFGSGRR CPG+ LG+  VRL++AQLVHCFDW+LP
Sbjct  409  DPEEFRPERFADGGVDVKGRDFQLIPFGSGRRGCPGMHLGLVNVRLVLAQLVHCFDWELP  468

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             G SPKELDM+E+FGL + RAKHL+  P+YRL
Sbjct  469  AGTSPKELDMSEDFGLAMPRAKHLILRPSYRL  500



>ref|XP_007152787.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
 gb|ESW24781.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
Length=499

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAI+LDM+AG+++TS+T +EW MSEL RHP +MK L+ ELE  VG+++ VEE DL+
Sbjct  287  RTNIKAIILDMIAGALETSSTTLEWAMSELLRHPSVMKRLQHELEHVVGMNKHVEENDLQ  346

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL MV+KE+ R+HPV PLL+P    ED +++G+ I K++RIIVN WAIG DPNVW +
Sbjct  347  KLSYLNMVVKETLRLHPVGPLLVPRECREDVIIDGYLIKKKSRIIVNAWAIGRDPNVWDN  406

Query  353  PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPN  174
             + F P RF   N++ RG+DF ++PFGSGRR CPG+ LG+T V L++AQLVHCFDW LP 
Sbjct  407  AEIFDPTRFENDNVDIRGKDFRILPFGSGRRGCPGIHLGLTTVSLVLAQLVHCFDWMLPL  466

Query  173  GMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            GMS  ELDM E FGL + R  HL+  P YRL
Sbjct  467  GMSCDELDMQEIFGLSIPRKNHLLTRPVYRL  497



>gb|KHN20715.1| Cytochrome P450 71A1 [Glycine soja]
Length=500

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 165/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            +  +K I+ DM+ G+ +TS+ V+EW +SEL RHP +M+ L+ EL+  VG+++MV+E DL 
Sbjct  282  KRSIKGIVFDMIIGASETSSNVIEWAISELVRHPRVMENLQNELKDVVGINKMVDENDLA  341

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL+MV+KE+ R+HPV PLL PH +MED V+ G++I K++R+I+N WAIG DP VWS+
Sbjct  342  KLSYLDMVVKETLRLHPVVPLLAPHESMEDIVIEGYYIKKKSRVIINAWAIGRDPKVWSE  401

Query  353  PKK-FIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              + F P RF  +NI+++G+DF+LIPFGSGRRSCPG+ +G+T V+L++ QLVHCF W+LP
Sbjct  402  NAEVFYPERFMNSNIDFKGQDFQLIPFGSGRRSCPGIVMGLTTVKLVLTQLVHCFKWELP  461

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             G+ P ELDM E+ GL + RA+HL+ IPTYRL
Sbjct  462  CGIGPDELDMNEKSGLSMPRARHLLVIPTYRL  493



>ref|XP_010036875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW48537.1| hypothetical protein EUGRSUZ_K02212 [Eucalyptus grandis]
Length=504

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R +VKAI+LD+++GS ++S+T+++W  SEL R P +MK L++EL   VG++RMVEE DL 
Sbjct  291  RTNVKAIVLDLISGSYESSSTIIDWAFSELMRSPHVMKKLQQELRAIVGMNRMVEESDLP  350

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L YL+MVIKE+FR++P  PLL+PH + ED  ++G +IPKR R+IVN WA+G D + W D
Sbjct  351  KLNYLDMVIKETFRLYPPGPLLIPHESTEDIEIDGHYIPKRTRVIVNAWALGRDIDAWGD  410

Query  353  P-KKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF+ ++++ +GRDF+LIPFGSGRRSCPG+ L +   RL +AQ+VHCFDW+LP
Sbjct  411  DVEEFKPERFANSSVDVKGRDFQLIPFGSGRRSCPGMNLALINTRLFLAQMVHCFDWELP  470

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +GMSP +LDMTEE GL +++AKHL  +PTYRL
Sbjct  471  DGMSPSDLDMTEEVGLSLSKAKHLSLVPTYRL  502



>ref|XP_010663583.1| PREDICTED: cytochrome P450 CYP736A12 isoform X2 [Vitis vinifera]
Length=472

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R +VKAI+LD+L G +D+S   V+W ++EL RHP +MK ++EEL+  VG+ R VEE DL+
Sbjct  259  RTNVKAIILDILVGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRTVEESDLK  318

