BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049B10

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628597.1|  PREDICTED: ataxin-2 homolog                        245   2e-73   Nicotiana tomentosiformis
ref|XP_004248167.1|  PREDICTED: bromodomain-containing protein 4        241   1e-71   Solanum lycopersicum
ref|XP_009782976.1|  PREDICTED: vacuolar protein sorting-associat...    237   2e-70   Nicotiana sylvestris
ref|XP_009628959.1|  PREDICTED: extensin-like                           237   2e-70   Nicotiana tomentosiformis
ref|XP_009782624.1|  PREDICTED: pollen-specific leucine-rich repe...    236   5e-70   Nicotiana sylvestris
ref|XP_004243351.1|  PREDICTED: bromodomain-containing protein 4-...    236   5e-70   Solanum lycopersicum
ref|XP_006367642.1|  PREDICTED: adenylate cyclase, terminal-diffe...    234   2e-69   Solanum tuberosum [potatoes]
ref|XP_006357482.1|  PREDICTED: transcription factor SPT20 homolog      234   4e-69   Solanum tuberosum [potatoes]
emb|CDP14783.1|  unnamed protein product                                198   1e-55   Coffea canephora [robusta coffee]
ref|XP_010110218.1|  hypothetical protein L484_009824                   194   4e-54   Morus notabilis
ref|XP_010689008.1|  PREDICTED: RNA polymerase II degradation fac...    189   2e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB31694.1|  hypothetical protein B456_005G201600                    172   8e-46   Gossypium raimondii
ref|XP_002272844.1|  PREDICTED: arginine-glutamic acid dipeptide ...    171   2e-45   Vitis vinifera
ref|XP_007198900.1|  hypothetical protein PRUPE_ppa004117mg             168   1e-44   Prunus persica
ref|XP_007043595.1|  Structural constituent of cell wall                167   3e-44   
ref|XP_002517918.1|  structural constituent of cell wall, putative      167   4e-44   Ricinus communis
ref|XP_008229157.1|  PREDICTED: mediator of RNA polymerase II tra...    164   4e-43   Prunus mume [ume]
ref|XP_008229158.1|  PREDICTED: mediator of RNA polymerase II tra...    164   4e-43   Prunus mume [ume]
gb|KJB77274.1|  hypothetical protein B456_012G128800                    161   3e-42   Gossypium raimondii
gb|KJB77267.1|  hypothetical protein B456_012G128800                    160   4e-42   Gossypium raimondii
gb|KJB77269.1|  hypothetical protein B456_012G128800                    158   4e-42   Gossypium raimondii
gb|KJB77268.1|  hypothetical protein B456_012G128800                    161   4e-42   Gossypium raimondii
gb|KJB77271.1|  hypothetical protein B456_012G128800                    161   6e-42   Gossypium raimondii
gb|KDP24130.1|  hypothetical protein JCGZ_25787                         160   8e-42   Jatropha curcas
ref|XP_008337475.1|  PREDICTED: altered inheritance of mitochondr...    160   2e-41   
gb|KHG27956.1|  S-adenosylmethionine synthase 1                         160   2e-41   Gossypium arboreum [tree cotton]
gb|KEH17617.1|  structural constituent of cell wall protein, puta...    159   2e-41   Medicago truncatula
gb|KHN31988.1|  hypothetical protein glysoja_025822                     159   2e-41   Glycine soja [wild soybean]
ref|XP_003539922.1|  PREDICTED: putative uncharacterized protein ...    159   4e-41   Glycine max [soybeans]
ref|XP_006592435.1|  PREDICTED: putative uncharacterized protein ...    159   4e-41   Glycine max [soybeans]
ref|XP_007132659.1|  hypothetical protein PHAVU_011G113900g             158   7e-41   Phaseolus vulgaris [French bean]
ref|XP_009357856.1|  PREDICTED: putative uncharacterized protein ...    157   9e-41   Pyrus x bretschneideri [bai li]
ref|XP_004506616.1|  PREDICTED: transcription factor SPT20 homolog      155   7e-40   Cicer arietinum [garbanzo]
ref|XP_004303103.1|  PREDICTED: transcriptional regulator DEF1          155   8e-40   Fragaria vesca subsp. vesca
ref|XP_006582794.1|  PREDICTED: vacuolar protein sorting-associat...    150   2e-38   
gb|KHN35253.1|  hypothetical protein glysoja_042323                     150   3e-38   Glycine soja [wild soybean]
ref|XP_006447363.1|  hypothetical protein CICLE_v10014791mg             150   6e-38   Citrus clementina [clementine]
ref|XP_006447362.1|  hypothetical protein CICLE_v10014791mg             150   6e-38   Citrus clementina [clementine]
ref|XP_008342910.1|  PREDICTED: extensin-like isoform X1                149   7e-38   
ref|XP_008342911.1|  PREDICTED: extensin-like isoform X2                149   7e-38   
gb|KDO51849.1|  hypothetical protein CISIN_1g008878mg                   149   9e-38   Citrus sinensis [apfelsine]
gb|KDO51850.1|  hypothetical protein CISIN_1g008878mg                   149   9e-38   Citrus sinensis [apfelsine]
ref|XP_011098021.1|  PREDICTED: extensin                                147   4e-37   Sesamum indicum [beniseed]
ref|XP_002325597.2|  hydroxyproline-rich glycoprotein                   147   8e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011002849.1|  PREDICTED: calcium-binding protein P-like          146   1e-36   Populus euphratica
ref|XP_009341977.1|  PREDICTED: ATP-dependent helicase brm-like i...    145   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_009341976.1|  PREDICTED: ATP-dependent helicase brm-like i...    145   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_009336198.1|  PREDICTED: mediator of RNA polymerase II tra...    145   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_009336199.1|  PREDICTED: mediator of RNA polymerase II tra...    145   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_006376495.1|  hydroxyproline-rich glycoprotein                   141   6e-35   Populus trichocarpa [western balsam poplar]
gb|EYU28592.1|  hypothetical protein MIMGU_mgv1a004659mg                140   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_010035753.1|  PREDICTED: RNA polymerase II degradation fac...    139   4e-34   Eucalyptus grandis [rose gum]
gb|KCW89535.1|  hypothetical protein EUGRSUZ_A01820                     133   4e-32   Eucalyptus grandis [rose gum]
ref|XP_010051997.1|  PREDICTED: LOW QUALITY PROTEIN: bromodomain-...    133   5e-32   Eucalyptus grandis [rose gum]
ref|XP_011037330.1|  PREDICTED: putative uncharacterized protein ...    132   6e-32   Populus euphratica
ref|XP_011037329.1|  PREDICTED: bromodomain-containing protein 4-...    132   7e-32   Populus euphratica
ref|XP_003540363.1|  PREDICTED: integrator complex subunit 3 homo...    132   9e-32   Glycine max [soybeans]
ref|XP_007149849.1|  hypothetical protein PHAVU_005G103700g             132   1e-31   Phaseolus vulgaris [French bean]
gb|KEH39132.1|  structural constituent of cell wall protein, puta...    123   1e-28   Medicago truncatula
gb|KEH39131.1|  structural constituent of cell wall protein, puta...    123   1e-28   Medicago truncatula
ref|XP_010242911.1|  PREDICTED: RNA polymerase II degradation fac...    120   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_008455323.1|  PREDICTED: mediator of RNA polymerase II tra...    112   2e-24   Cucumis melo [Oriental melon]
ref|XP_003543336.1|  PREDICTED: RNA polymerase II degradation fac...    110   7e-24   Glycine max [soybeans]
ref|XP_004136824.1|  PREDICTED: uncharacterized protein LOC101206745    110   7e-24   Cucumis sativus [cucumbers]
ref|XP_008455322.1|  PREDICTED: transcription factor SPT20 homolog      108   3e-23   Cucumis melo [Oriental melon]
ref|XP_010924426.1|  PREDICTED: putative cyclin-dependent serine/...    107   3e-23   
gb|KHN36637.1|  hypothetical protein glysoja_001368                     108   4e-23   Glycine soja [wild soybean]
ref|XP_010924425.1|  PREDICTED: hepatocyte growth factor-regulate...    107   6e-23   Elaeis guineensis
ref|XP_004136823.1|  PREDICTED: uncharacterized protein LOC101206501    107   7e-23   Cucumis sativus [cucumbers]
ref|XP_008798248.1|  PREDICTED: putative cyclin-dependent serine/...    100   2e-20   Phoenix dactylifera
ref|XP_008810225.1|  PREDICTED: ataxin-2 homolog isoform X1           93.2    5e-18   Phoenix dactylifera
ref|XP_008810226.1|  PREDICTED: ataxin-2 homolog isoform X2           93.2    5e-18   Phoenix dactylifera
ref|XP_010919602.1|  PREDICTED: tyrosine-protein phosphatase non-...  91.7    2e-17   Elaeis guineensis
ref|XP_010919593.1|  PREDICTED: tyrosine-protein phosphatase non-...  91.7    2e-17   Elaeis guineensis
ref|XP_002869511.1|  hypothetical protein ARALYDRAFT_491942           88.2    2e-16   
ref|NP_974630.1|  uncharacterized protein                             87.0    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194559.2|  uncharacterized protein                             87.0    6e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB79632.1|  predicted proline-rich protein                       87.0    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144355.1|  PREDICTED: protein transport protein SEC31-like  86.7    8e-16   Brassica rapa
ref|XP_009137778.1|  PREDICTED: basic salivary proline-rich prote...  86.3    1e-15   Brassica rapa
ref|XP_006283593.1|  hypothetical protein CARUB_v10004649mg           85.9    1e-15   Capsella rubella
emb|CDY14248.1|  BnaA08g13790D                                        85.9    2e-15   Brassica napus [oilseed rape]
gb|KFK35898.1|  hypothetical protein AALP_AA4G050800                  85.5    2e-15   Arabis alpina [alpine rockcress]
emb|CDY67879.1|  BnaC07g50480D                                        85.5    2e-15   Brassica napus [oilseed rape]
ref|XP_010540875.1|  PREDICTED: extensin                              85.5    2e-15   Tarenaya hassleriana [spider flower]
emb|CDX89188.1|  BnaA01g17050D                                        84.3    5e-15   
ref|XP_010438481.1|  PREDICTED: formin-like protein 5                 84.3    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010433239.1|  PREDICTED: bromodomain-containing protein 4-...  84.3    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010448000.1|  PREDICTED: vacuolar protein-sorting protein ...  84.3    5e-15   Camelina sativa [gold-of-pleasure]
emb|CDX97433.1|  BnaC08g12980D                                        83.6    9e-15   
gb|EPS62243.1|  hypothetical protein M569_12549                       83.6    9e-15   Genlisea aurea
ref|XP_006412973.1|  hypothetical protein EUTSA_v10024987mg           83.2    1e-14   Eutrema salsugineum [saltwater cress]
emb|CDY18985.1|  BnaC01g20830D                                        83.2    1e-14   Brassica napus [oilseed rape]
emb|CDY25250.1|  BnaA02g22060D                                        82.8    2e-14   Brassica napus [oilseed rape]
ref|XP_009109102.1|  PREDICTED: formin-like protein 3                 82.0    3e-14   Brassica rapa
gb|EEC71500.1|  hypothetical protein OsI_03777                        77.0    1e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001044280.1|  Os01g0754500                                     76.6    2e-12   
dbj|BAK01177.1|  predicted protein                                    75.9    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006644724.1|  PREDICTED: mediator of RNA polymerase II tra...  72.4    5e-11   Oryza brachyantha
ref|XP_006644725.1|  PREDICTED: mediator of RNA polymerase II tra...  72.0    6e-11   Oryza brachyantha
emb|CDM84126.1|  unnamed protein product                              71.2    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008655245.1|  PREDICTED: uncharacterized protein LOC100383...  71.2    1e-10   Zea mays [maize]
gb|EMT05386.1|  hypothetical protein F775_26441                       70.9    2e-10   
ref|NP_001169238.1|  uncharacterized protein LOC100383096             70.5    2e-10   Zea mays [maize]
ref|XP_004969990.1|  PREDICTED: trithorax group protein osa-like      70.1    3e-10   Setaria italica
ref|XP_009395702.1|  PREDICTED: pollen-specific leucine-rich repe...  69.3    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS50510.1|  hypothetical protein TRIUR3_23019                     68.6    9e-10   Triticum urartu
ref|XP_002458505.1|  hypothetical protein SORBIDRAFT_03g034890        67.4    2e-09   Sorghum bicolor [broomcorn]
ref|XP_009396506.1|  PREDICTED: pinin-like                            62.8    6e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795992.1|  PREDICTED: protein transport protein SEC31-like  58.2    3e-06   
gb|KEH24794.1|  DNA-binding protein, putative                         57.4    5e-06   Medicago truncatula
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     56.2    1e-05   Elaeis guineensis
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...  56.2    1e-05   Oryza brachyantha
ref|XP_001784568.1|  predicted protein                                55.5    2e-05   
ref|XP_008801947.1|  PREDICTED: arginine-glutamic acid dipeptide ...  54.7    4e-05   Phoenix dactylifera
emb|CAJ44247.1|  hypothetical protein                                 51.6    4e-05   Cocos nucifera
ref|XP_006446566.1|  hypothetical protein CICLE_v10014743mg           54.7    4e-05   Citrus clementina [clementine]
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...  54.7    4e-05   Oryza brachyantha
ref|XP_006470271.1|  PREDICTED: COPII coat assembly protein sec16...  54.3    5e-05   Citrus sinensis [apfelsine]
ref|XP_011097415.1|  PREDICTED: protein enabled-like                  54.3    5e-05   Sesamum indicum [beniseed]
ref|XP_001770189.1|  predicted protein                                53.9    5e-05   
gb|KDO55180.1|  hypothetical protein CISIN_1g0084162mg                53.9    6e-05   Citrus sinensis [apfelsine]
ref|XP_002300038.2|  hypothetical protein POPTR_0001s34990g           53.5    7e-05   
ref|XP_001758183.1|  predicted protein                                53.5    9e-05   
gb|KDO55178.1|  hypothetical protein CISIN_1g0084162mg                53.5    1e-04   Citrus sinensis [apfelsine]
gb|KDO55179.1|  hypothetical protein CISIN_1g0084162mg                53.1    1e-04   Citrus sinensis [apfelsine]
ref|XP_010108811.1|  hypothetical protein L484_020546                 52.8    2e-04   Morus notabilis
ref|XP_009388841.1|  PREDICTED: bromodomain-containing protein 4      52.8    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042136.2|  Os01g0169900                                     52.0    3e-04   
ref|XP_002440684.1|  hypothetical protein SORBIDRAFT_09g005090        51.6    4e-04   
ref|XP_011047322.1|  PREDICTED: vacuolar protein sorting-associat...  51.6    4e-04   Populus euphratica
ref|XP_007031556.1|  Uncharacterized protein TCM_016944               51.6    4e-04   
ref|XP_006833453.1|  hypothetical protein AMTR_s00082p00053170        51.6    5e-04   
gb|KHG02060.1|  Myosin-2                                              51.2    5e-04   Gossypium arboreum [tree cotton]
gb|KJB75894.1|  hypothetical protein B456_012G063600                  51.2    5e-04   Gossypium raimondii
ref|XP_002524656.1|  DNA binding protein, putative                    51.2    6e-04   Ricinus communis
ref|XP_009611187.1|  PREDICTED: transcriptional regulator DEF1 is...  50.8    8e-04   Nicotiana tomentosiformis
ref|XP_009611188.1|  PREDICTED: transcriptional regulator DEF1 is...  50.8    8e-04   Nicotiana tomentosiformis
gb|KHG20812.1|  Actin cytoskeleton-regulatory complex PAN1            50.4    9e-04   Gossypium arboreum [tree cotton]
gb|ADE75761.1|  unknown                                               50.4    0.001   Picea sitchensis
gb|KDP45326.1|  hypothetical protein JCGZ_09575                       50.4    0.001   Jatropha curcas
ref|XP_004489226.1|  PREDICTED: vacuolar protein sorting-associat...  50.4    0.001   Cicer arietinum [garbanzo]



