BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049B02

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB61693.1|  hypothetical protein B456_009G374900                    120   2e-39   Gossypium raimondii
gb|KJB61692.1|  hypothetical protein B456_009G374900                    120   2e-39   Gossypium raimondii
gb|KJB61696.1|  hypothetical protein B456_009G374900                    120   3e-39   Gossypium raimondii
ref|XP_002514810.1|  ATP binding protein, putative                      118   3e-39   
ref|XP_011466081.1|  PREDICTED: endoribonuclease Dicer homolog 2        112   4e-38   Fragaria vesca subsp. vesca
ref|XP_007029209.1|  Dicer-like protein isoform 2                       106   1e-37   
ref|XP_007208392.1|  hypothetical protein PRUPE_ppa000240mg             109   1e-37   
ref|XP_007029213.1|  Dicer-like protein isoform 6                       106   1e-37   
ref|XP_007029208.1|  Dicer-like protein isoform 1                       106   1e-37   
ref|XP_007029210.1|  Dicer-like protein isoform 3                       106   1e-37   
ref|XP_007029212.1|  Dicer-like protein isoform 5                       105   2e-37   
ref|XP_009361581.1|  PREDICTED: endoribonuclease Dicer homolog 2        114   2e-37   
ref|XP_008370841.1|  PREDICTED: endoribonuclease Dicer homolog 2        114   2e-37   
ref|XP_006480493.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    111   4e-37   Citrus sinensis [apfelsine]
ref|XP_006428679.1|  hypothetical protein CICLE_v10010912mg             111   4e-37   Citrus clementina [clementine]
gb|KHG30499.1|  hypothetical protein F383_12835                         112   4e-37   Gossypium arboreum [tree cotton]
gb|KHG30500.1|  hypothetical protein F383_12835                         112   5e-37   Gossypium arboreum [tree cotton]
ref|XP_008218472.1|  PREDICTED: endoribonuclease Dicer homolog 2        105   5e-37   Prunus mume [ume]
ref|XP_009340367.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    112   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_010101236.1|  Endoribonuclease Dicer-2-like protein              106   1e-36   
gb|KJB14793.1|  hypothetical protein B456_002G143000                    110   1e-36   Gossypium raimondii
ref|XP_008240740.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    106   6e-36   Prunus mume [ume]
ref|XP_002312197.1|  hypothetical protein POPTR_0008s07580g             105   8e-36   
gb|KDP26899.1|  hypothetical protein JCGZ_18057                         104   2e-35   Jatropha curcas
ref|XP_011006570.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    107   4e-35   Populus euphratica
gb|KDO45678.1|  hypothetical protein CISIN_1g0030622mg                  103   7e-35   Citrus sinensis [apfelsine]
ref|XP_006480488.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    103   8e-35   
ref|XP_006428678.1|  hypothetical protein CICLE_v10010911mg             103   8e-35   Citrus clementina [clementine]
ref|XP_006480490.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    103   9e-35   Citrus sinensis [apfelsine]
gb|AFD22619.1|  dicer-like 2 protein                                  99.4    2e-34   Nicotiana attenuata
ref|XP_008240779.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    105   3e-34   Prunus mume [ume]
ref|XP_009625898.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    100   3e-34   
ref|XP_011015068.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    100   9e-34   Populus euphratica
ref|XP_010038609.1|  PREDICTED: endoribonuclease Dicer homolog 2        100   1e-33   Eucalyptus grandis [rose gum]
gb|KCW84635.1|  hypothetical protein EUGRSUZ_B01461                     100   1e-33   Eucalyptus grandis [rose gum]
ref|XP_009783913.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  98.6    1e-33   Nicotiana sylvestris
emb|CDP04170.1|  unnamed protein product                                103   1e-33   Coffea canephora [robusta coffee]
ref|XP_011015091.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  99.0    2e-33   Populus euphratica
ref|XP_011015099.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  99.0    2e-33   Populus euphratica
ref|XP_011084676.1|  PREDICTED: endoribonuclease Dicer homolog 2        110   2e-33   Sesamum indicum [beniseed]
ref|XP_007217819.1|  hypothetical protein PRUPE_ppa027063mg             103   4e-33   
ref|XP_007216887.1|  hypothetical protein PRUPE_ppa020875mg             105   6e-33   
ref|XP_002315119.1|  hypothetical protein POPTR_0010s18870g           98.2    1e-32   
ref|XP_010312608.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  94.7    1e-32   
ref|XP_010673887.1|  PREDICTED: endoribonuclease Dicer homolog 2      98.2    2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004303843.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  94.4    2e-32   Fragaria vesca subsp. vesca