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L Y+ MV+KE+ R+HPV P L+P  ++E   +N  +IPK+ARI++N WAIG DPN WS+
Sbjct  319  SLIYMNMVLKEALRLHPVGPFLIPRESVEHSTINEHYIPKKARILINTWAIGRDPNAWSN  378

Query  353  -PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF   NI+  G DFELIPFGSGRR CPG+QLG+  V+L++AQLVHCFDW+LP
Sbjct  379  NAEEFFPERFIDNNIDLYGHDFELIPFGSGRRRCPGIQLGLITVQLILAQLVHCFDWELP  438

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            N MSP +L+M E+FGL + RA HL+A PTYRL +
Sbjct  439  NDMSPSDLNMREKFGLTMPRANHLIAKPTYRLHI  472



>ref|XP_007152789.1| hypothetical protein PHAVU_004G159800g [Phaseolus vulgaris]
 gb|ESW24783.1| hypothetical protein PHAVU_004G159800g [Phaseolus vulgaris]
Length=499

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAI+LD++AG+++TS+T++EW MSEL RHP +MK L+ ELE  VG++R VEE DLE
Sbjct  287  RTNIKAIILDIIAGALETSSTMLEWAMSELLRHPSVMKRLQHELEHVVGMNRHVEENDLE  346

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
            +L YL MV+KE+ R+HPVAPLL+P    ED +++G+ I K++RIIVN WAIG DP VW++
Sbjct  347  NLSYLNMVVKETLRLHPVAPLLVPRECREDVIIDGYFIKKKSRIIVNAWAIGRDPKVWNN  406

Query  353  PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPN  174
               F P RF   NI+ RG+DF ++PFGSGRR CPG+ LG+T + L++AQLVHCFDW LP 
Sbjct  407  AAIFDPTRFENDNIDIRGKDFRILPFGSGRRGCPGIHLGLTTLSLVLAQLVHCFDWVLPL  466

Query  173  GMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            GMS  ELDM E FGL + R  HL+  P YRL
Sbjct  467  GMSSHELDMQEIFGLSIPRKNHLLTRPVYRL  497



>ref|XP_004237368.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=502

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 176/232 (76%), Gaps = 6/232 (3%)
 Frame = -3

Query  758  MXDIMKSGE----STIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLK  591
            + DIM S +    S+    R  +KAI+ DM+ G++DTS T +EW+ +E+ +HP +M  L+
Sbjct  269  LVDIMLSYQDNPNSSYSIDRATMKAILSDMIVGAIDTSHTWIEWVFAEIIKHPTVMNKLQ  328

Query  590  EELERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKR  411
            +EL   VGLDRMVEE+DL  LEYLE+V+KE+FR+HPVAPLL+P  ++ED V++  +IPK 
Sbjct  329  DELTSIVGLDRMVEEDDLLKLEYLELVLKETFRLHPVAPLLVPRESIEDVVISECYIPKG  388

Query  410  ARIIVNIWAIGHDPNVWSDP-KKFIPNRFSG-TNIEYRGRDFELIPFGSGRRSCPGLQLG  237
            +R+++N WA+GHDPN+WSD  ++FIP RF G    + RG DF L+PFG GRRSCPG+ LG
Sbjct  389  SRVMINCWALGHDPNIWSDNVEEFIPERFIGKKKTDLRGHDFHLLPFGYGRRSCPGINLG  448

Query  236  ITVVRLLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            +  V+L+VAQLVHCF+WDLP+G+ P +LDMTE+FGL   RA+ L+ IPTYRL
Sbjct  449  LITVKLIVAQLVHCFNWDLPDGIFPVDLDMTEKFGLAAPRAQDLLVIPTYRL  500



>ref|XP_010045642.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW83846.1| hypothetical protein EUGRSUZ_B00716 [Eucalyptus grandis]
Length=508

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KAI+LDM++GS +TS+T ++W  SEL R+P+ M  L+EELE  VGL RMVEE DL 
Sbjct  295  RTNIKAIILDMISGSFETSSTSIDWAFSELMRNPQAMARLQEELETVVGLTRMVEESDLS  354

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             L YL+MV KES R+HPV PLL+P  +MED ++N   IPK+++IIVNIWAIG DP+VWS 
Sbjct  355  KLNYLDMVAKESMRLHPVIPLLVPRESMEDAIINERFIPKKSQIIVNIWAIGRDPSVWSE  414