>ref|XP_009628597.1| PREDICTED: ataxin-2 homolog [Nicotiana tomentosiformis]
Length=535

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 139/176 (79%), Gaps = 1/176 (1%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQVPFSG++Q VASRPE MPYG   +SRP+Q Q    HLKP+F A GDGY  SG H
Sbjct  361  NSMPMQVPFSGISQPVASRPEAMPYGYDRSSRPLQQQPAPPHLKPSFGAVGDGYAASGAH  420

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRN  431
            P+ +PGNAYVMYD EG RGHPP QP F Q  YPPSSF   NP    + N+MVRPPQ +RN
Sbjct  421  PTLSPGNAYVMYDGEGTRGHPPPQPNFSQSGYPPSSFPPQNPQPTPSANLMVRPPQLVRN  480

Query  430  PPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
              PYNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNAVLDRLNGHSSGGSQ+GW
Sbjct  481  -HPYNELIEKLVSMGYRADHVVNVIQRLEESGQPVDFNAVLDRLNGHSSGGSQRGW  535



>ref|XP_004248167.1| PREDICTED: bromodomain-containing protein 4 [Solanum lycopersicum]
Length=545

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 139/180 (77%), Gaps = 9/180 (5%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQV FS + Q+V+SRPE +PYG   + RP+Q Q P QHLKP+F APGDGY  SGPH
Sbjct  369  NSMPMQVSFSTIPQSVSSRPEAIPYGYDRSGRPLQSQPPTQHLKPSFGAPGDGYAASGPH  428

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANT----NVMVRPPQ  443
            PS + GNAY+MYDSEGPRGHPPQ P FPQ  YPPSSF    PPQ A +    N M RPPQ
Sbjct  429  PSLSAGNAYLMYDSEGPRGHPPQPPNFPQSGYPPSSF----PPQNAQSSPSPNHMFRPPQ  484

Query  442  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             MR   PYNEL+EKLASMGYR DH++NVIQR+EESGQ VDFN VLDRLNGHSSGG Q+GW
Sbjct  485  LMRT-HPYNELIEKLASMGYRGDHVVNVIQRLEESGQTVDFNTVLDRLNGHSSGGPQRGW  543



>ref|XP_009782976.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Nicotiana sylvestris]
Length=535

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQVPFSG++Q VASRPE M YG   + RP+Q Q    HLKP+F A GDGY  +G H
Sbjct  361  NSMPMQVPFSGISQPVASRPEAMSYGYDRSGRPLQQQPVAPHLKPSFGAVGDGYAANGAH  420

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRN  431
            P+ +PGNAYVMYD EG RGHPP QP F Q  YPPSSF   NP    + N+MVRPPQ +RN
Sbjct  421  PTLSPGNAYVMYDGEGTRGHPPPQPNFSQSGYPPSSFPPQNPQPTPSANLMVRPPQLVRN  480

Query  430  PPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
              P+ EL+EK+ SMGYR DH+INVIQR+EESGQPVDFNAVLDRLNGHSSGGSQ+GW
Sbjct  481  -HPFKELIEKMVSMGYRADHVINVIQRLEESGQPVDFNAVLDRLNGHSSGGSQRGW  535



>ref|XP_009628959.1| PREDICTED: extensin-like [Nicotiana tomentosiformis]
Length=534

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQV FS + Q  ASRPE MPYG   + R +Q Q P QHL+P+F APGDGY  SGPH
Sbjct  360  NSMPMQVSFSAIPQPAASRPEAMPYGYDRSGRLLQSQPPTQHLRPSFGAPGDGYAASGPH  419

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRN  431
            PS + GNAY+MYDSEGPRGH  Q P FPQ  YPPSSF+  NP    + N+MVRPPQ +R 
Sbjct  420  PSLSTGNAYLMYDSEGPRGHASQPPNFPQSGYPPSSFAPQNPQSTPSPNIMVRPPQLVRT  479

Query  430  PPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
              PYNEL+EK+ SMGYR DH++NVIQR+EESGQ VDFNAVLDRLNGHSSG SQ+GW
Sbjct  480  -HPYNELIEKMVSMGYRGDHVVNVIQRLEESGQTVDFNAVLDRLNGHSSGASQRGW  534



>ref|XP_009782624.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=539

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQV FS + Q  ASRPE MPYG   + RP+Q Q   QHLKP+F APGD Y  SGPH
Sbjct  365  NSMPMQVSFSAIPQPAASRPEAMPYGYDRSGRPLQSQPLSQHLKPSFGAPGDSYAASGPH  424

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRN  431
            PS + GNAY+MYDSEG RGHP Q P FPQ  YPPSSF+  NP    + N+MVRPPQ +R 
Sbjct  425  PSLSAGNAYLMYDSEGTRGHPSQPPNFPQSGYPPSSFAPQNPQSTPSPNIMVRPPQLVRT  484

Query  430  PPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
              PYNEL+EK+ SMGYR DH++NVIQR+EESGQ VDFNAVLDRLNGHSSG SQ+GW
Sbjct  485  -HPYNELIEKMVSMGYRGDHVVNVIQRLEESGQTVDFNAVLDRLNGHSSGASQRGW  539



>ref|XP_004243351.1| PREDICTED: bromodomain-containing protein 4-like [Solanum lycopersicum]
Length=537

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 139/177 (79%), Gaps = 3/177 (2%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQVPFSG++Q VASRPE MPYG   + RP+Q Q    HLKP+F APGDGY  SG H
Sbjct  363  NSMPMQVPFSGVSQPVASRPESMPYGYDRSGRPLQQQPATPHLKPSFGAPGDGYAASGAH  422

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPA-NTNVMVRPPQGMR  434
            P+ +PGNAYVMYD EG R HPP QP F Q  YPPSSF   N  QPA + N+MVRPPQ +R
Sbjct  423  PTLSPGNAYVMYDGEGTRAHPPPQPNFQQSGYPPSSFPPQN-QQPAPSPNLMVRPPQQVR  481

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  PYNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNA+LDR+NGHSSGG Q+GW
Sbjct  482  N-HPYNELIEKLVSMGYRGDHVVNVIQRLEESGQPVDFNAILDRMNGHSSGGPQRGW  537



>ref|XP_006367642.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
[Solanum tuberosum]
Length=548

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 137/180 (76%), Gaps = 9/180 (5%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQ+ +S + Q+VA RPE +PYG   + RP+Q Q P QHLKP+F APGDGY  SGPH
Sbjct  372  NSMPMQMSYSAIPQSVACRPEAIPYGYDRSGRPLQSQPPTQHLKPSFGAPGDGYATSGPH  431

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANT----NVMVRPPQ  443
            PS + GNAY+MYD EGPRGHP Q P FPQ  YPPSSF    PPQ A +    N MVRPPQ
Sbjct  432  PSLSAGNAYLMYDGEGPRGHPSQPPNFPQSGYPPSSF----PPQNAQSSPSPNHMVRPPQ  487

Query  442  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             MR   PYNEL+EKLASMGYR DH++NVIQR+EESGQ VDFN VLDRLNGHSSGG Q+GW
Sbjct  488  LMRT-HPYNELIEKLASMGYRGDHVVNVIQRLEESGQTVDFNTVLDRLNGHSSGGPQRGW  546



>ref|XP_006357482.1| PREDICTED: transcription factor SPT20 homolog [Solanum tuberosum]
Length=537

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQVPFSG++Q VASRPE MPYG   + RP+Q Q    HLKP+F APGDGY  SG H
Sbjct  363  NSMPMQVPFSGVSQPVASRPEAMPYGYDRSGRPLQQQPAAPHLKPSFGAPGDGYAASGAH  422

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRN  431
            P+ +PGNAYVMYD EG R HPP QP F Q  YPPSSF   N     + N+MVRP Q +RN
Sbjct  423  PTLSPGNAYVMYDGEGTRTHPPPQPNFQQSRYPPSSFPPQNQQPTPSPNLMVRPTQQVRN  482

Query  430  PPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
              PYNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNA+LD +NGHSSGGSQ+GW
Sbjct  483  -HPYNELIEKLVSMGYRGDHVVNVIQRLEESGQPVDFNAILDSMNGHSSGGSQRGW  537



>emb|CDP14783.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 129/176 (73%), Gaps = 1/176 (1%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N+M MQVPFSG++Q    R E +PYG G A+RPVQPQ   QHLK  + +P DGY  SGPH
Sbjct  363  NSMPMQVPFSGISQPGPVRAETVPYGYGGAARPVQPQPQPQHLKATYASPADGYAASGPH  422

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRN  431
            P+ +PGN YVMYD  G   HP QQP FPQ  YPP++    N      +N++VRPPQ +RN
Sbjct  423  PTLSPGNTYVMYDEAGRPHHPAQQPHFPQSPYPPTTMPPQNLQPNTGSNLVVRPPQFVRN  482

Query  430  PPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
              PY +L+EK+ SMGYR DH+++ IQR+EESGQPVDFNAVLDRLNGHS+GG Q+GW
Sbjct  483  -HPYGDLIEKVVSMGYRGDHVVSAIQRLEESGQPVDFNAVLDRLNGHSAGGPQRGW  537



>ref|XP_010110218.1| hypothetical protein L484_009824 [Morus notabilis]
 gb|EXC25515.1| hypothetical protein L484_009824 [Morus notabilis]
Length=527

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M MQVP+SG+ Q   S  + +P+G     R    Q P Q +K A+ A PGDGY  SGP
Sbjct  349  NSMPMQVPYSGIPQAGTSLGDAVPFGYTAPGRAAPQQLPPQQMKGAYAAQPGDGYAASGP  408

Query  613  HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGM  437
            HP+F PG+ Y+MYDS+G R H PPQ P F QG YPP+S SL N       NVMVR PQ M
Sbjct  409  HPAFPPGSTYMMYDSDGGRAHYPPQVPHFAQGGYPPTSASLPNQLPNVAPNVMVRNPQFM  468

Query  436  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            RN P Y EL+EKLASMG+R DHI++VIQRMEESGQP+DFN VLDRLN HSSG  Q+GW
Sbjct  469  RNHP-YAELIEKLASMGFRGDHIVSVIQRMEESGQPIDFNGVLDRLNVHSSGAPQRGW  525



>ref|XP_010689008.1| PREDICTED: RNA polymerase II degradation factor 1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 126/180 (70%), Gaps = 5/180 (3%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGYGVSGP  614
            ++MSMQ+PF GM Q+  SRPEGMPYG G  SRP QPQ    H+K  F   PGDGY   G 
Sbjct  364  SSMSMQMPFPGMPQSGVSRPEGMPYGYGGPSRPAQPQPSPPHMKGGFPSQPGDGYATGGS  423

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQ  443
            HP  +   +Y++YD+EG R H   Q  + QG YPP++ SL N P P +++ MVR   P Q
Sbjct  424  HPPVSSAGSYMLYDNEGGRSHHSLQTHYSQGVYPPANPSLPNLPAPGSSSHMVRNPGPQQ  483

Query  442  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             +RN P YNEL++KL SMGYR DH+++VIQR+EESG  VDFNAVLDRLNGHSSG SQ+ W
Sbjct  484  YVRNHP-YNELIDKLVSMGYRSDHVVSVIQRLEESGLAVDFNAVLDRLNGHSSGSSQRSW  542



>gb|KJB31694.1| hypothetical protein B456_005G201600 [Gossypium raimondii]
Length=546

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M+MQV +SG+ Q V+SR + + YG GV  R   PQ P Q +K  F A P D Y   G 
Sbjct  367  NSMAMQVSYSGLPQPVSSRADTITYGYGVPGRTA-PQQPPQQIKGTFGAQPTDRYTGPGS  425

Query  613  HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSS-FSLANPPQPANTNVMVRP---  449
            +P+F PG+AY++YDSEG R H P QQP F QG YPP++  SL   P  A  NVMVR    
Sbjct  426  NPTFPPGSAYMVYDSEGGRTHHPSQQPNFSQGGYPPAANVSLQTQP-GAGPNVMVRNTNH  484

Query  448  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
            PQ +RN P Y+EL+EKL SMG+R DH+ +VIQRMEESGQP DFNAVLDRLN HSSGGSQ+
Sbjct  485  PQFVRNHP-YSELIEKLVSMGFRGDHVASVIQRMEESGQPPDFNAVLDRLNAHSSGGSQR  543

Query  268  -GW  263
             GW
Sbjct  544  GGW  546



>ref|XP_002272844.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Vitis 
vinifera]
Length=550

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 127/182 (70%), Gaps = 10/182 (5%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGYGVSGP  614
            ++M MQ+ FSG++Q  ASR + +PYG G A RPV  Q P QH+K  F   PGD Y  SGP
Sbjct  371  SSMPMQMSFSGISQPGASRADTLPYGYGAAGRPVPQQPPPQHIKGTFGTQPGDAYAASGP  430