ref|XP_010649216.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  97.1    3e-32   Vitis vinifera
ref|XP_010649214.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  97.1    3e-32   Vitis vinifera
ref|XP_010649215.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  96.7    3e-32   Vitis vinifera
ref|XP_010649218.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  96.3    3e-32   Vitis vinifera
emb|CBI17597.3|  unnamed protein product                              96.3    4e-32   Vitis vinifera
ref|XP_010312606.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  96.7    4e-32   Solanum lycopersicum
gb|EYU39730.1|  hypothetical protein MIMGU_mgv1a0003142mg             97.4    5e-32   Erythranthe guttata [common monkey flower]
ref|XP_010312607.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  96.7    5e-32   
emb|CAN77284.1|  hypothetical protein VITISV_043738                   97.1    5e-32   Vitis vinifera
gb|KEH42074.1|  endoribonuclease dicer-like protein                   96.7    8e-32   Medicago truncatula
ref|XP_010312604.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  95.1    1e-31   Solanum lycopersicum
ref|XP_010249398.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    102   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010249397.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    102   6e-31   Nelumbo nucifera [Indian lotus]
ref|XP_004486471.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  94.7    6e-31   Cicer arietinum [garbanzo]
emb|CDP06207.1|  unnamed protein product                              95.1    1e-30   Coffea canephora [robusta coffee]
ref|XP_007147466.1|  hypothetical protein PHAVU_006G127100g           94.4    2e-30   Phaseolus vulgaris [French bean]
ref|XP_007140643.1|  hypothetical protein PHAVU_008G129500g           92.0    3e-30   Phaseolus vulgaris [French bean]
ref|XP_006300010.1|  hypothetical protein CARUB_v10016233mg           90.1    1e-29   
ref|XP_006586847.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  94.7    2e-29   Glycine max [soybeans]
gb|KHN23014.1|  Endoribonuclease Dicer like 2                         94.7    2e-29   Glycine soja [wild soybean]
ref|XP_003534774.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  94.4    2e-29   Glycine max [soybeans]
ref|XP_006586846.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  94.7    2e-29   Glycine max [soybeans]
emb|CDP20270.1|  unnamed protein product                              86.3    1e-28   Coffea canephora [robusta coffee]
ref|XP_010508928.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  85.9    2e-28   
emb|CDO96787.1|  unnamed protein product                              85.9    2e-28   Coffea canephora [robusta coffee]
ref|XP_010508629.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  85.5    2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010508779.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  85.5    2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003535104.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  92.4    3e-28   Glycine max [soybeans]
ref|XP_010549776.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  90.9    6e-28   Tarenaya hassleriana [spider flower]
ref|XP_007216896.1|  hypothetical protein PRUPE_ppa019601mg           86.7    6e-28   
ref|XP_006604892.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  96.7    6e-28   Glycine max [soybeans]
ref|XP_003553782.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  96.7    7e-28   Glycine max [soybeans]
ref|XP_010549772.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  90.9    7e-28   Tarenaya hassleriana [spider flower]
ref|XP_003594551.1|  Endoribonuclease Dicer                           91.7    8e-28   
gb|KHN43108.1|  Endoribonuclease Dicer like 2                         96.3    9e-28   Glycine soja [wild soybean]
gb|AES64802.2|  endoribonuclease dicer-like protein                   91.3    1e-27   Medicago truncatula
ref|XP_002884369.1|  hypothetical protein ARALYDRAFT_317213           79.7    1e-27   
ref|XP_009348590.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  93.6    1e-27   Pyrus x bretschneideri [bai li]
ref|XP_007029214.1|  Dicer-like protein isoform 7                     77.8    1e-27   
ref|XP_007147294.1|  hypothetical protein PHAVU_006G111800g           89.4    1e-27   Phaseolus vulgaris [French bean]
emb|CDO96789.1|  unnamed protein product                              78.2    1e-27   Coffea canephora [robusta coffee]
ref|XP_010485666.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  85.9    2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010485668.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  85.9    2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010485670.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  85.9    2e-27   Camelina sativa [gold-of-pleasure]