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            + ++F+P RF+   I+ +G  FEL+PFGSGRR CPG+QLG+  V+ ++AQL HCF W+LP
Sbjct  415  NAEEFVPERFADNGIDVKGHHFELLPFGSGRRGCPGIQLGLIQVKFVLAQLAHCFKWELP  474

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             GM P ++DM+E FGL V RA HL A+PTYRL
Sbjct  475  KGMVPSDIDMSERFGLSVPRANHLFAVPTYRL  506



>ref|XP_002275691.1| PREDICTED: cytochrome P450 CYP736A12 isoform X1 [Vitis vinifera]
Length=501

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R +VKAI+LD+L G +D+S   V+W ++EL RHP +MK ++EEL+  VG+ R VEE DL+
Sbjct  288  RTNVKAIILDILVGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRTVEESDLK  347

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L Y+ MV+KE+ R+HPV P L+P  ++E   +N  +IPK+ARI++N WAIG DPN WS+
Sbjct  348  SLIYMNMVLKEALRLHPVGPFLIPRESVEHSTINEHYIPKKARILINTWAIGRDPNAWSN  407

Query  353  -PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF   NI+  G DFELIPFGSGRR CPG+QLG+  V+L++AQLVHCFDW+LP
Sbjct  408  NAEEFFPERFIDNNIDLYGHDFELIPFGSGRRRCPGIQLGLITVQLILAQLVHCFDWELP  467

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            N MSP +L+M E+FGL + RA HL+A PTYRL +
Sbjct  468  NDMSPSDLNMREKFGLTMPRANHLIAKPTYRLHI  501



>ref|XP_010047217.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=531

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 161/212 (76%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R ++KA+ LDM+A S ++S+T +EW MSEL RHP  MK L+ ELE  VGL R VEE DL 
Sbjct  318  RTNIKALALDMIAASYESSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLP  377

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWS-  357
             L Y++MV+KESFR++P  PLL+PH + E   + G++IPK  R+IVN WA+G D   W+ 
Sbjct  378  KLNYMDMVVKESFRLYPPGPLLIPHESTEGIEMGGYYIPKGTRVIVNAWALGRDAGTWAE  437

Query  356  DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
            DP++F P RF+   ++ +GRDF+LIPFGSGRR CPG+ LG+  VRL++AQLVHCFDW+LP
Sbjct  438  DPEEFRPERFADGGVDVKGRDFQLIPFGSGRRGCPGMHLGLVNVRLVLAQLVHCFDWELP  497

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             G SPKELDM+E+FGL + RAKHL+  P+YRL
Sbjct  498  AGTSPKELDMSEDFGLAMPRAKHLILRPSYRL  529



>ref|XP_003615678.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98636.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 166/220 (75%), Gaps = 1/220 (0%)
 Frame = -3

Query  737  GESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDR  558
            GE  +   R ++KAI+LDM+  ++DTSAT +EW +SEL RHP +MK L++E++ +VG  R
Sbjct  285  GEQNLVIDRTNIKAILLDMIVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKR  344

Query  557  MVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIG  378
            MV E+DL+ L YL+MV+ E+ R++PVAPLL+P  + E   ++G+ I ++ R+IVN WAIG
Sbjct  345  MVNEKDLKKLNYLDMVVDETLRLYPVAPLLVPRESRESTTIDGYFIKEKTRLIVNAWAIG  404

Query  377  HDPNVWS-DPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLV  201
             DPNVWS + K+F P RF    + Y G++FE IPFGSGRR CPG+QLG+  V+L++AQ +
Sbjct  405  RDPNVWSENAKEFYPERFVEKKMNYLGQEFESIPFGSGRRRCPGIQLGLITVKLVIAQFI  464

Query  200  HCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            HCF+W+LP+ +SP  L+M E+FGL + RA+HL AIP+YRL
Sbjct  465  HCFNWELPHNISPSNLNMEEKFGLTIPRAQHLHAIPSYRL  504



>gb|AFK79030.1| cytochrome P450 CYP736A53 [Bupleurum chinense]
Length=498

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R  +K+I++D++  S++TS+  ++WI++EL +HP  MK  +EEL   VGLDRMVEE+DL 
Sbjct  287  RPSIKSIVIDIITASINTSSISIDWILTELMKHPTAMKKCQEELTSVVGLDRMVEEKDLP  346