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR-----P  449
            HP+  PGNAY+MYD+E    HPPQ P FPQG YPP S S  NP     +N+MVR     P
Sbjct  431  HPALHPGNAYMMYDNEARAHHPPQPPHFPQGVYPPVSVSSQNPQPTVGSNLMVRNSGQPP  490

Query  448  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
            P+      PYNE +EKL +MGYR DH++NVIQRMEESGQP+DFN++LDRLN + SGGSQ+
Sbjct  491  PRNH----PYNEWIEKLMNMGYRGDHVVNVIQRMEESGQPIDFNSLLDRLNANPSGGSQR  546

Query  268  GW  263
            GW
Sbjct  547  GW  548



>ref|XP_007198900.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
 gb|EMJ00099.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
Length=529

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 121/178 (68%), Gaps = 5/178 (3%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            ++MSMQVP+S + Q    R + MP+G   A RP+Q Q P Q LK AF A  G+GY  SGP
Sbjct  353  SSMSMQVPYSSIPQQGPGRSDAMPFGYSGAGRPIQQQPPPQQLKGAFGAQAGEGYAASGP  412

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            HP+  PG+ Y+MYD EG R H   Q   P   YPP+S S   P      N+M R PQ +R
Sbjct  413  HPALPPGSTYMMYDGEGGRTHYSAQ--VPHYGYPPTSASHQTPQPTTAPNLMARNPQFIR  470

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  263
            N P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+DRL N HSSGG Q+GW
Sbjct  471  NHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVIDRLSNVHSSGGPQRGW  527



>ref|XP_007043595.1| Structural constituent of cell wall [Theobroma cacao]
 gb|EOX99426.1| Structural constituent of cell wall [Theobroma cacao]
Length=552

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 129/182 (71%), Gaps = 9/182 (5%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            N++ MQVP+SG+ Q V+SR + +PYG G+  R   PQ P Q +K  F AP  +GY   GP
Sbjct  374  NSLPMQVPYSGVPQPVSSRADTIPYGYGLPGRTA-PQQP-QQIKGTFGAPPAEGYTAPGP  431

Query  613  HPSFAPGNAYVMYDSEGPR-GHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---  446
            HP   PG+AY+MYDSEG R  HPPQQP F QG Y P++ SL  P      NVM+R     
Sbjct  432  HPPLPPGSAYMMYDSEGGRPLHPPQQPHFSQGGYSPANVSLQTPQTGTGPNVMIRNTSHS  491

Query  445  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-  269
            Q +R+ P Y++L+EKL SMG+RVDH+ +VIQRMEESGQPVDFNAVLDRLN HSSGGSQ+ 
Sbjct  492  QFIRSHP-YSDLIEKLVSMGFRVDHVASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQRG  550

Query  268  GW  263
            GW
Sbjct  551  GW  552



>ref|XP_002517918.1| structural constituent of cell wall, putative [Ricinus communis]
 gb|EEF44436.1| structural constituent of cell wall, putative [Ricinus communis]
Length=536

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSGPH  611
            ++M MQ+ ++ + Q ++S  + +PYG G      Q     Q        PGDGY   GPH
Sbjct  357  SSMPMQLSYAAVPQPLSSGTDAIPYGYGAGRTVPQQPQAQQVKAAYGAPPGDGYATGGPH  416

Query  610  PSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQG--  440
             +  PG+AY+MYDSEG R H PPQQP F QG YPP++ SL NP     TN+M R P    
Sbjct  417  SALPPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPTNLSLQNPQSAPGTNMMARNPSHAN  476

Query  439  -MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             +RN P Y+EL++KL SMG+R +HI+ VIQRMEESGQP+DFNAVLDRL+ +SSGGSQ+GW
Sbjct  477  FVRNHP-YSELIDKLVSMGFRAEHIVGVIQRMEESGQPLDFNAVLDRLS-NSSGGSQRGW  534



>ref|XP_008229157.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X1 [Prunus mume]
Length=530

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 120/178 (67%), Gaps = 5/178 (3%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            ++MSMQVP+S + Q    R + MP+G   A RP+Q Q P Q LK AF A  G+GY  +GP
Sbjct  354  SSMSMQVPYSSIPQQGPGRSDAMPFGYSGAGRPIQQQPPPQQLKGAFGAQAGEGYAPAGP  413

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            HP   PG+ Y+MYD EG R H   Q   P   YPP+S S   P      N+M R PQ +R
Sbjct  414  HPGLPPGSTYMMYDGEGGRTHYSAQ--VPHYGYPPTSASHQTPQPTTAPNLMARNPQFIR  471

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  263
            N P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+DRL N HSSGG Q+GW
Sbjct  472  NHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVIDRLSNVHSSGGPQRGW  528



>ref|XP_008229158.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X2 [Prunus mume]
Length=529

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 120/178 (67%), Gaps = 5/178 (3%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            ++MSMQVP+S + Q    R + MP+G   A RP+Q Q P Q LK AF A  G+GY  +GP
Sbjct  353  SSMSMQVPYSSIPQQGPGRSDAMPFGYSGAGRPIQQQPPPQQLKGAFGAQAGEGYAPAGP  412

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            HP   PG+ Y+MYD EG R H   Q   P   YPP+S S   P      N+M R PQ +R
Sbjct  413  HPGLPPGSTYMMYDGEGGRTHYSAQ--VPHYGYPPTSASHQTPQPTTAPNLMARNPQFIR  470

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  263
            N P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+DRL N HSSGG Q+GW
Sbjct  471  NHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVIDRLSNVHSSGGPQRGW  527



>gb|KJB77274.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=461

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 120/178 (67%), Gaps = 12/178 (7%)
 Frame = -2

Query  778  MQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGPHPSF  602
            MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY  S  HP  
Sbjct  290  MQVPYSGVRQPLSSCVDTIPYGYGVPGR----TAP-QPIKGTFEAQPRDGYQASVSHPPL  344

Query  601  APGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMR  434
             PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R     Q +R
Sbjct  345  PPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVR  404

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  263
            N P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG+Q+ GW
Sbjct  405  NHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  461



>gb|KJB77267.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=419

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 120/178 (67%), Gaps = 12/178 (7%)
 Frame = -2

Query  778  MQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGPHPSF  602
            MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY  S  HP  
Sbjct  248  MQVPYSGVRQPLSSCVDTIPYGYGVPGR----TAP-QPIKGTFEAQPRDGYQASVSHPPL  302

Query  601  APGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMR  434
             PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R     Q +R
Sbjct  303  PPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVR  362

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  263
            N P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG+Q+ GW
Sbjct  363  NHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  419



>gb|KJB77269.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=342

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 120/178 (67%), Gaps = 12/178 (7%)
 Frame = -2

Query  778  MQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGPHPSF  602
            MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY  S  HP  
Sbjct  171  MQVPYSGVRQPLSSCVDTIPYGYGVPGR----TAP-QPIKGTFEAQPRDGYQASVSHPPL  225

Query  601  APGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMR  434
             PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R     Q +R
Sbjct  226  PPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVR  285

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  263
            N P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG+Q+ GW
Sbjct  286  NHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  342



>gb|KJB77268.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77270.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77272.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=551

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 120/178 (67%), Gaps = 12/178 (7%)
 Frame = -2

Query  778  MQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGPHPSF  602
            MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY  S  HP  
Sbjct  380  MQVPYSGVRQPLSSCVDTIPYGYGVPGRT----AP-QPIKGTFEAQPRDGYQASVSHPPL  434

Query  601  APGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMR  434
             PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R     Q +R
Sbjct  435  PPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVR  494

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  263
            N P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG+Q+ GW
Sbjct  495  NHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  551



>gb|KJB77271.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77273.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=566

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 120/178 (67%), Gaps = 12/178 (7%)
 Frame = -2

Query  778  MQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGPHPSF  602
            MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY  S  HP  
Sbjct  395  MQVPYSGVRQPLSSCVDTIPYGYGVPGRT----AP-QPIKGTFEAQPRDGYQASVSHPPL  449

Query  601  APGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMR  434
             PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R     Q +R
Sbjct  450  PPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVR  509

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  263
            N P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG+Q+ GW
Sbjct  510  NHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  566



>gb|KDP24130.1| hypothetical protein JCGZ_25787 [Jatropha curcas]
Length=532

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 122/182 (67%), Gaps = 11/182 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGYGVSGP  614
            N+M MQV ++ + Q + SR E MPYG G A R V  Q P Q +K  +    GDGY  +GP
Sbjct  354  NSMPMQVSYAAVPQPLPSRAE-MPYGYG-AGRQVPQQPPPQQIKATYGTQTGDGYATAGP  411

Query  613  HPSFAPGNAYVMYDS-EGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQG  440
             P+  PG+AY+MYDS EG R H PPQ   FPQ  YPP S SL N    A  NV+ R P  
Sbjct  412  -PALPPGSAYMMYDSSEGGRTHHPPQPSHFPQAGYPPGSLSLQNSQPAAGANVLARNPNH  470

Query  439  ---MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
               +RN P YNEL+EKL +MG+R+DH+I VIQRMEESGQPVDFNAVLDRLN H +G SQ+
Sbjct  471  SHLVRNHP-YNELIEKLVNMGFRMDHVIGVIQRMEESGQPVDFNAVLDRLNVH-NGSSQR  528

Query  268  GW  263
            GW
Sbjct  529  GW  530



>ref|XP_008337475.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Malus domestica]
Length=521

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 7/177 (4%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M MQVP+S + Q  + R + MP+G G A R +Q Q P Q +K AF A PG+GYG +GP
Sbjct  349  NSMPMQVPYSNIPQPGSGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYGAAGP  408

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            HP+F PG+ Y +YDSEG R             YPP+S S   P      NVM R PQ   
Sbjct  409  HPAFPPGSTYTVYDSEGGRTQ-----YSAHYGYPPTSISHHMPQPTTAPNVMARNPQFPG  463

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N P YNEL+EKL  MG+R DH+++VIQRMEE GQPVDFNAV+DRLN H SGG Q+GW
Sbjct  464  NHP-YNELIEKLVPMGFRSDHVVSVIQRMEEXGQPVDFNAVIDRLNAHPSGGPQRGW  519



>gb|KHG27956.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=552

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 121/178 (68%), Gaps = 12/178 (7%)
 Frame = -2

Query  778  MQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGPHPSF  602
            MQVP+SG+ Q ++SR + +PYG  V  R     AP Q +K  F A P DGY     HP  
Sbjct  381  MQVPYSGVPQPLSSRVDTIPYGYRVPGR----TAP-QPIKGTFEAQPRDGYQAPVSHPPL  435

Query  601  APGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMR  434
             PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R     Q +R
Sbjct  436  PPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVR  495

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  263
            N P Y++L+EKL SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG+Q+ GW
Sbjct  496  NHP-YSDLIEKLVSMGFRGDHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  552



>gb|KEH17617.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=527

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 122/185 (66%), Gaps = 16/185 (9%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGYGVSGP  614
            N+M MQ+P+SG+ Q  +SR + M YG G   R V  Q P Q +K +F   PGD YG SG 
Sbjct  348  NSMPMQMPYSGVPQPGSSRADSMQYGYGGTGRTVPQQPPPQQIKGSFPSQPGDVYGASGT  407

Query  613  HPSFAP--GNAYVMYDS-EGPRGH--PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRP  449
            HP+  P  GNAY+MYD  EG R H  PPQ   F Q  YP +S SL NP      N++VR 
Sbjct  408  HPALPPPPGNAYMMYDGGEGGRAHHPPPQPSHFAQSGYPQTSASLTNP------NLLVRN  461

Query  448  P---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
            P   Q +RN P YNEL+EKL +MG+R DH+ +VIQRMEESGQ +DFN+VLDRLN HSS G
Sbjct  462  PSQSQFVRNHP-YNELIEKLVNMGFRGDHVASVIQRMEESGQTIDFNSVLDRLNVHSSVG  520

Query  277  SQKGW  263
             Q+GW
Sbjct  521  PQRGW  525



>gb|KHN31988.1| hypothetical protein glysoja_025822 [Glycine soja]
Length=505

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 123/182 (68%), Gaps = 9/182 (5%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            N+M+MQ+P+SG+    +SR + +PYG G A R V  Q P Q +K +F AP  D YG SG 
Sbjct  325  NSMAMQMPYSGVPPPGSSRTDAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPADMYGPSGN  384

Query  613  HPSFAP-GNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---  446
             P+  P   AY+MYD EG R H P QP F Q  YPP+S SL NPP     N+MVR P   
Sbjct  385  LPALPPPSGAYMMYDGEGGRTHHPPQPHFAQPGYPPTSASLQNPP--PGLNLMVRNPNQS  442

Query  445  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-  269
            Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VLDRLN HSS G Q+ 
Sbjct  443  QFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVLDRLNVHSSVGPQRG  501

Query  268  GW  263
            GW
Sbjct  502  GW  503



>ref|XP_003539922.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoformX1 [Glycine max]
Length=533

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 123/182 (68%), Gaps = 9/182 (5%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            N+M+MQ+P+SG+    +SR + +PYG G A R V  Q P Q +K +F AP  D YG SG 
Sbjct  353  NSMAMQMPYSGVPPPGSSRTDAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPADMYGPSGN  412

Query  613  HPSFAP-GNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---  446
             P+  P   AY+MYD EG R H P QP F Q  YPP+S SL NPP     N+MVR P   
Sbjct  413  LPALPPPSGAYMMYDGEGGRTHHPPQPHFAQPGYPPTSASLQNPP--PGLNLMVRNPNQS  470

Query  445  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-  269
            Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VLDRLN HSS G Q+ 
Sbjct  471  QFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVLDRLNVHSSVGPQRG  529

Query  268  GW  263
            GW
Sbjct  530  GW  531



>ref|XP_006592435.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoform X2 [Glycine max]
Length=534

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 123/182 (68%), Gaps = 9/182 (5%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            N+M+MQ+P+SG+    +SR + +PYG G A R V  Q P Q +K +F AP  D YG SG 
Sbjct  354  NSMAMQMPYSGVPPPGSSRTDAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPADMYGPSGN  413

Query  613  HPSFAP-GNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---  446
             P+  P   AY+MYD EG R H P QP F Q  YPP+S SL NPP     N+MVR P   
Sbjct  414  LPALPPPSGAYMMYDGEGGRTHHPPQPHFAQPGYPPTSASLQNPP--PGLNLMVRNPNQS  471