gb|AAF26098.1|AC012328_1  unknown protein                             80.9    2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078101.1|  endoribonuclease Dicer-like 2                    80.5    2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABF19798.1|  dicer-like 2 spliceform 2                             80.5    2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844770.1|  hypothetical protein AMTR_s00016p00258500        83.6    2e-27   
ref|NP_566199.4|  endoribonuclease Dicer-like 2                       79.7    3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABF19797.1|  dicer-like 2 spliceform 1                             79.7    4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373030.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  91.7    5e-27   
ref|XP_006408318.1|  hypothetical protein EUTSA_v10019898mg           83.6    9e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010088523.1|  Endoribonuclease Dicer-2-like protein            87.0    9e-27   
ref|XP_007147469.1|  hypothetical protein PHAVU_006G127200g           96.7    1e-26   Phaseolus vulgaris [French bean]
emb|CDO96788.1|  unnamed protein product                              80.1    2e-26   Coffea canephora [robusta coffee]
ref|XP_010233057.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  82.8    3e-26   
ref|XP_010233062.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  81.6    5e-26   
emb|CDY43132.1|  BnaA05g32540D                                        84.3    1e-25   Brassica napus [oilseed rape]
ref|XP_009130358.1|  PREDICTED: endoribonuclease Dicer homolog 2      84.3    1e-25   
ref|NP_001131630.1|  uncharacterized protein LOC100192986             73.2    4e-25   
emb|CDY50692.1|  BnaC05g47910D                                        82.8    5e-25   Brassica napus [oilseed rape]
gb|ACE60552.1|  dicer-like protein 2                                  82.4    5e-25   Brassica rapa
gb|AFW68290.1|  hypothetical protein ZEAMMB73_539070                  72.8    8e-25   
ref|XP_008681082.1|  PREDICTED: uncharacterized protein LOC100192...  72.4    9e-25   Zea mays [maize]
ref|XP_008681081.1|  PREDICTED: uncharacterized protein LOC100192...  72.4    9e-25   
ref|XP_004982513.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  72.0    2e-24   Setaria italica
ref|XP_002464290.1|  hypothetical protein SORBIDRAFT_01g015670        70.9    2e-24   
ref|XP_010229604.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  77.8    3e-24   
gb|EMS67761.1|  Endoribonuclease Dicer-like protein 2a                74.3    2e-22   Triticum urartu
gb|ABK24820.1|  unknown                                               77.0    3e-22   Picea sitchensis
ref|XP_006651573.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  70.5    6e-22   Oryza brachyantha
ref|XP_004157159.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  95.1    1e-20   
ref|XP_004982511.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  75.1    3e-20   Setaria italica
ref|XP_004982510.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  75.1    3e-20   Setaria italica
ref|XP_004982509.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  75.1    3e-20   Setaria italica
gb|EEC75643.1|  hypothetical protein OsI_12390                        67.0    4e-20   Oryza sativa Indica Group [Indian rice]
ref|NP_001050564.1|  Os03g0583900                                     67.0    4e-20   
gb|AAS07189.1|  putative ribonuclease III, 5'-partial (with alter...  66.2    6e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ27614.1|  hypothetical protein OsJ_11558                        65.1    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644680.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.9    1e-18   Zea mays [maize]
ref|XP_004139098.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  95.9    1e-18   Cucumis sativus [cucumbers]
gb|AFD22618.1|  dicer-like 1 protein                                  74.3    2e-18   Nicotiana attenuata
gb|AFW68291.1|  hypothetical protein ZEAMMB73_565304                  65.1    2e-18   
ref|XP_008644678.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.1    2e-18   Zea mays [maize]
ref|XP_008644679.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.1    2e-18   Zea mays [maize]
ref|XP_008644683.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.1    3e-18   
ref|XP_008644682.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.1    3e-18   
ref|XP_008644676.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  65.1    3e-18   Zea mays [maize]