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             LEYL MVIKE  R++P+APLL PH A ED ++NG+HI K++RIIVN+WAIG DP VWSD
Sbjct  347  KLEYLYMVIKEGLRLYPIAPLLGPHEAKEDIMINGYHIHKKSRIIVNVWAIGRDPKVWSD  406

Query  353  -PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++FIP RF+ + I+ RGRDFEL+PFGSGRR CPG+QLG+  V+L++AQL+HCF+W+LP
Sbjct  407  NAEEFIPERFADSKIDLRGRDFELLPFGSGRRGCPGIQLGVLNVQLVLAQLLHCFEWELP  466

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
             G +P++LDMTE FGL + R +HL  +P  R+
Sbjct  467  AGKAPEDLDMTELFGLTIPRIEHLQLVPKIRI  498



>ref|XP_007152790.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
 gb|ESW24784.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
Length=507

 Score =   253 bits (646),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R +VKAI+LD++  ++DTS T +EW MSEL RHP +MK L+ ELE  VG++R VEE DLE
Sbjct  295  RTNVKAIILDIITAALDTSYTTIEWAMSELLRHPSVMKRLQHELEHVVGMNRHVEENDLE  354

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
            +L YL MV+KE+ R+HPVAPLL+P    ED +++G+ I K++RIIVN WAIG DP VW++
Sbjct  355  NLSYLNMVVKETLRLHPVAPLLVPRECREDVIIDGYFIKKKSRIIVNAWAIGRDPKVWNN  414

Query  353  PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLPN  174
               F P RF   NI+ RG+DF ++PFGSGRR CPG+ LG+T   L++AQLVHCFDW LP 
Sbjct  415  AAIFNPTRFENDNIDIRGKDFRILPFGSGRRGCPGIHLGLTTFSLILAQLVHCFDWVLPL  474

Query  173  GMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            GMS  ELDM E FGL   R KHL+  P YRL
Sbjct  475  GMSCDELDMQEIFGLTTPRKKHLLVRPVYRL  505



>ref|XP_009372725.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   252 bits (644),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 175/223 (78%), Gaps = 0/223 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
             M   M S ES  +  R ++KA+M DML  S DTS+T V W +S L RHP++MK +++E+
Sbjct  268  AMLAYMGSEESDYRIERLNIKAMMSDMLVASADTSSTTVLWALSGLMRHPQVMKKVQKEI  327

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            +  VGL+RMVEE D E LEYL+MV+KE+ R+HPV PLLLPHAA+EDC V+G+HIPK++R+
Sbjct  328  KNVVGLNRMVEESDTEKLEYLDMVVKETMRLHPVLPLLLPHAAIEDCTVDGYHIPKKSRV  387

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            IVN+WAIG DP+VW D +KF+P RF  +N++ RG  F+++PFGSGRR C G+QLGITVV 
Sbjct  388  IVNVWAIGRDPSVWEDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCVGMQLGITVVH  447

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIP  93
             ++AQLVH FDW+LP+ M P ELDMT EFGL V+RAK+L+AIP
Sbjct  448  FVLAQLVHWFDWELPDNMLPNELDMTAEFGLAVSRAKNLLAIP  490



>ref|XP_003534173.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=978

 Score =   261 bits (667),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 163/227 (72%), Gaps = 1/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   M   E      R ++KAI+LDM+A S DTS   VEW MSEL R+P  MK L+EEL 
Sbjct  747  MHQAMNQQEQKYVTGRTNIKAIILDMIAASFDTSTVAVEWAMSELLRNPSDMKKLQEELN  806

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG D++VEE DL  L YL MV+KE+ R++P  PLLLP  ++ED  +NG+HI K+ RI+
Sbjct  807  NVVGEDKLVEESDLSKLPYLNMVVKETLRLYPAGPLLLPRESLEDITINGYHIKKKTRIL  866

Query  398  VNIWAIGHDPNVWSDPKK-FIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            VN WAIG DP VWSD    F P RF  +N++ RG DF+L+PFGSGRR CPG+QLG+T   
Sbjct  867  VNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGCPGIQLGLTTFG  926

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCF+W+LP G+SP +LDM+E FGL + R+K L+AIPTYRL
Sbjct  927  LVLAQLVHCFNWELPFGVSPDDLDMSERFGLSLPRSKPLLAIPTYRL  973


 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 165/227 (73%), Gaps = 1/227 (0%)
 Frame = -3