Query  445  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-  269
            Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VLDRLN HSS G Q+ 
Sbjct  472  QFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVLDRLNVHSSVGPQRG  530

Query  268  GW  263
            GW
Sbjct  531  GW  532



>ref|XP_007132659.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
 gb|ESW04653.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
Length=541

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 124/180 (69%), Gaps = 8/180 (4%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            N+M MQ P+SG+    +SRP+ +PYG G + R V  Q P Q +K +F AP G+ YG +G 
Sbjct  364  NSMPMQGPYSGVPPPGSSRPDTIPYGYGGSGRTVPQQPPPQQMKSSFPAPPGEMYGPTGS  423

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---Q  443
              +  P +AY+MY+ EG R H P QP F Q  YPP+S SL NPP   + N+MVR P   Q
Sbjct  424  LAALPPSSAYMMYEGEGGRTHHPPQPHFTQPGYPPTSASLQNPP---SHNLMVRNPNQSQ  480

Query  442  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             +RN P Y+EL+EKL SMG+R DH+++VIQRMEESGQ +DFN+VLDRLN HSS G  +GW
Sbjct  481  FVRNHP-YSELIEKLVSMGFRGDHVMSVIQRMEESGQAIDFNSVLDRLNVHSSVGPPRGW  539



>ref|XP_009357856.1| PREDICTED: putative uncharacterized protein DDB_G0294196 [Pyrus 
x bretschneideri]
 ref|XP_009357877.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Pyrus x bretschneideri]
Length=521

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 116/177 (66%), Gaps = 7/177 (4%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M MQVP+S + Q  + R + MP+G G A R +Q Q P Q +K AF A PG+GYG +GP
Sbjct  349  NSMPMQVPYSNIPQPGSGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYGAAGP  408

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            HP+  PG+ Y++YDSEG R             YPP+S S   P      N+M R PQ   
Sbjct  409  HPALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMARNPQFPH  463

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N P YNEL+EKL  MG+R DH+++VIQRMEESGQPVDFNAV+DRLN H SG  Q+GW
Sbjct  464  NHP-YNELIEKLVPMGFRSDHVVSVIQRMEESGQPVDFNAVIDRLNAHPSGVPQRGW  519



>ref|XP_004506616.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=523

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 123/183 (67%), Gaps = 18/183 (10%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M MQ+P+SG+ Q+ +SR + M YG G A R V  Q P Q +K +F A PGD YG SG 
Sbjct  352  NSMPMQMPYSGVPQSGSSRADSMQYGYGGAGRTVPQQPPPQQIKGSFPAQPGDVYGASGT  411

Query  613  HPSFAPGNAYVMYDS-EGPRGHPPQQPI--FPQGAYPPSSFSLANPPQPANTNVMVRPP-  446
            HP+    NAY+MYD  EG R H P      F QG YPP+S SL NP      N+MVR P 
Sbjct  412  HPA----NAYMMYDGGEGGRTHHPPPQPPHFAQGGYPPTSASLQNP------NLMVRNPS  461

Query  445  --QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  272
              Q +RN P YNEL+EKL +MG+R DH+ +VIQRMEESGQ +DFN+VLDRLN H+S G Q
Sbjct  462  QSQFVRNHP-YNELIEKLVNMGFRGDHVASVIQRMEESGQTIDFNSVLDRLNVHNSVGPQ  520

Query  271  KGW  263
            +GW
Sbjct  521  RGW  523



>ref|XP_004303103.1| PREDICTED: transcriptional regulator DEF1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 121/181 (67%), Gaps = 8/181 (4%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH-LKPAFCAP-GDGYGVSG  617
            N+M MQV +S + Q  + R + MP+G   A R +  Q P Q  +K AF A  GDGY  +G
Sbjct  361  NSMPMQVSYSSVPQPGSGRSDAMPFGYSGAGRTMPQQPPPQQQIKGAFGAQQGDGYAAAG  420

Query  616  PHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPANT-NVMVRPPQ  443
            PHP+  PG+ Y+MYDSEG R  +  Q P + QG YPP+S S    PQP    + MVR PQ
Sbjct  421  PHPALPPGSTYMMYDSEGGRNPYSAQVPHYSQGGYPPASGSQT--PQPTTAPSHMVRNPQ  478

Query  442  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG-SQKG  266
             +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFNAV+DRLN HSSG   Q+G
Sbjct  479  FIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQTIDFNAVIDRLNVHSSGAPPQRG  537

Query  265  W  263
            W
Sbjct  538  W  538



>ref|XP_006582794.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Glycine max]
Length=486

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            N+M+MQ+P+SG+    ++R + +PYG G A R V  Q P Q +K +F AP G+ YG +G 
Sbjct  308  NSMAMQMPYSGVPPQGSNRADAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPGEMYGPTGS  367

Query  613  HPSFAP-GNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP--  446
             P+  P  +AY+MYD EG R H PPQ P F Q  YPP+S SL NPPQ    N+MVR P  
Sbjct  368  LPALPPPSSAYMMYDGEGGRSHHPPQPPHFAQPGYPPTSASLQNPPQ--GHNLMVRNPNQ  425

Query  445  -QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
             Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ VDFN+VLDRL+  S G  + 
Sbjct  426  SQFVRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAVDFNSVLDRLS--SVGPQRG  482

Query  268  GW  263
            GW
Sbjct  483  GW  484



>gb|KHN35253.1| hypothetical protein glysoja_042323 [Glycine soja]
Length=531

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            N+M+MQ+P+SG+    ++R + +PYG G A R V  Q P Q +K +F AP G+ YG +G 
Sbjct  353  NSMAMQMPYSGVPPQGSNRADAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPGEMYGPTGS  412

Query  613  HPSFAP-GNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP--  446
             P+  P  +AY+MYD EG R H PPQ P F Q  YPP+S SL NPPQ    N+MVR P  
Sbjct  413  LPALPPPSSAYMMYDGEGGRSHHPPQPPHFAQPGYPPTSASLQNPPQ--GHNLMVRNPNQ  470

Query  445  -QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
             Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ VDFN+VLDRL+  S G  + 
Sbjct  471  SQFVRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAVDFNSVLDRLS--SVGPQRG  527

Query  268  GW  263
            GW
Sbjct  528  GW  529



>ref|XP_006447363.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60603.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=554

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 119/186 (64%), Gaps = 20/186 (11%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCA-PGDGYGV  623
            N+  MQV ++G+ Q V++R + MPYG G   RPV  Q P      +K  + A PGDGY  
Sbjct  377  NSAPMQVQYTGVPQPVSTRADVMPYGYGAPGRPVPQQPPPLQPQPIKGNYGAQPGDGYAA  436

Query  622  SGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPAN-TNVMVR-  452
            +GP P+  PG+ Y+MYDSE  R  HPPQQ  F QG YP          QP   +N++ R 
Sbjct  437  AGPRPTLPPGSGYMMYDSESGRTPHPPQQSHFAQGGYPS---------QPTTGSNLLARN  487

Query  451  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
               PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN HSSGG
Sbjct  488  PSQPQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGG  546

Query  277  SQK-GW  263
            SQ+ GW
Sbjct  547  SQRGGW  552



>ref|XP_006447362.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60602.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=553

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 119/186 (64%), Gaps = 20/186 (11%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCA-PGDGYGV  623
            N+  MQV ++G+ Q V++R + MPYG G   RPV  Q P      +K  + A PGDGY  
Sbjct  376  NSAPMQVQYTGVPQPVSTRADVMPYGYGAPGRPVPQQPPPLQPQPIKGNYGAQPGDGYAA  435

Query  622  SGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPAN-TNVMVR-  452
            +GP P+  PG+ Y+MYDSE  R  HPPQQ  F QG YP          QP   +N++ R 
Sbjct  436  AGPRPTLPPGSGYMMYDSESGRTPHPPQQSHFAQGGYPS---------QPTTGSNLLARN  486

Query  451  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
               PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN HSSGG
Sbjct  487  PSQPQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGG  545

Query  277  SQK-GW  263
            SQ+ GW
Sbjct  546  SQRGGW  551



>ref|XP_008342910.1| PREDICTED: extensin-like isoform X1 [Malus domestica]
Length=522

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG +GP
Sbjct  350  NSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYGAAGP  409

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            HP+  PG+ Y++YDSEG R             YPP S S   P      N+M R     +
Sbjct  410  HPALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPXSISHHTPQPTTAPNLMAR---NQQ  461

Query  433  NPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNAV+DRLN H SGG Q+GW
Sbjct  462  FPPNHPYNELIEKLVPMGFRXDHVASVIQRMEESGQPIDFNAVIDRLNSHPSGGPQRGW  520



>ref|XP_008342911.1| PREDICTED: extensin-like isoform X2 [Malus domestica]
Length=521

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG +GP
Sbjct  349  NSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYGAAGP  408

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            HP+  PG+ Y++YDSEG R             YPP S S   P      N+M R     +
Sbjct  409  HPALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPXSISHHTPQPTTAPNLMAR---NQQ  460

Query  433  NPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNAV+DRLN H SGG Q+GW
Sbjct  461  FPPNHPYNELIEKLVPMGFRXDHVASVIQRMEESGQPIDFNAVIDRLNSHPSGGPQRGW  519



>gb|KDO51849.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=549

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 119/186 (64%), Gaps = 20/186 (11%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCA-PGDGYGV  623
            N+  MQV ++G+ Q V++R + MPYG G   RPV  Q P      +K  + A PGDGY  
Sbjct  372  NSAPMQVQYTGVPQPVSTRADVMPYGYGAPGRPVPQQPPPLQPQPIKGNYGAQPGDGYAA  431

Query  622  SGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPAN-TNVMVR-  452
            +GP P+  PG+ Y+MYDSE  R  HPPQQ  F QG YP          QP   +N++ R 
Sbjct  432  AGPRPTLPPGSGYMMYDSESGRTPHPPQQSHFAQGGYPS---------QPTTGSNLLARN  482

Query  451  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
               PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN HSSGG
Sbjct  483  PSQPQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGG  541

Query  277  SQK-GW  263
            SQ+ GW
Sbjct  542  SQRGGW  547



>gb|KDO51850.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=550

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 119/186 (64%), Gaps = 20/186 (11%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCA-PGDGYGV  623
            N+  MQV ++G+ Q V++R + MPYG G   RPV  Q P      +K  + A PGDGY  
Sbjct  373  NSAPMQVQYTGVPQPVSTRADVMPYGYGAPGRPVPQQPPPLQPQPIKGNYGAQPGDGYAA  432

Query  622  SGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPAN-TNVMVR-  452
            +GP P+  PG+ Y+MYDSE  R  HPPQQ  F QG YP          QP   +N++ R 
Sbjct  433  AGPRPTLPPGSGYMMYDSESGRTPHPPQQSHFAQGGYPS---------QPTTGSNLLARN  483

Query  451  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
               PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN HSSGG
Sbjct  484  PSQPQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGG  542

Query  277  SQK-GW  263
            SQ+ GW
Sbjct  543  SQRGGW  548



>ref|XP_011098021.1| PREDICTED: extensin [Sesamum indicum]
Length=525

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 116/178 (65%), Gaps = 14/178 (8%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGYGVSGP  614
            N+M MQV F G  Q  ++ PE   YG G A RP+Q Q P QHLKP +    G+GY  SGP
Sbjct  358  NSMPMQVSFVGAPQPGSTGPEAT-YGYGNAGRPIQQQPPPQHLKPGYGSQSGEGYVPSGP  416

Query  613  HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGM  437
              +  PGN Y+++D EG R H PP QP F Q AYPP        P P   N++V  P  +
Sbjct  417  RSTLPPGNTYMVFDGEGGRTHHPPPQPHFQQNAYPPQRM-----PSP---NMVV--PHSI  466

Query  436  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            R+ P YNEL+EKL  MGYR DH++ VIQR+EESGQ +DFN+VLDRLNGH SGGSQ+ W
Sbjct  467  RSHP-YNELIEKLVGMGYRGDHVVGVIQRLEESGQTIDFNSVLDRLNGHPSGGSQRVW  523



>ref|XP_002325597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99978.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=537

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 113/186 (61%), Gaps = 20/186 (11%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCAP-GDGYGV  623
            N++ MQV +SG+ Q++ASR + MPYG G     V  Q        +K  F     D Y  
Sbjct  360  NSLPMQVSYSGVPQSLASRADTMPYGYGAGRTAVPQQPRQPSPQQIKGTFGGQHSDAYAT  419

Query  622  SGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMV---  455
            +GPHP   P +AY++YD EG R H PPQQ  FPQG YPP         QPA    M+   
Sbjct  420  AGPHPGQPPVSAYMVYDGEGGRTHHPPQQSHFPQGGYPP---------QPAAGTGMLPRH  470

Query  454  -RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
              P    RN P Y++L+EKL SMG+R DH  +VIQRMEESG+PVDFNAVLDRLN  SSGG
Sbjct  471  SSPSHFFRNHP-YSDLIEKLVSMGFRGDHAASVIQRMEESGEPVDFNAVLDRLNVQSSGG  529

Query  277  SQK-GW  263
            SQ+ GW
Sbjct  530  SQRGGW  535



>ref|XP_011002849.1| PREDICTED: calcium-binding protein P-like [Populus euphratica]
Length=549

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 113/186 (61%), Gaps = 20/186 (11%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCAP-GDGYGV  623
            N++ MQV +SG+ Q++ASR + MPYG G     V  Q        +K  F     D Y  
Sbjct  372  NSLPMQVSYSGVPQSLASRADTMPYGYGAGRTAVPQQPRQPSPQQIKGTFGGQHSDAYAT  431

Query  622  SGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMV---  455
            +GPHP   P +AY++YD EG R H PPQQ  FPQG YPP         QPA    M+   
Sbjct  432  AGPHPGQPPVSAYMVYDGEGGRTHHPPQQSHFPQGGYPP---------QPAAGTSMLPRH  482

Query  454  -RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
              P    RN P Y++L+EKL SMG+R DH  +VIQRMEESG+PVDFNAVLDRLN  SSGG
Sbjct  483  SSPSHFFRNHP-YSDLIEKLVSMGFRGDHAASVIQRMEESGEPVDFNAVLDRLNVLSSGG  541

Query  277  SQK-GW  263
            SQ+ GW
Sbjct  542  SQRGGW  547



>ref|XP_009341977.1| PREDICTED: ATP-dependent helicase brm-like isoform X2 [Pyrus 
x bretschneideri]
Length=521