ref|XP_008644677.1|  PREDICTED: uncharacterized protein LOC103626...  64.3    3e-18   Zea mays [maize]
ref|XP_003546271.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  91.3    3e-18   Glycine max [soybeans]
ref|XP_008783544.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  70.9    5e-18   Phoenix dactylifera
ref|XP_008443670.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  93.6    7e-18   Cucumis melo [Oriental melon]
ref|XP_008443675.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  93.6    7e-18   
ref|XP_008443676.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  93.6    7e-18   Cucumis melo [Oriental melon]
ref|XP_008443674.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  93.6    8e-18   Cucumis melo [Oriental melon]
gb|AIO05700.1|  putative endoribonuclease dicer-like protein 1        70.1    8e-18   Cocos nucifera
gb|EYU35897.1|  hypothetical protein MIMGU_mgv1a000073mg              68.6    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_010934026.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  70.5    1e-17   
ref|XP_010934025.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  70.1    1e-17   Elaeis guineensis
gb|EEE59414.1|  hypothetical protein OsJ_11564                        63.5    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010229289.1|  PREDICTED: endoribonuclease Dicer homolog 1      68.9    1e-17   Brachypodium distachyon [annual false brome]
dbj|BAD34005.1|  CAF protein-like                                     63.9    1e-17   Oryza sativa Japonica Group [Japonica rice]
sp|Q69LX2.2|DCL2B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...  63.5    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985932.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  70.5    1e-17   Setaria italica
gb|EAY88320.1|  hypothetical protein OsI_09779                        70.5    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_006650986.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  70.5    2e-17   
gb|EAZ25399.1|  hypothetical protein OsJ_09217                        70.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
sp|Q8LMR2.1|DCL1_ORYSJ  RecName: Full=Endoribonuclease Dicer homo...  70.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EMS58929.1|  Endoribonuclease Dicer-like protein 1                 68.6    3e-17   Triticum urartu
gb|EMT07624.1|  Endoribonuclease Dicer-1-like protein                 68.6    3e-17   
tpg|DAA43005.1|  TPA: hypothetical protein ZEAMMB73_941906            69.3    3e-17   
ref|XP_009794783.1|  PREDICTED: endoribonuclease Dicer homolog 1      68.9    4e-17   Nicotiana sylvestris
gb|KFK42493.1|  hypothetical protein AALP_AA1G000600                  64.7    6e-17   Arabis alpina [alpine rockcress]
ref|XP_010457181.1|  PREDICTED: endoribonuclease Dicer homolog 1      64.7    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006846422.1|  hypothetical protein AMTR_s00018p00015000        69.7    6e-17   
ref|XP_010474688.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  64.7    7e-17   
ref|XP_010474687.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  64.7    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008681621.1|  PREDICTED: uncharacterized protein LOC100381...  67.8    7e-17   
ref|XP_006306578.1|  hypothetical protein CARUB_v10008073mg           64.7    7e-17   Capsella rubella
gb|KEH24704.1|  endoribonuclease dicer-like protein                   68.2    8e-17   Medicago truncatula
gb|AES82838.2|  endoribonuclease dicer-like protein                   68.2    8e-17   Medicago truncatula
ref|XP_010661522.1|  PREDICTED: endoribonuclease Dicer homolog 1      68.2    9e-17   Vitis vinifera
ref|XP_002978277.1|  hypothetical protein SELMODRAFT_108314           67.0    9e-17   Selaginella moellendorffii
ref|XP_007051387.1|  Helicase, C-terminal, Argonaute and Dicer pr...  68.6    9e-17   
ref|XP_002966292.1|  hypothetical protein SELMODRAFT_86110            67.4    1e-16   Selaginella moellendorffii
ref|XP_011071730.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  68.2    1e-16   
ref|XP_003626620.1|  Endoribonuclease Dicer-like protein              68.2    1e-16   
gb|ABD32724.1|  Helicase, C-terminal; Argonaute and Dicer protein...  68.2    1e-16   Medicago truncatula
ref|XP_007051386.1|  Dicer-like 1 isoform 1                           68.6    1e-16   
ref|XP_011071729.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  67.8    1e-16   Sesamum indicum [beniseed]
gb|KDP28399.1|  hypothetical protein JCGZ_14170                       68.2    1e-16   Jatropha curcas
ref|XP_010054145.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  68.2    1e-16   Eucalyptus grandis [rose gum]
ref|XP_010054144.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  68.2    1e-16   Eucalyptus grandis [rose gum]