Query  758  MXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELE  579
            M   +   E      R ++KAI+LDM+AGS DTSA  VEW MSEL R+P  MK L+EEL 
Sbjct  276  MHQAVNQQEQKYVIGRTNIKAIILDMIAGSFDTSAVAVEWAMSELLRNPSDMKKLQEELN  335

Query  578  RQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARII  399
              VG +++VEE DL  L YL MV+KE+ R++P  PLL+P  ++ED  +NG+HI K+ RI+
Sbjct  336  NVVGENKLVEESDLSKLPYLNMVVKETLRLYPAGPLLVPRESLEDITINGYHIKKKTRIL  395

Query  398  VNIWAIGHDPNVWSDPKK-FIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
            VN WAIG DP VWSD    F P RF  +N++ RG DF+L+PFGSGRR CPG+QLG+T   
Sbjct  396  VNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGCPGIQLGLTTFG  455

Query  221  LLVAQLVHCFDWDLPNGMSPKELDMTEEFGLVVTRAKHLMAIPTYRL  81
            L++AQLVHCF+W+LP G+SP +LDM+E FGL + R+K L+AIPTYRL
Sbjct  456  LVLAQLVHCFNWELPFGVSPDDLDMSEIFGLSLPRSKPLLAIPTYRL  502



>ref|XP_006365796.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=482

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = -3

Query  761  TMXDIMKSGESTIQFTREHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEEL  582
            TM  IM+SGE+  +  R  VKA++LD+L  S D  +  ++WI+SEL RHP++MK L+ EL
Sbjct  271  TMMTIMQSGEAEFKIDRRDVKAVLLDLLLASTDNVSIAIDWILSELLRHPKVMKKLQIEL  330

Query  581  ERQVGLDRMVeeedlehleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARI  402
            E+ VG++RMVEE DLE LEYL+MVI+E  R+HP + LL PH ++EDC+V+GF IPK +R+
Sbjct  331  EQAVGINRMVEESDLERLEYLDMVIREGLRLHPPSTLLTPHESIEDCIVDGFDIPKGSRL  390

Query  401  IVNIWAIGHDPNVWSDPKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVR  222
             VN+WAIG DP  W DP+KF+P RF  +NI+ RG DF+L+PFGSGRRSCPGLQLG+T+VR
Sbjct  391  FVNVWAIGRDPEAWPDPEKFMPERFVDSNIDLRGHDFQLLPFGSGRRSCPGLQLGLTIVR  450

Query  221  LLVAQLVHCFDWDLPN  174
            L++AQLVHCFDW+LPN
Sbjct  451  LVLAQLVHCFDWELPN  466



>emb|CAN69565.1| hypothetical protein VITISV_033534 [Vitis vinifera]
Length=501

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 161/214 (75%), Gaps = 1/214 (0%)
 Frame = -3

Query  713  REHVKAIMLDMLAGSMDTSATVVEWIMSELFRHPEIMKTLKEELERQVGLDRMVeeedle  534
            R +VKAI+ D+L G +D+S   V+W ++EL RHP +MK ++EEL+  VG+ R VEE DL+
Sbjct  288  RTNVKAIIFDILVGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRTVEESDLK  347

Query  533  hleylEMVIKESFRIHPVAPLLLPHAAMEDCVVNGFHIPKRARIIVNIWAIGHDPNVWSD  354
             L Y+ MV+KE+ R+HPV P L+P  ++E   +N  +IPK+ARI++N WAIG DP+ WS+
Sbjct  348  SLIYMNMVLKEALRLHPVGPFLIPRESVEHSTINEHYIPKKARILINTWAIGRDPBAWSN  407

Query  353  -PKKFIPNRFSGTNIEYRGRDFELIPFGSGRRSCPGLQLGITVVRLLVAQLVHCFDWDLP  177
              ++F P RF   NI+  G DFELIPFGSGRR CPG+QLG+  V+L++AQLVHCFDW+LP
Sbjct  408  NAEEFFPERFIDNNIDLYGHDFELIPFGSGRRRCPGIQLGLITVQLILAQLVHCFDWELP  467

Query  176  NGMSPKELDMTEEFGLVVTRAKHLMAIPTYRLRL  75
            N MSP +L+M E+FGL + RA HL+A PTYRL +
Sbjct  468  NDMSPSDLNMREKFGLTMPRANHLIAKPTYRLHI  501



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680