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 112/179 (63%), Gaps = 11/179 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG +GP
Sbjct  349  NSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYGAAGP  408

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            H +  PG+ Y++YDSEG R             YPP+S S   P      N+M R     +
Sbjct  409  HTALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMAR---NQQ  460

Query  433  NPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             PP  PYNEL+EKL  MG+R DHI +VIQRMEESGQP+DFNAV+DRLN H SG  Q+GW
Sbjct  461  FPPNHPYNELIEKLVPMGFRSDHIASVIQRMEESGQPIDFNAVIDRLNAHPSGVPQRGW  519



>ref|XP_009341976.1| PREDICTED: ATP-dependent helicase brm-like isoform X1 [Pyrus 
x bretschneideri]
Length=522

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 112/179 (63%), Gaps = 11/179 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG +GP
Sbjct  350  NSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYGAAGP  409

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            H +  PG+ Y++YDSEG R             YPP+S S   P      N+M R     +
Sbjct  410  HTALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMAR---NQQ  461

Query  433  NPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             PP  PYNEL+EKL  MG+R DHI +VIQRMEESGQP+DFNAV+DRLN H SG  Q+GW
Sbjct  462  FPPNHPYNELIEKLVPMGFRSDHIASVIQRMEESGQPIDFNAVIDRLNAHPSGVPQRGW  520



>ref|XP_009336198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Pyrus x bretschneideri]
Length=522

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 112/179 (63%), Gaps = 11/179 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG +GP
Sbjct  350  NSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYGAAGP  409

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            H +  PG+ Y++YDSEG R             YPP+S S   P      N+M R     +
Sbjct  410  HTALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMAR---NQQ  461

Query  433  NPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNAV+DRLN H SG  Q+GW
Sbjct  462  FPPNHPYNELIEKLVPMGFRSDHVASVIQRMEESGQPIDFNAVIDRLNAHPSGVPQRGW  520



>ref|XP_009336199.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 112/179 (63%), Gaps = 11/179 (6%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG +GP
Sbjct  349  NSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYGAAGP  408

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMR  434
            H +  PG+ Y++YDSEG R             YPP+S S   P      N+M R     +
Sbjct  409  HTALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMAR---NQQ  460

Query  433  NPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNAV+DRLN H SG  Q+GW
Sbjct  461  FPPNHPYNELIEKLVPMGFRSDHVASVIQRMEESGQPIDFNAVIDRLNAHPSGVPQRGW  519



>ref|XP_006376495.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|ERP54292.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=532

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 113/182 (62%), Gaps = 15/182 (8%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M MQV +SG+ Q ++S  + +PYG G     V  Q P Q +K  F A P D Y  +G 
Sbjct  358  NSMPMQVSYSGVPQPMSSCADTVPYGYGAGRAAVPQQPPPQQIKGNFGAQPSDVYATAGS  417

Query  613  HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PP  446
            HP   P +AY++YD E  R H   QQP FPQG YPP         Q A   ++ R   P 
Sbjct  418  HPGLPPVSAYMIYDGETGRTHHTSQQPHFPQGVYPPQ--------QAAGAGMLPRHSSPS  469

Query  445  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-  269
              +RN   YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL  HSSGGSQ+ 
Sbjct  470  HFVRNNF-YNDLIEKLVNMGFRGDHVVSVIQRMEEGGEPVDFNSVLDRLKVHSSGGSQRG  528

Query  268  GW  263
            GW
Sbjct  529  GW  530



>gb|EYU28592.1| hypothetical protein MIMGU_mgv1a004659mg [Erythranthe guttata]
Length=516

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 116/184 (63%), Gaps = 23/184 (13%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSG-P  614
            N+M MQV F G +Q   S    +PYG   ++RP+Q   P QHL+      GDGY  SG P
Sbjct  346  NSMPMQVSFVGASQQQPSSEAAIPYGY-TSNRPIQ-TPPPQHLR---QTAGDGYAPSGQP  400

Query  613  HPSFAPGNAYVMYDSEGPRG--HPPQ-QPIFPQG---AYPPSSFSLANPPQPANTNVMVR  452
             P+   GN+Y++YD EG RG  HPP  Q  F QG   AYPP    +  PP       MV 
Sbjct  401  RPA---GNSYMVYDGEGGRGPHHPPGPQSHFQQGVVGAYPPGPQRMPGPPN------MVV  451

Query  451  PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  272
            P   MR+ P YNEL++KL +MGYR DH++ +IQRMEESGQ +DFN+VLDRLNGHSSG SQ
Sbjct  452  PQSSMRSHP-YNELIDKLVAMGYRTDHVVGIIQRMEESGQTIDFNSVLDRLNGHSSGTSQ  510

Query  271  K-GW  263
            + GW
Sbjct  511  RGGW  514



>ref|XP_010035753.1| PREDICTED: RNA polymerase II degradation factor 1-like [Eucalyptus 
grandis]
 gb|KCW47211.1| hypothetical protein EUGRSUZ_K01026 [Eucalyptus grandis]
Length=535

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 114/181 (63%), Gaps = 6/181 (3%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M+MQ+ +SG+   V+SR + + Y  G   R  Q Q P    K  F A P + Y  +GP
Sbjct  354  NSMAMQLSYSGVPPAVSSRVDTVSYEYGGPGRMGQQQPPLPPPKGTFGAHPSETYQAAGP  413

Query  613  HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---  446
                 P + Y+MY+ +  R H  PQQ  FPQGAYPP++  + NP      N++ R P   
Sbjct  414  QSMAPPTSGYMMYEGDMARAHHQPQQVHFPQGAYPPTNLPVQNPHPAPGGNLVGRNPSHS  473

Query  445  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKG  266
            Q +RN P Y EL+EKL +MG+R DH+ +VIQR+EESGQPVDFNAVLDRLN H SG SQ+G
Sbjct  474  QFVRNHP-YGELIEKLVNMGFRGDHVASVIQRLEESGQPVDFNAVLDRLNVHPSGNSQRG  532

Query  265  W  263
            W
Sbjct  533  W  533



>gb|KCW89535.1| hypothetical protein EUGRSUZ_A01820 [Eucalyptus grandis]
Length=471

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 108/184 (59%), Gaps = 16/184 (9%)
 Frame = -2

Query  772  VPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---------LKPAFCAPGDG-YGV  623
            V +S +  T + RPE M  G G   R  Q                ++  F    +G YG 
Sbjct  288  VQYSRIPATASGRPENMAVGFGGPGRTTQQHQHQHQHQQQPPPQAIRSTFIMQNNGGYGA  347

Query  622  SGPHPSFAPGNAYVMYDSEGPR-GHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  446
             GP+PS +PGN Y++YD E  R  H PQQP  PQGAYP ++ S  N  QP    + VR P
Sbjct  348  VGPNPSMSPGNTYMVYDGESGRMHHVPQQPPLPQGAYPQTNISYQNL-QPTPPPIQVRNP  406

Query  445  ---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  275
               Q +R     NELV++L SMG+RVDH+++VIQRMEESGQPVDFN+VLDRL+G SSG  
Sbjct  407  AYPQFIRKHAD-NELVDRLVSMGFRVDHVLSVIQRMEESGQPVDFNSVLDRLSGPSSGNP  465

Query  274  QKGW  263
            Q+ W
Sbjct  466  QRAW  469



>ref|XP_010051997.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain-containing protein 
4 [Eucalyptus grandis]
Length=513

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 108/184 (59%), Gaps = 16/184 (9%)
 Frame = -2

Query  772  VPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---------LKPAFCAPGDG-YGV  623
            V +S +  T + RPE M  G G   R  Q                ++  F    +G YG 
Sbjct  330  VQYSRIPATASGRPENMAVGFGGPGRTTQQHQHQHQHQQQPPPQAIRSTFIMQNNGGYGA  389

Query  622  SGPHPSFAPGNAYVMYDSEGPR-GHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  446
             GP+PS +PGN Y++YD E  R  H PQQP  PQGAYP ++ S  N  QP    + VR P
Sbjct  390  VGPNPSMSPGNTYMVYDGESGRMHHVPQQPPLPQGAYPQTNISYQNL-QPTPPPIQVRNP  448

Query  445  ---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  275
               Q +R     NELV++L SMG+RVDH+++VIQRMEESGQPVDFN+VLDRL+G SSG  
Sbjct  449  AYPQFIRKHAD-NELVDRLVSMGFRVDHVLSVIQRMEESGQPVDFNSVLDRLSGPSSGNP  507

Query  274  QKGW  263
            Q+ W
Sbjct  508  QRAW  511



>ref|XP_011037330.1| PREDICTED: putative uncharacterized protein DDB_G0294196 isoform 
X2 [Populus euphratica]
Length=526

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 108/178 (61%), Gaps = 16/178 (9%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M MQV +SG+ Q ++SR + +PYG G     V  Q P Q +K  F A P D Y  +GP
Sbjct  358  NSMPMQVSYSGVPQPMSSRADTVPYGYGAGRAAVPQQPPPQQIKGNFGAQPSDVYATAGP  417

Query  613  HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMV----RP  449
            HP   P +AY++YD E  R H   QQP FPQG YPP         QPA    M+     P
Sbjct  418  HPGLPPVSAYMIYDGETGRTHHASQQPHFPQGVYPP---------QPAAGAGMLPRHSSP  468

Query  448  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  275
                RN   YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL   SSG S
Sbjct  469  SHFARNNF-YNDLIEKLVNMGFRGDHVVSVIQRMEEVGEPVDFNSVLDRLKVPSSGWS  525



>ref|XP_011037329.1| PREDICTED: bromodomain-containing protein 4-like isoform X1 [Populus 
euphratica]
Length=527

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 108/178 (61%), Gaps = 16/178 (9%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M MQV +SG+ Q ++SR + +PYG G     V  Q P Q +K  F A P D Y  +GP
Sbjct  359  NSMPMQVSYSGVPQPMSSRADTVPYGYGAGRAAVPQQPPPQQIKGNFGAQPSDVYATAGP  418

Query  613  HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMV----RP  449
            HP   P +AY++YD E  R H   QQP FPQG YPP         QPA    M+     P
Sbjct  419  HPGLPPVSAYMIYDGETGRTHHASQQPHFPQGVYPP---------QPAAGAGMLPRHSSP  469

Query  448  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  275
                RN   YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL   SSG S
Sbjct  470  SHFARNNF-YNDLIEKLVNMGFRGDHVVSVIQRMEEVGEPVDFNSVLDRLKVPSSGWS  526



>ref|XP_003540363.1| PREDICTED: integrator complex subunit 3 homolog isoform 1 [Glycine 
max]
 gb|KHN27890.1| hypothetical protein glysoja_007622 [Glycine soja]
Length=532

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 114/185 (62%), Gaps = 16/185 (9%)
 Frame = -2

Query  790  NNMSMQVPFSGM----TQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  626
            N++ MQ+P+SG+    + +     + MPYG   A R V  Q   QH++ +F A PGD YG
Sbjct  353  NSVPMQMPYSGIPPQGSSSGGGGSDAMPYGYSGAGRTVPQQPLLQHMRGSFSAQPGDVYG  412

Query  625  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRP  449
             SG H    P ++Y +YD E  R H PP+   + Q  YPP+S SL NP   A+ N+MV  
Sbjct  413  NSGTHTMRPPASSYNVYDGENARAHYPPEPSHYAQAGYPPTSASLHNP---ASHNLMVPS  469

Query  448  P---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
            P   Q +R+ P YN+L+EK  SMG+R +H+ ++IQRMEE+ QP+DFN+V DRLN H    
Sbjct  470  PSQSQFIRSHP-YNDLIEKFVSMGFRGNHVASIIQRMEETQQPIDFNSVHDRLNVH---N  525

Query  277  SQKGW  263
             Q+GW
Sbjct  526  PQRGW  530



>ref|XP_007149849.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
 gb|ESW21843.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
Length=513

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 107/176 (61%), Gaps = 18/176 (10%)
 Frame = -2

Query  778  MQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGPHPSF  602
            MQ+P+SG+   V+S  + +P+G     R V PQ P  H+K +F A PGD YG SG + + 
Sbjct  350  MQLPYSGIPPRVSSHADVLPHGYSGGGRTV-PQQPMLHMKGSFLAQPGDAYGTSGIYTAQ  408

Query  601  APGNAYVMYDSEGPRGHPPQQPIFP-QGAYPPSSFSLAN--PPQPANTNVMVRPPQGMRN  431
            +P +++++YD E  R H P QP    QG YPP+S SL N  P   +  N +         
Sbjct  409  SPASSFMVYDGENARSHYPSQPSHTTQGGYPPTSASLHNTAPHSQSQFNRI---------  459

Query  430  PPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
              P NEL+EK  SMG+R DH+++ IQRM+E+ QP+DFN+VLDRLN H     Q+GW
Sbjct  460  -NPNNELIEKFVSMGFRGDHVVSTIQRMQETEQPIDFNSVLDRLNVH---NLQRGW  511



>gb|KEH39132.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=480

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = -2

Query  640  GDGYGVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPANTN  464
            G+ YG SG H +  P + YVM + EG R  +PPQ   F QG YPP + SL NP   A  N
Sbjct  353  GNLYGTSGVHATPPPASVYVMNEGEGGRASYPPQPSPFAQGGYPPQNASLQNP---APHN  409

Query  463  VMVRPP--QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  290
            V +R P  Q +    PYNEL+E L SMG R D ++++IQRMEE+GQPV+FN+VLDRLN H
Sbjct  410  VTIRNPSQQKLMRSHPYNELIENLVSMGVRGDLVVSIIQRMEETGQPVNFNSVLDRLNAH  469

Query  289  SSGGSQKGW  263
            SS G Q+ W
Sbjct  470  SSLGPQREW  478



>gb|KEH39131.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=500

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = -2

Query  640  GDGYGVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPANTN  464
            G+ YG SG H +  P + YVM + EG R  +PPQ   F QG YPP + SL NP   A  N
Sbjct  373  GNLYGTSGVHATPPPASVYVMNEGEGGRASYPPQPSPFAQGGYPPQNASLQNP---APHN  429

Query  463  VMVRPP--QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  290
            V +R P  Q +    PYNEL+E L SMG R D ++++IQRMEE+GQPV+FN+VLDRLN H
Sbjct  430  VTIRNPSQQKLMRSHPYNELIENLVSMGVRGDLVVSIIQRMEETGQPVNFNSVLDRLNAH  489