gb|KHG02896.1|  Endoribonuclease Dicer -like protein                  67.8    1e-16   Gossypium arboreum [tree cotton]
ref|XP_006491399.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  69.7    1e-16   Citrus sinensis [apfelsine]
ref|XP_006444699.1|  hypothetical protein CICLE_v10018447mg           69.7    1e-16   Citrus clementina [clementine]
dbj|BAD94606.1|  CAF protein                                          64.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KDO86652.1|  hypothetical protein CISIN_1g000174mg                 69.7    1e-16   Citrus sinensis [apfelsine]
ref|XP_001757950.1|  dsRNA-specific nuclease dicer and related ri...  70.9    2e-16   
gb|ABV31244.1|  dicer-like 1                                          70.9    2e-16   Physcomitrella patens
ref|XP_007220573.1|  hypothetical protein PRUPE_ppa000070mg           67.4    2e-16   Prunus persica
ref|XP_006386668.1|  Endoribonuclease Dicer family protein            68.6    2e-16   Populus trichocarpa [western balsam poplar]
gb|AEZ02177.1|  Dicer                                                 64.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335261.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  66.6    2e-16   Pyrus x bretschneideri [bai li]
gb|AAF03534.1|AF187317_1  CAF protein                                 64.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171612.1|  endoribonuclease Dicer-like 1                       64.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184881.1|  endoribonuclease Dicer-like 1                    64.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008244191.1|  PREDICTED: endoribonuclease Dicer homolog 1      67.0    2e-16   Prunus mume [ume]
ref|NP_001289827.1|  endoribonuclease Dicer homolog 1                 69.7    2e-16   Solanum lycopersicum
gb|KJB09576.1|  hypothetical protein B456_001G150400                  68.2    2e-16   Gossypium raimondii
ref|XP_006604922.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  68.2    2e-16   Glycine max [soybeans]
ref|XP_006352611.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  68.2    2e-16   Solanum tuberosum [potatoes]
gb|KJB09575.1|  hypothetical protein B456_001G150400                  67.8    2e-16   Gossypium raimondii
ref|XP_006418369.1|  hypothetical protein EUTSA_v10006531mg           65.1    2e-16   Eutrema salsugineum [saltwater cress]
gb|AJA90756.1|  Dicer-like 3                                          67.8    2e-16   Cycas revoluta
gb|KHN11363.1|  Endoribonuclease Dicer like 1                         68.2    2e-16   Glycine soja [wild soybean]
ref|XP_002892088.1|  hypothetical protein ARALYDRAFT_333551           64.7    2e-16   
ref|XP_011025346.1|  PREDICTED: endoribonuclease Dicer homolog 1      68.2    3e-16   Populus euphratica
ref|XP_004494885.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  67.8    3e-16   
ref|XP_004155270.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  66.6    3e-16   
ref|XP_004134274.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  66.6    3e-16   
gb|KGN56328.1|  hypothetical protein Csa_3G116650                     66.6    3e-16   Cucumis sativus [cucumbers]
ref|XP_008437750.1|  PREDICTED: endoribonuclease Dicer homolog 1      66.6    3e-16   Cucumis melo [Oriental melon]
ref|XP_004494884.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  67.8    3e-16   Cicer arietinum [garbanzo]
ref|XP_002515097.1|  dicer-1, putative                                69.3    3e-16   
ref|XP_007139041.1|  hypothetical protein PHAVU_009G260000g           67.8    4e-16   Phaseolus vulgaris [French bean]
ref|XP_008358840.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  66.6    4e-16   
ref|XP_010241057.1|  PREDICTED: endoribonuclease Dicer homolog 1      67.4    4e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009411416.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  62.8    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011083615.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  64.3    4e-16   
ref|XP_010686530.1|  PREDICTED: endoribonuclease Dicer homolog 1      66.6    4e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009366581.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  67.0    4e-16   
ref|XP_006577359.1|  PREDICTED: endoribonuclease Dicer homolog 1-...  67.4    4e-16   Glycine max [soybeans]
ref|XP_011083472.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  64.3    4e-16   Sesamum indicum [beniseed]
ref|XP_011083691.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  64.3    4e-16   
ref|XP_011083398.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  64.3    4e-16   