Query  289  SSGGSQKGW  263
            SS G Q+ W
Sbjct  490  SSLGPQREW  498



>ref|XP_010242911.1| PREDICTED: RNA polymerase II degradation factor 1 [Nelumbo nucifera]
Length=560

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 105/193 (54%), Gaps = 18/193 (9%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSGVASRP-VQPQAPGQHLKP-------------AF  650
            +M MQVPFSG+ Q   SR E M YG   A R  VQ Q P QH                A 
Sbjct  366  SMPMQVPFSGIPQPGVSRAESMVYGYNAAGRTTVQQQPPLQHNMQQQPQPQTSQSTFGAH  425

Query  649  CAPGDG-YGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPA  473
             + G G Y  +G  P+   G   ++YD EG R      P + QG+Y P   SL NP  PA
Sbjct  426  LSSGTGAYPGAGAQPTQPQGQRSMIYDGEGGRAPHTLPPHYTQGSYTPGPVSLHNPQVPA  485

Query  472  -NTNVMVRP--PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDR  302
             ++N+M RP  P  M     Y EL+EK  SMGY  +H+ +VI R+EESGQPVDFN+VLDR
Sbjct  486  GSSNIMPRPRSPSHMMRNHVYAELIEKAVSMGYVREHVASVIHRLEESGQPVDFNSVLDR  545

Query  301  LNGHSSGGSQKGW  263
            LN   S G Q+GW
Sbjct  546  LNVQPSVGYQRGW  558



>ref|XP_008455323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Cucumis melo]
Length=542

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 106/197 (54%), Gaps = 25/197 (13%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  614
            N+M MQ+ FS + Q  +SR + +PYG   +   V  Q P   +K AF +  G+GY  SGP
Sbjct  350  NSMPMQLSFSPIPQPGSSRIDTVPYGYVGSGVTVSQQPP--QVKNAFVSQAGEGYLPSGP  407

Query  613  HPSFAPGNAYVMYDSEGPRGHPPQQPI--------------FPQGAYPPSSFSLANPPQP  476
              + + G +Y+MYD E  R                      F Q  YPP++ S+     P
Sbjct  408  QSALSSGASYMMYDRESGRPPHHPPQPQQPPHHPPQPQQSHFNQSGYPPANGSIQISQHP  467

Query  475  ANTNVMVRPPQG---MRNP---PPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNA  314
            +  +V+ R P     MRN     PY E+VEKL  MG+R DH+ +VI RMEESGQPVDFNA
Sbjct  468  SGPHVVARNPNHPHYMRNQNQNHPYGEIVEKLVGMGFRSDHVASVIHRMEESGQPVDFNA  527

Query  313  VLDRLNGHSSGGSQKGW  263
            VLD L+   SGG Q+ W
Sbjct  528  VLDGLSN--SGGPQRVW  542



>ref|XP_003543336.1| PREDICTED: RNA polymerase II degradation factor 1-like [Glycine 
max]
Length=537

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 107/189 (57%), Gaps = 20/189 (11%)
 Frame = -2

Query  790  NNMSMQVPFSGM------TQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDG  632
            N++ MQ+P+SG+          +S  + MP G   A R V  Q   Q ++ +F A P D 
Sbjct  354  NSVPMQMPYSGIPPQGSSHGGGSSSGDAMPNGYSGAGRTVPQQPLLQLMRGSFSAQPADV  413

Query  631  YGVSGP--HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNV  461
            YG SG   H +  P ++Y +YD E  R H PPQ   + Q  YPP+S S  N    A  N+
Sbjct  414  YGTSGAQSHTTRPPASSYDVYDGENARAHYPPQPSHYAQAGYPPTSASHQNH---APHNL  470

Query  460  MVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  290
            MV  P   Q +R+   YN+L+EK  SMG+R DH+ N+IQRMEE+  P+DFN+V DRL+ H
Sbjct  471  MVGSPSQSQFIRSHL-YNDLIEKFVSMGFRGDHVANIIQRMEETQLPIDFNSVHDRLDVH  529

Query  289  SSGGSQKGW  263
                 Q+GW
Sbjct  530  ---NPQRGW  535



>ref|XP_004136824.1| PREDICTED: uncharacterized protein LOC101206745 [Cucumis sativus]
 ref|XP_004155474.1| PREDICTED: uncharacterized protein LOC101231079 [Cucumis sativus]
 gb|KGN43616.1| hypothetical protein Csa_7G048000 [Cucumis sativus]
Length=515

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 102/180 (57%), Gaps = 16/180 (9%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            ++M MQ+ F  + Q  +SR +  PYG    S    PQ P Q +K A+  P G+GY     
Sbjct  348  SSMPMQMSFPSIPQPGSSRVDAGPYGYAAGSGGSAPQQPPQ-VKNAYGPPTGEGYMP---  403

Query  613  HPSFAPGNAYVMYDSEGPR--GHPPQQPIFPQGAYPPSSFSLANPPQ-PANTNVMVRPPQ  443
             P    G AY+MYD E  R   HPPQQ  F Q  YP ++     PPQ PA  +V  R P 
Sbjct  404  -PGQQSGGAYMMYDRESGRPPHHPPQQTHFNQSGYPLANAPHQVPPQAPAGPHVSARNPS  462

Query  442  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
                   ++ L+EKL  MG+R DH+ ++IQRME+SGQPVDFNAVLDRL+  S  G Q+ W
Sbjct  463  -------HSHLIEKLVGMGFRGDHVASIIQRMEDSGQPVDFNAVLDRLSSPSGPGPQRAW  515



>ref|XP_008455322.1| PREDICTED: transcription factor SPT20 homolog [Cucumis melo]
Length=514

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 102/180 (57%), Gaps = 16/180 (9%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYGVSGP  614
            ++M MQ+ F  + Q  +SR +  PYG    S    PQ P Q +K A+  P G+GY     
Sbjct  347  SSMPMQMSFPSIPQPGSSRVDAGPYGYAPGSGGSAPQQPPQ-VKNAYGPPTGEGYMP---  402

Query  613  HPSFAPGNAYVMYDSEGPR--GHPPQQPIFPQGAYPPSSFSLANPPQ-PANTNVMVRPPQ  443
             P    G AY+MYD E  R   HPPQQ  F Q  YP ++     PPQ PA  +V  R P 
Sbjct  403  -PGQQSGGAYMMYDRESGRPPHHPPQQAHFNQSGYPLANAPHQVPPQAPAGPHVSARNPS  461

Query  442  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
                   ++ L+EKL  MG+R DH+ ++IQRME+SGQPVDFNAVLDRL+  S  G Q+ W
Sbjct  462  -------HSHLIEKLVGMGFRGDHVASIIQRMEDSGQPVDFNAVLDRLSSPSGPGPQRAW  514



>ref|XP_010924426.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 isoform X2 [Elaeis guineensis]
Length=425

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 103/191 (54%), Gaps = 36/191 (19%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSG----VASRPV-------QPQAPGQHLKPAFCAP  641
            +M+MQVP++ ++Q V +RPE +P+G G    + S+P+       QPQ P    + +F  P
Sbjct  253  SMAMQVPYTTISQPVGNRPEAVPFGYGGPGSMVSQPLPQHGSQRQPQPPTS--QSSFGRP  310

Query  640  GDGYGVSGPHPSFAPGNAY---VMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--P  476
             +     GP P   P NA     MY                  +YPPS+ S A  PQ  P
Sbjct  311  LNKGAYVGPAPYTPPLNAQSYNTMY------------------SYPPSNVSPAQNPQLPP  352

Query  475  ANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  296
            +N   +  P   + +  PY E++EK  SMGY  DH  +VIQRMEESGQP+DFN++LDRLN
Sbjct  353  SNVVRVHHPGLQLMHTQPYGEMIEKAVSMGYARDHAASVIQRMEESGQPIDFNSLLDRLN  412

Query  295  GHSSGGSQKGW  263
            G + G S + W
Sbjct  413  GQAGGASSRPW  423



>gb|KHN36637.1| hypothetical protein glysoja_001368 [Glycine soja]
Length=537

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 106/189 (56%), Gaps = 20/189 (11%)
 Frame = -2

Query  790  NNMSMQVPFSGM------TQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDG  632
            N++ MQ+P+SG+          +S  + MP G   A R V  Q   Q ++ +F A P D 
Sbjct  354  NSVPMQMPYSGIPPQGSSHGGGSSSGDAMPNGYSGAGRTVPQQPLLQLMRGSFSAQPADV  413

Query  631  YGVSGP--HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNV  461
            YG SG   H +  P ++Y +YD E  R H PPQ   + Q  YPP+S S  N    A  N+
Sbjct  414  YGTSGAQSHTTRPPASSYDVYDGENARAHYPPQPSHYAQAGYPPTSASHQNH---APHNL  470

Query  460  MV---RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  290
            MV      Q +R+   YN+L+EK  SMG+R DH+ N+IQRMEE+  P+DFN+V DRL+ H
Sbjct  471  MVGSTSQSQFIRSHL-YNDLIEKFVSMGFRGDHVANIIQRMEETQLPIDFNSVNDRLDVH  529

Query  289  SSGGSQKGW  263
                 Q+GW
Sbjct  530  ---NPQRGW  535



>ref|XP_010924425.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Elaeis guineensis]
Length=517

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 103/191 (54%), Gaps = 36/191 (19%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSG----VASRPV-------QPQAPGQHLKPAFCAP  641
            +M+MQVP++ ++Q V +RPE +P+G G    + S+P+       QPQ P    + +F  P
Sbjct  345  SMAMQVPYTTISQPVGNRPEAVPFGYGGPGSMVSQPLPQHGSQRQPQPPTS--QSSFGRP  402

Query  640  GDGYGVSGPHPSFAPGNAY---VMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--P  476
             +     GP P   P NA     MY                  +YPPS+ S A  PQ  P
Sbjct  403  LNKGAYVGPAPYTPPLNAQSYNTMY------------------SYPPSNVSPAQNPQLPP  444

Query  475  ANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  296
            +N   +  P   + +  PY E++EK  SMGY  DH  +VIQRMEESGQP+DFN++LDRLN
Sbjct  445  SNVVRVHHPGLQLMHTQPYGEMIEKAVSMGYARDHAASVIQRMEESGQPIDFNSLLDRLN  504

Query  295  GHSSGGSQKGW  263
            G + G S + W
Sbjct  505  GQAGGASSRPW  515



>ref|XP_004136823.1| PREDICTED: uncharacterized protein LOC101206501 [Cucumis sativus]
 ref|XP_004155475.1| PREDICTED: uncharacterized protein LOC101231301 [Cucumis sativus]
 gb|KGN43615.1| Structural constituent of cell wall [Cucumis sativus]
Length=545

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 104/202 (51%), Gaps = 32/202 (16%)
 Frame = -2

Query  790  NNMSMQVPFSGMTQTVASRPEGMPYG---SGVASRPVQPQAPGQHLKPAFCAPGDGYGVS  620
            N+M MQ+ FS + Q  +SR + +PYG   SGV      PQ    ++  A    G+GY  S
Sbjct  350  NSMPMQLSFSPIPQPGSSRIDTVPYGYVGSGVTVSQQPPQVKNAYVSQA----GEGYLPS  405

Query  619  GPHPSFAPGNAYVMYDSEGPRGHPPQQPI---------------FPQGAYPPSSFSLANP  485
            GP  + + G +Y+MYD E  R                       F Q  Y P++ SL   
Sbjct  406  GPQSALSLGASYMMYDRESGRPQHHPPQPQQQPPHHPPQPQQSHFNQSGYSPANGSLQIS  465

Query  484  PQPANTNVMVRPPQG---MRNP-----PPYNELVEKLASMGYRVDHIINVIQRMEESGQP  329
              P+  +V+ R P     MRN       PY E+VEKL  MG+R DH+ ++I RMEESGQP
Sbjct  466  QHPSGPHVVARNPNHPHYMRNQNPNQNHPYGEIVEKLVGMGFRSDHVASIIHRMEESGQP  525

Query  328  VDFNAVLDRLNGHSSGGSQKGW  263
            VDFNAVLD L+   SGG Q+ W
Sbjct  526  VDFNAVLDGLSN--SGGPQRVW  545



>ref|XP_008798248.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 [Phoenix dactylifera]
Length=514

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 99/191 (52%), Gaps = 36/191 (19%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSG----VASRPV-------QPQAPGQHLKPAFCAP  641
            +M+MQVP++ ++Q V +RPE +P+G G      S+P+       QPQ P    + +F  P
Sbjct  342  SMAMQVPYTTISQPVGNRPEAVPFGYGGPGSTVSQPLPQHSSQRQPQPPTS--QSSFGLP  399

Query  640  GDGYGVSGPHPSFAPGNAY---VMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPAN  470
                G  GP P   P NA     MY                  +YPPS  S A  PQ  +
Sbjct  400  LHKGGYVGPAPYTPPLNAQSYNTMY------------------SYPPSIVSAAQNPQLPS  441

Query  469  TNV--MVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  296
            +NV  +  P   +    PY E++EK  SMGY  DH  + IQRM ESGQP+DFN++LDRLN
Sbjct  442  SNVGGVHHPGLQLMPAQPYGEMIEKAVSMGYARDHAASAIQRMGESGQPIDFNSLLDRLN  501

Query  295  GHSSGGSQKGW  263
            G + G S + W
Sbjct  502  GQAGGASPRIW  512



>ref|XP_008810225.1| PREDICTED: ataxin-2 homolog isoform X1 [Phoenix dactylifera]
Length=516

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 94/187 (50%), Gaps = 28/187 (15%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLK---------PAFCAPGD  635
            +M +QVP+S ++Q   SRPE + +G G  S  V P  P   L+          +F  P  
Sbjct  344  SMVVQVPYSTISQPGGSRPEAVSFGYGEPSSTVSPPMPQHSLQRQPQPPTSQSSFGPPPS  403

Query  634  GYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--PANTNV  461
              G  GP P   P N                Q       YPPS+ S A   Q  P N   
Sbjct  404  KGGYVGPAPYTPPLNV---------------QSYSTTYNYPPSNVSAAQNQQLPPGNVVG  448

Query  460  MVRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSS  284
            +  P PQ MR+ P Y E++EK  SMGY  DH+ +VIQR+ ESGQP+DFN++LD LNG  +
Sbjct  449  VHHPGPQLMRSHP-YGEMIEKAVSMGYARDHVASVIQRVGESGQPMDFNSLLDMLNGRVT  507