ref|XP_009411415.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  62.8    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN16394.1|  Endoribonuclease Dicer like 1                         67.4    5e-16   Glycine soja [wild soybean]
ref|XP_011083770.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  64.3    5e-16   
ref|XP_011083544.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  64.3    5e-16   
ref|XP_010107130.1|  Endoribonuclease Dicer-1-like protein            65.9    6e-16   
ref|XP_011468880.1|  PREDICTED: endoribonuclease Dicer homolog 1      67.8    7e-16   Fragaria vesca subsp. vesca
ref|XP_009119662.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  65.5    7e-16   Brassica rapa
emb|CDY15207.1|  BnaC05g00860D                                        65.1    7e-16   Brassica napus [oilseed rape]
ref|XP_009606996.1|  PREDICTED: endoribonuclease Dicer homolog 1      67.4    7e-16   
emb|CDX90002.1|  BnaA10g00800D                                        65.1    7e-16   
ref|XP_002464289.1|  hypothetical protein SORBIDRAFT_01g015666        59.7    7e-16   
ref|XP_008376239.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  67.0    1e-15   
gb|EPS58332.1|  hypothetical protein M569_16483                       62.8    1e-15   Genlisea aurea
ref|XP_001772316.1|  predicted protein                                67.0    1e-15   
ref|XP_008364841.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  66.6    1e-15   
ref|XP_002458957.1|  hypothetical protein SORBIDRAFT_03g043355        62.4    3e-15   
gb|ABV31246.1|  dicer-like 4                                          67.0    3e-15   Physcomitrella patens
ref|XP_010556636.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  63.5    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_010556639.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...  63.5    4e-15   Tarenaya hassleriana [spider flower]
gb|ABG74922.1|  Dicer-like 1b protein                                 66.2    4e-15   Physcomitrella patens
gb|AJA90772.1|  Dicer-like 3                                          63.9    7e-15   Ginkgo biloba [ginkgo]
gb|EYU29223.1|  hypothetical protein MIMGU_mgv1a0001672mg             59.3    5e-14   Erythranthe guttata [common monkey flower]
gb|AJA90765.1|  Dicer-like 3                                          60.8    6e-14   Ephedra trifurca [Mexican-tea]
gb|AJA90780.1|  Dicer-like 3                                          62.4    7e-14   Pinus canariensis [Canary Island pine]
ref|XP_009588920.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  62.8    8e-14   Nicotiana tomentosiformis
ref|XP_009588925.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  62.4    8e-14   Nicotiana tomentosiformis
ref|XP_004970995.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  57.4    8e-14   Setaria italica
ref|XP_006474519.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  58.2    1e-13   
ref|XP_006452951.1|  hypothetical protein CICLE_v10007239mg           58.2    1e-13   Citrus clementina [clementine]
ref|XP_006474520.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  58.2    1e-13   Citrus sinensis [apfelsine]
ref|XP_006452950.1|  hypothetical protein CICLE_v10007239mg           58.2    1e-13   Citrus clementina [clementine]
ref|XP_002961233.1|  hypothetical protein SELMODRAFT_74321            57.0    1e-13   
gb|AFD22620.1|  dicer-like 3 protein                                  62.4    1e-13   Nicotiana attenuata
ref|XP_008392375.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  52.8    2e-13   
gb|EEC72002.1|  hypothetical protein OsI_04862                        60.5    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_008351646.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  52.8    2e-13   
gb|EEE55857.1|  hypothetical protein OsJ_04485                        60.5    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002969464.1|  hypothetical protein SELMODRAFT_91347            57.0    2e-13   
ref|NP_001045148.1|  Os01g0909200                                     60.1    2e-13   
ref|XP_001766164.1|  dsRNA-specific nuclease dicer and related ri...  60.5    2e-13   
ref|XP_009381868.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  61.6    3e-13   
ref|XP_006361520.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  61.2    3e-13   Solanum tuberosum [potatoes]
gb|ABV31245.1|  dicer-like 3                                          60.5    3e-13   Physcomitrella patens
ref|XP_009363041.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.2    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_010244128.1|  PREDICTED: ribonuclease 3-like protein 3         64.3    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_007225476.1|  hypothetical protein PRUPE_ppa000165mg           60.5    4e-13   
ref|NP_001289826.1|  endoribonuclease Dicer homolog 3a                60.1    4e-13   Solanum lycopersicum