Query  283  GGSQKGW  263
            GGS + W
Sbjct  508  GGSTRVW  514



>ref|XP_008810226.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
 ref|XP_008810227.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
Length=493

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 94/187 (50%), Gaps = 28/187 (15%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLK---------PAFCAPGD  635
            +M +QVP+S ++Q   SRPE + +G G  S  V P  P   L+          +F  P  
Sbjct  321  SMVVQVPYSTISQPGGSRPEAVSFGYGEPSSTVSPPMPQHSLQRQPQPPTSQSSFGPPPS  380

Query  634  GYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--PANTNV  461
              G  GP P   P N                Q       YPPS+ S A   Q  P N   
Sbjct  381  KGGYVGPAPYTPPLNV---------------QSYSTTYNYPPSNVSAAQNQQLPPGNVVG  425

Query  460  MVRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSS  284
            +  P PQ MR+ P Y E++EK  SMGY  DH+ +VIQR+ ESGQP+DFN++LD LNG  +
Sbjct  426  VHHPGPQLMRSHP-YGEMIEKAVSMGYARDHVASVIQRVGESGQPMDFNSLLDMLNGRVT  484

Query  283  GGSQKGW  263
            GGS + W
Sbjct  485  GGSTRVW  491



>ref|XP_010919602.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X2 [Elaeis guineensis]
Length=488

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 99/188 (53%), Gaps = 31/188 (16%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYG----SGVASRPV-------QPQAPGQHLKPAFCAP  641
            +M+MQVP+S ++Q   SRPE +P+G    S   S+P+       QPQ P  H   +F  P
Sbjct  317  SMAMQVPYSTISQPGGSRPEAVPFGYVGSSSTVSQPMPQHSLQRQPQPPTSH--SSFGPP  374

Query  640  GDGYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNV  461
                G  GP P   P N                Q      +YPPS+ S A   Q    NV
Sbjct  375  PIKGGYVGPAPYTPPLNV---------------QSYSTTYSYPPSNASAAQNQQLPPGNV  419

Query  460  M-VRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  287
            + V P PQ +R+ P Y E++EK   MGY  +H+ +VIQRM E+GQP+DFN++LD LNG +
Sbjct  420  VGVHPGPQLVRSHP-YGEMIEKAVGMGYAREHVASVIQRMGETGQPMDFNSLLDMLNGRA  478

Query  286  SGGSQKGW  263
            +  S + W
Sbjct  479  TSASARVW  486



>ref|XP_010919593.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X1 [Elaeis guineensis]
Length=515

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 99/188 (53%), Gaps = 31/188 (16%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYG----SGVASRPV-------QPQAPGQHLKPAFCAP  641
            +M+MQVP+S ++Q   SRPE +P+G    S   S+P+       QPQ P  H   +F  P
Sbjct  344  SMAMQVPYSTISQPGGSRPEAVPFGYVGSSSTVSQPMPQHSLQRQPQPPTSH--SSFGPP  401

Query  640  GDGYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNV  461
                G  GP P   P N                Q      +YPPS+ S A   Q    NV
Sbjct  402  PIKGGYVGPAPYTPPLNV---------------QSYSTTYSYPPSNASAAQNQQLPPGNV  446

Query  460  M-VRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  287
            + V P PQ +R+ P Y E++EK   MGY  +H+ +VIQRM E+GQP+DFN++LD LNG +
Sbjct  447  VGVHPGPQLVRSHP-YGEMIEKAVGMGYAREHVASVIQRMGETGQPMDFNSLLDMLNGRA  505

Query  286  SGGSQKGW  263
            +  S + W
Sbjct  506  TSASARVW  513



>ref|XP_002869511.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45770.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  +GW
Sbjct  442  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGW  494



>ref|NP_974630.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85467.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=438

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  386  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  438



>ref|NP_194559.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36251.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAM20028.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AEE85466.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=496

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  444  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  496



>emb|CAB79632.1| predicted proline-rich protein [Arabidopsis thaliana]
Length=508

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  456  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  508



>ref|XP_009144355.1| PREDICTED: protein transport protein SEC31-like [Brassica rapa]
Length=476

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  424  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSAQSSGGPPRGW  476



>ref|XP_009137778.1| PREDICTED: basic salivary proline-rich protein 1-like [Brassica 
rapa]
 emb|CDY29896.1| BnaA03g49170D [Brassica napus]
Length=487

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH+++VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  435  YGELIEKLVSMGFRGDHVMSVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  487



>ref|XP_006283593.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
 gb|EOA16491.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
Length=497

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  444  YGELIEKLVSMGFRADHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  497



>emb|CDY14248.1| BnaA08g13790D [Brassica napus]
Length=491

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 77/152 (51%), Gaps = 24/152 (16%)
 Frame = -2

Query  685  PQAPGQHLKPAFCAPGDGYGVSGPHPSFAPGNAYVMYDS-----------EGPRGHPPQQ  539
            PQAP Q         GDGY  SGP P   PG A  MY+            +  +GH  Q 
Sbjct  353  PQAPQQTKMSYNPQTGDGYLPSGPPP---PGYASAMYEDGRMQYPPPQPQQQQQGHYMQG  409

Query  538  PIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINV  359
            P  P G Y P              + ++R          Y EL+EKL SMG+R DH++ V
Sbjct  410  P--PGGGYAPQQHQAGGGGNTGTPSPVLRSK--------YGELIEKLVSMGFRGDHVMAV  459

Query  358  IQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            IQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  460  IQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  491



>gb|KFK35898.1| hypothetical protein AALP_AA4G050800 [Arabis alpina]
Length=484

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  432  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  484



>emb|CDY67879.1| BnaC07g50480D [Brassica napus]
Length=478

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  426  YGELIEKLVSMGFRGDHVMGVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  478



>ref|XP_010540875.1| PREDICTED: extensin [Tarenaya hassleriana]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 73/143 (51%), Gaps = 35/143 (24%)
 Frame = -2

Query  676  PGQHLKPAFC-APGDGYGVSGPHPSFAPGNAYVMYDSEGPRGH----PPQQPIFPQGAYP  512
            P Q +K ++    G+GY  SG          Y MY+  G  G     PPQQ  FP G Y 
Sbjct  380  PPQQMKTSYSPQSGEGYVPSG----------YAMYEG-GEAGRMQYPPPQQTHFPPGGYA  428

Query  511  PSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQ  332
            P                     Q +R    Y EL+EKL SMG+R DH++ VIQRMEESGQ
Sbjct  429  PQQGGR----------------QFLRASSAYGELIEKLVSMGFRGDHVMAVIQRMEESGQ  472

Query  331  PVDFNAVLDRLNGHSSGGSQKGW  263
            P+DFNAVLDRL+  S    Q+GW
Sbjct  473  PIDFNAVLDRLSVQS---PQRGW  492



>emb|CDX89188.1| BnaA01g17050D [Brassica napus]
Length=470

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  433  NPPP-----YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
             PPP     Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +
Sbjct  409  TPPPVSRSKYGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSAQSSGGPPR  468

Query  268  GW  263
            GW
Sbjct  469  GW  470



>ref|XP_010438481.1| PREDICTED: formin-like protein 5 [Camelina sativa]
Length=497

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG-SQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  444  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  497



>ref|XP_010433239.1| PREDICTED: bromodomain-containing protein 4-like [Camelina sativa]
Length=494

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG-SQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  441  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  494



>ref|XP_010448000.1| PREDICTED: vacuolar protein-sorting protein BRO1-like [Camelina 
sativa]
Length=495

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG-SQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  442  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  495



>emb|CDX97433.1| BnaC08g12980D [Brassica napus]
Length=492

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  440  YGELIEKLVSMGFRGDHVMTVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  492



>gb|EPS62243.1| hypothetical protein M569_12549, partial [Genlisea aurea]
Length=512

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 97/187 (52%), Gaps = 38/187 (20%)
 Frame = -2

Query  778  MQVPFSGMTQTVASRPEGMPYGSGVASRP--------VQPQAPGQHLKPAFCAPGDGYGV  623
            +QVPFS       S  E +PY  G + +P         Q Q+  QHLK            
Sbjct  348  VQVPFS-------SGSEVIPYSYGSSGKPPVQQQQQHQQHQSLAQHLKGGGGYGDGYGIP  400

Query  622  SGPH-PSFAPGNAYVMYDSEGPRG-----HPPQQPIFPQGAYPPSSFSLANPPQPANTNV  461
            SG   P   PGN+Y+++D E  R       PP  P + Q    PS      PP PA +  
Sbjct  401  SGQQRPPPQPGNSYMVFDGETGRTTTTHLQPP--PHYQQQG--PSYL----PPPPATSFA  452

Query  460  MVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN-GHSS  284
                P+G     PYNEL+EKL  MGYR +H++ VIQR+EESGQ VDFN+VLDRLN G   
Sbjct  453  ----PRGH----PYNELIEKLIGMGYRGEHVVGVIQRLEESGQAVDFNSVLDRLNGGGGG  504

Query  283  GGSQKGW  263
            GGSQ+GW
Sbjct  505  GGSQRGW  511



>ref|XP_006412973.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
 gb|ESQ54426.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
Length=499

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  447  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSVPSSGGPPRGW  499



>emb|CDY18985.1| BnaC01g20830D [Brassica napus]
Length=479

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 5/62 (8%)
 Frame = -2

Query  433  NPPP-----YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
             PPP     Y EL+EKL SMG+R DH+I VIQRMEESGQP++FNA+LD+L+  SSGG  +
Sbjct  418  TPPPVLRTKYGELIEKLMSMGFRGDHVIAVIQRMEESGQPIEFNALLDKLSVQSSGGPPR  477

Query  268  GW  263
            GW
Sbjct  478  GW  479



>emb|CDY25250.1| BnaA02g22060D [Brassica napus]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  440  YGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  492



>ref|XP_009109102.1| PREDICTED: formin-like protein 3 [Brassica rapa]
Length=500

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  421  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  448  YGELIEKLMSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  500



>gb|EEC71500.1| hypothetical protein OsI_03777 [Oryza sativa Indica Group]
Length=595

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 93/185 (50%), Gaps = 28/185 (15%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSGVASRPV-QPQAPGQHLKP----AFCAPGDGYGV  623
            +M+MQ P++ +     SR E +PY  G    P  Q     Q L P    +F  P  G G 
Sbjct  429  SMAMQGPYNTVAPAAGSRSE-VPYSYGGPGMPPPQHNMQRQQLPPPSQGSFGPPSKG-GY  486

Query  622  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--PANTNVMVRP  449
            +GP P +AP  +   Y++                 YPPS  S A  PQ  PA  NV +  
Sbjct  487  AGP-PQYAPQGSSHGYNTAY--------------GYPPSGPSAAQAPQMPPAPGNVGMSH  531

Query  448  P---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
            P   Q MR  P Y E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN   SG 
Sbjct  532  PGSHQMMRGHP-YGEMIEKAITMGYPREQVMNVIQRMTESGQPMDFNTLLDRLNEAGSGA  590

Query  277  SQKGW  263
              + W
Sbjct  591  PPRAW  595



>ref|NP_001044280.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAD87289.1| putative calcium-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06194.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAG93651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 93/185 (50%), Gaps = 28/185 (15%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSGVASRPV-QPQAPGQHLKP----AFCAPGDGYGV  623
            +M+MQ P++ +     SR E +PY  G    P  Q     Q L P    +F  P  G G 
Sbjct  428  SMAMQGPYNTVAPAAGSRSE-VPYSYGGPGMPPPQHNMQRQQLPPPSQGSFGPPSKG-GY  485

Query  622  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--PANTNVMVRP  449
            +GP P +AP  +   Y++                 YPPS  S A  PQ  PA  NV +  
Sbjct  486  AGP-PQYAPQGSSHGYNTAY--------------GYPPSGPSAAQAPQMPPAPGNVGMSH  530

Query  448  P---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
            P   Q MR  P Y E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN   SG 
Sbjct  531  PGSHQMMRGHP-YGEMIEKAITMGYPREQVMNVIQRMTESGQPMDFNTLLDRLNEAGSGA  589

Query  277  SQKGW  263
              + W
Sbjct  590  PPRAW  594



>dbj|BAK01177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = -2

Query  565  GPRGHPPQQPIFPQGAYPPSSFSLANPPQ--PANTNVMVRPP--QGMRNPPPYNELVEKL  398
             P+GHP      P G YPPS  S A  PQ  P    V    P    M    PY +++EK 
Sbjct  499  APQGHPQGYNNTPYGGYPPSGPSAAQAPQMPPGGGGVSHPGPSHHHMMRGHPYGDMIEKA  558

Query  397  ASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             +MGY  D ++NVIQRM ESGQ +DFNA+LDRLN   SG   + W
Sbjct  559  ITMGYPRDQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRAW  603



>ref|XP_006644724.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Oryza brachyantha]
Length=587

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  448  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
            P  M    PY E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN   SG   +
Sbjct  526  PHQMMRGHPYGEMIEKAITMGYPREQVLNVIQRMTESGQPMDFNTLLDRLNEAGSGAHPR  585

Query  268  GW  263
             W
Sbjct  586  AW  587



>ref|XP_006644725.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Oryza brachyantha]
Length=586

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  448  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  269
            P  M    PY E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN   SG   +
Sbjct  525  PHQMMRGHPYGEMIEKAITMGYPREQVLNVIQRMTESGQPMDFNTLLDRLNEAGSGAHPR  584

Query  268  GW  263
             W
Sbjct  585  AW  586



>emb|CDM84126.1| unnamed protein product [Triticum aestivum]
Length=603

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -2

Query  565  GPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP----QGMRNPPPYNELVEKL  398
             P+GHP Q      G YPP+  S A  PQ     V V  P      M    PY +++EK 
Sbjct  500  APQGHP-QGYNTSYGGYPPNDPSAAQAPQMPPGGVGVSHPGSSHHHMMRGHPYGDMIEKA  558

Query  397  ASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             +MGY  D ++NVIQRM +SGQ +DFNA+LDRLN   SG   + W
Sbjct  559  ITMGYPRDQVLNVIQRMTDSGQQIDFNALLDRLNESGSGAPPRPW  603



>ref|XP_008655245.1| PREDICTED: uncharacterized protein LOC100383096 isoform X1 [Zea 
mays]
 gb|AFW85062.1| putative DUF1421 domain family protein [Zea mays]
Length=584

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 84/172 (49%), Gaps = 8/172 (5%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSGVASRPV-QPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N++MQ  ++    + A+RPE +PY  G A  P+ Q Q   QH       P    G  GP 
Sbjct  413  NVAMQGSYNTAVPSGANRPE-LPYSYGGAGIPLSQSQPLPQHNMQRHQLPPSSQGSFGPP  471

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ-PANTNVMVRPPQGMR  434
            PS     +Y       P+G+P  Q      AYPP+      P Q P     M  P   M 
Sbjct  472  PS---KGSYAGSPQYAPQGNP--QGYSTGYAYPPNGPPAVQPQQMPPGGVGMSHPASHMM  526

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
               PY E++EK  +MGY  D ++NV QRM ESGQ +DFN +LDRLN   SG 
Sbjct  527  RGHPYGEMMEKAITMGYPRDQVLNVTQRMAESGQSMDFNTLLDRLNEAGSGA  578



>gb|EMT05386.1| hypothetical protein F775_26441 [Aegilops tauschii]
Length=606

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 56/105 (53%), Gaps = 4/105 (4%)
 Frame = -2

Query  565  GPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP----QGMRNPPPYNELVEKL  398
             P+GHP        G YPP+  S A  PQ       V  P      M    PY +++EK 
Sbjct  502  APQGHPQGGYNTSYGGYPPNGPSAAQAPQMPPGGAGVSHPGSSHHHMMRGHPYGDMIEKA  561

Query  397  ASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
             +MGY  D ++NVIQRM ESGQ +DFNA+LDRLN   SG   + W
Sbjct  562  NTMGYPRDQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRPW  606



>ref|NP_001169238.1| uncharacterized protein LOC100383096 [Zea mays]
 gb|ACN32051.1| unknown [Zea mays]
Length=507

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 84/172 (49%), Gaps = 8/172 (5%)
 Frame = -2

Query  787  NMSMQVPFSGMTQTVASRPEGMPYGSGVASRPV-QPQAPGQHLKPAFCAPGDGYGVSGPH  611
            N++MQ  ++    + A+RPE +PY  G A  P+ Q Q   QH       P    G  GP 
Sbjct  336  NVAMQGSYNTAVPSGANRPE-LPYSYGGAGIPLSQSQPLPQHNMQRHQLPPSSQGSFGPP  394

Query  610  PSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ-PANTNVMVRPPQGMR  434
            PS     +Y       P+G+P  Q      AYPP+      P Q P     M  P   M 
Sbjct  395  PS---KGSYAGSPQYAPQGNP--QGYSTGYAYPPNGPPAVQPQQMPPGGVGMSHPASHMM  449

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  278
               PY E++EK  +MGY  D ++NV QRM ESGQ +DFN +LDRLN   SG 
Sbjct  450  RGHPYGEMMEKAITMGYPRDQVLNVTQRMAESGQSMDFNTLLDRLNEAGSGA  501



>ref|XP_004969990.1| PREDICTED: trithorax group protein osa-like [Setaria italica]
Length=590

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            PY E++EK  +MGY  + ++NV QRM ESGQP+DFN +LDRLN   SG   + W
Sbjct  537  PYGEMIEKAITMGYPREQVLNVTQRMAESGQPMDFNTLLDRLNEAGSGAPPRAW  590



>ref|XP_009395702.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=581

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  439  MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            MRN P Y +++EK   MGY  + +++++QRM E+GQP+DFN++LDRLNG ++G + + W
Sbjct  524  MRNHP-YGDMIEKAIGMGYDGNQVMSLVQRMAETGQPMDFNSLLDRLNGQAAGATPRAW  581



>gb|EMS50510.1| hypothetical protein TRIUR3_23019 [Triticum urartu]
Length=606

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            PY +++EK  +MGY  + ++NVIQRM ESGQ +DFNA+LDRLN   SG   + W
Sbjct  553  PYGDMIEKAITMGYPREQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRPW  606



>ref|XP_002458505.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
 gb|EES03625.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
Length=587

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  520  AYPPSSFSLANPPQ-PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRME  344
            AYPPS      P Q P     M  P   M    PY E++EK  +MGY  D ++NV QRM 
Sbjct  500  AYPPSGPPAVQPQQMPPGGVGMSHPGSHMMRGHPYGEMMEKAITMGYPRDQVLNVTQRMA  559

Query  343  ESGQPVDFNAVLDRLNGHSSGG  278
            ESGQP+DFN +LDRLN   SG 
Sbjct  560  ESGQPMDFNTLLDRLNEAGSGA  581



>ref|XP_009396506.1| PREDICTED: pinin-like [Musa acuminata subsp. malaccensis]
Length=512

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = -2

Query  523  GAYPPSS-FSLANPPQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQ  353
             +YPP++ F +A   Q  P+N+  +    +  RN   Y E++EK   MGY  + II  +Q
Sbjct  424  SSYPPNNNFPVARNQQIPPSNSAALPYDSRLTRNHS-YGEMIEKAVGMGYDRNQIIGAVQ  482

Query  352  RMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            RM ESGQP+DF+++LDRLNG ++    + W
Sbjct  483  RMVESGQPMDFHSLLDRLNGQAAAAPARAW  512



>ref|XP_008795992.1| PREDICTED: protein transport protein SEC31-like [Phoenix dactylifera]
Length=553

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  436  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            +N  P +++VEK+A+MG+  D +   ++++ ESGQ VD N VLD+L        QKGW
Sbjct  493  KNRLPIDDVVEKVATMGFSRDQVRATVRKLTESGQSVDLNVVLDKLMNDEEIQPQKGW  550



>gb|KEH24794.1| DNA-binding protein, putative [Medicago truncatula]
Length=565

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS---QKGW  263
            N  P +++VEK+A+MG+  DH+   ++++ E+GQ VD N VLD+L     GG    Q+GW
Sbjct  503  NRVPVDDIVEKVATMGFPRDHVRATVRKLTENGQAVDLNTVLDKLMNEGGGGDMQQQRGW  562



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  436  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            +N  P +++VEK+A+MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  489  KNRLPIDDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  546



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++VEK+A+MG+  + +   ++R+ E+GQ VD N VLD+L   S    QKGW
Sbjct  517  PVDDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMNDSDVQPQKGW  570



>ref|XP_001784568.1| predicted protein [Physcomitrella patens]
 gb|EDQ50633.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (54%), Gaps = 18/125 (14%)
 Frame = -2

Query  592  NAYVMYDSEGPRGH----PPQ----QPIFP-QGAYPPSSFSLANPPQPANTNVMVRPPQG  440
             AY   D +GP+G+    PPQ    QP  P  G YP      A   QP++ +     P  
Sbjct  254  QAYPSQDRDGPQGYNQYAPPQYRMAQPGSPASGGYP--QLPTARSIQPSSLSTGGTAPVA  311

Query  439  MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQ---  272
              N    +E+++K+ASMG+  D +  +++++ E+G  VD N VLD+L NG SSGG++   
Sbjct  312  A-NRVSIDEVIDKVASMGFGRDQVRAIVRKLMENGTTVDLNVVLDKLMNGDSSGGNEGQQ  370

Query  271  --KGW  263
              KGW
Sbjct  371  PAKGW  375



>ref|XP_008801947.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Phoenix 
dactylifera]
Length=539

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++V+K+A+MG+  D +   ++R+ E+GQ VD N VLD+L        QKGW
Sbjct  480  NRMPIDDVVDKVATMGFSRDQVRAAVRRLTENGQSVDLNVVLDKLMNDGEIQPQKGW  536



>emb|CAJ44247.1| hypothetical protein [Cocos nucifera]
Length=120

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  56   NRMPIDDVVDKVVTMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  112



>ref|XP_006446566.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
 gb|ESR59806.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
Length=574

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V+K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  518  PIDDVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  571



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  263
            N  P +++V+K+A+MG+  + +   ++++ ESGQ VD N VLD+L NG S    Q+GW
Sbjct  435  NRVPIDDVVDKVATMGFSREEVRAAVRQLTESGQNVDLNVVLDKLMNGSSDAQPQRGW  492



>ref|XP_006470271.1| PREDICTED: COPII coat assembly protein sec16-like [Citrus sinensis]
Length=574

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++V+K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  515  NRVPIDDVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  571



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  442  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            G  N  P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L     G +Q+GW
Sbjct  481  GSGNRVPIDDVVDKVTNMGFPRDQVRATVRKLTENGQSVDLNIVLDKLMNDGDGQAQRGW  540



>ref|XP_001770189.1| predicted protein [Physcomitrella patens]
 gb|EDQ65023.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 6/60 (10%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQ-----KGW  263
            P +E+++K+ASMG+  D +   ++++ E+G  VD N VLD+L NG SSG ++     KGW
Sbjct  341  PVDEVIDKVASMGFGRDQVRATVRKLTENGTSVDLNVVLDKLMNGDSSGRNESQQPAKGW  400



>gb|KDO55180.1| hypothetical protein CISIN_1g0084162mg, partial [Citrus sinensis]
Length=462

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  406  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  459



>ref|XP_002300038.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
 gb|EEE84843.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
Length=337

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V+K+ SMG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  281  PLDDVVDKVTSMGFPREHVEATVRKLTENGQSVDLNIVLDKLMNDGDVQPQRGW  334



>ref|XP_001758183.1| predicted protein [Physcomitrella patens]
 gb|EDQ77005.1| predicted protein [Physcomitrella patens]
Length=437

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 5/55 (9%)
 Frame = -2

Query  418  NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQ--KGW  263
            +E+++K+A MG+  D +  V++R+ E+GQ VD N VLD+L NG   GG+Q  KGW
Sbjct  381  DEVIDKVAVMGFSKDQVRAVVRRLTENGQSVDLNVVLDKLMNG--DGGAQPPKGW  433



>gb|KDO55178.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=564

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  508  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  561



>gb|KDO55179.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=566

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  510  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  563



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L     G   +GW
Sbjct  532  NRVPIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNEGEGQLPRGW  588



>ref|XP_009388841.1| PREDICTED: bromodomain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  418  NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            +++VEK+A+MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  484  DDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  535



>ref|NP_001042136.2| Os01g0169900 [Oryza sativa Japonica Group]
 dbj|BAD68319.1| vegetative cell wall protein gp1 -like [Oryza sativa Japonica 
Group]
 gb|EAY72703.1| hypothetical protein OsI_00570 [Oryza sativa Indica Group]
 gb|EAZ10703.1| hypothetical protein OsJ_00537 [Oryza sativa Japonica Group]
 dbj|BAH00414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04050.2| Os01g0169900 [Oryza sativa Japonica Group]
Length=580

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  263
            P +++VEK+A+MG+  + +   ++R+ E+GQ VD N VLD+L N       QKGW
Sbjct  523  PVDDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMNDSDVQQPQKGW  577



>ref|XP_002440684.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
 gb|EES19114.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
Length=582

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P ++++EK+A+MG+  + +   ++++ E+GQ VD N VLD+L   +    Q+ W
Sbjct  526  PIDDVIEKVATMGFSKEQVRATVRKLTENGQNVDLNVVLDKLMNDTDAQPQRSW  579



>ref|XP_011047322.1| PREDICTED: vacuolar protein sorting-associated protein 37C [Populus 
euphratica]
Length=552

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V+K+ +MG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  496  PLDDVVDKVTTMGFPREHVEATVRKLTENGQSVDLNVVLDKLMNDGDVQPQRGW  549



>ref|XP_007031556.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
 gb|EOY02482.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
Length=541

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++++K+ SMG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  482  NRVPVDDVIDKVTSMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSEVQPPRGW  538



>ref|XP_006833453.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
 gb|ERM98731.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
Length=695

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  496  NRVPIDDVVDKVTNMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  552



>gb|KHG02060.1| Myosin-2 [Gossypium arboreum]
Length=542

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  483  NRVPIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSDVQPPRGW  539



>gb|KJB75894.1| hypothetical protein B456_012G063600 [Gossypium raimondii]
Length=622

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  563  NRVPIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSDVQPPRGW  619



>ref|XP_002524656.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF37675.1| DNA binding protein, putative [Ricinus communis]
Length=568

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++V+K+++MG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  509  NRVPIDDVVDKVSNMGFPREHVRATVRKLTENGQAVDLNTVLDKLMNDGEVQPQRGW  565



>ref|XP_009611187.1| PREDICTED: transcriptional regulator DEF1 isoform X1 [Nicotiana 
tomentosiformis]
Length=551

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V+K+ +MG+  D +   ++R+ ESGQ VD N VLD+L         +GW
Sbjct  495  PIDDVVDKVTNMGFSRDQVRETVRRLTESGQAVDLNTVLDKLMNDGDVQPPRGW  548



>ref|XP_009611188.1| PREDICTED: transcriptional regulator DEF1 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V+K+ +MG+  D +   ++R+ ESGQ VD N VLD+L         +GW
Sbjct  489  PIDDVVDKVTNMGFSRDQVRETVRRLTESGQAVDLNTVLDKLMNDGDVQPPRGW  542



>gb|KHG20812.1| Actin cytoskeleton-regulatory complex PAN1 [Gossypium arboreum]
Length=566

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            N  P +++V+K+ SMG+  DH+   ++++ E+GQ VD N VLD+L   S     + W
Sbjct  507  NRVPIDDVVDKVTSMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSDIQPPRAW  563



>gb|ADE75761.1| unknown [Picea sitchensis]
Length=534

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  433  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            NP   +E+++K+++MG+    +   +QR+ E GQ +D N VLD+L    +   QK W
Sbjct  475  NPVAIDEVIDKVSAMGFSRGQVTATVQRLMEKGQQIDLNIVLDKLMNDGAIQPQKDW  531



>gb|KDP45326.1| hypothetical protein JCGZ_09575 [Jatropha curcas]
Length=579

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  424  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  263
            P +++V+K+ +MG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  523  PIDDVVDKVTNMGFPREHVRATVRKLTENGQQVDLNIVLDKLMNDGEVQPQRGW  576



>ref|XP_004489226.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Cicer arietinum]
Length=550

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -2

Query  418  NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  263
            +++V+K+A+MG+  DH+   ++++ E+GQ VD N VLD+L N       Q+GW
Sbjct  495  DDVVDKVATMGFPRDHVRATVRKLTENGQSVDLNTVLDKLMNEGGEIQQQRGW  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195