ref|XP_010231293.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.5    5e-13   
ref|XP_002994673.1|  hypothetical protein SELMODRAFT_432577           55.8    5e-13   
ref|XP_004976180.1|  PREDICTED: endoribonuclease Dicer homolog 4-...  68.2    7e-13   Setaria italica
gb|EPS61362.1|  hypothetical protein M569_13434                       62.0    7e-13   Genlisea aurea
ref|XP_008220598.1|  PREDICTED: endoribonuclease Dicer homolog 3      59.7    7e-13   Prunus mume [ume]
ref|XP_004976179.1|  PREDICTED: endoribonuclease Dicer homolog 4-...  67.8    8e-13   Setaria italica
ref|XP_002991516.1|  hypothetical protein SELMODRAFT_448444           54.3    8e-13   
ref|XP_008793257.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  60.1    8e-13   Phoenix dactylifera
gb|KJB65397.1|  hypothetical protein B456_010G093100                  59.3    1e-12   Gossypium raimondii
gb|AES73487.2|  endoribonuclease dicer-like protein                   55.5    1e-12   Medicago truncatula
ref|XP_003603236.1|  Endoribonuclease Dicer-like protein              55.5    1e-12   
gb|KJB65396.1|  hypothetical protein B456_010G093100                  58.9    1e-12   
gb|KJB65398.1|  hypothetical protein B456_010G093100                  58.9    1e-12   
tpg|DAA56229.1|  TPA: hypothetical protein ZEAMMB73_255524            54.7    1e-12   
gb|KJB65395.1|  hypothetical protein B456_010G093100                  58.9    1e-12   
gb|AEC12444.1|  ribonuclease III family protein DCL3                  58.9    2e-12   
ref|XP_010231294.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.5    2e-12   
ref|NP_001266210.1|  dicer-like protein 4                             53.9    2e-12   
ref|XP_006645200.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  59.3    2e-12   
ref|XP_006645199.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  59.3    2e-12   
ref|XP_010049290.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  59.7    2e-12   
ref|XP_010049291.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  59.7    2e-12   
gb|EMS52805.1|  Endoribonuclease Dicer-like protein 3a                56.6    2e-12   
ref|XP_007012461.1|  Ribonuclease III, putative isoform 1             57.4    2e-12   
ref|XP_002448150.1|  hypothetical protein SORBIDRAFT_06g022180        65.1    2e-12   
ref|XP_007012462.1|  Endoribonuclease Dicera, putative isoform 2      57.4    2e-12   
ref|XP_008357238.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.2    3e-12   
ref|XP_008357237.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.2    3e-12   
ref|XP_009359046.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.2    3e-12   
gb|KHG13242.1|  Endoribonuclease Dicera                               56.2    3e-12   
ref|XP_008393569.1|  PREDICTED: endoribonuclease Dicer homolog 3a     56.6    3e-12   
gb|AIO05701.1|  putative endoribonuclease dicer 3a-like protein 3a    57.4    4e-12   
ref|XP_004501416.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  54.7    4e-12   
ref|XP_010932925.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  57.0    4e-12   
ref|XP_008672684.1|  PREDICTED: uncharacterized protein LOC100279...  52.8    4e-12   
ref|XP_010932228.1|  PREDICTED: endoribonuclease Dicer homolog 4      66.2    7e-12   
ref|XP_010233576.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  57.8    7e-12   
ref|XP_006852760.1|  hypothetical protein AMTR_s00033p00127000        58.5    7e-12   
ref|XP_009418500.1|  PREDICTED: endoribonuclease Dicer homolog 4      66.2    7e-12   
gb|EMT29032.1|  Endoribonuclease Dicer-3a-like protein                55.8    8e-12   
emb|CDM85593.1|  unnamed protein product                              55.8    8e-12   
ref|XP_004144277.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.9    9e-12   
ref|XP_008796519.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  55.1    1e-11   
gb|AIO05703.1|  putative endoribonuclease dicer 4-like protein 4      65.1    1e-11   
ref|XP_010323152.1|  PREDICTED: dicer-like protein 4 isoform X2       53.9    2e-11   
ref|XP_010323153.1|  PREDICTED: dicer-like protein 4 isoform X3       53.9    2e-11   
ref|XP_010323151.1|  PREDICTED: dicer-like protein 4 isoform X1       53.9    2e-11   
ref|XP_008445598.1|  PREDICTED: endoribonuclease Dicer homolog 3      57.8    2e-11   
ref|XP_009400626.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  55.1    2e-11   
gb|ABB20894.1|  dicer-like protein                                    60.5    2e-11   
ref|XP_004158269.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  57.4    2e-11   
tpg|DAA49562.1|  TPA: hypothetical protein ZEAMMB73_299457            58.2    3e-11   
gb|KGN47575.1|  hypothetical protein Csa_6G361370                     57.4    3e-11   
gb|EEC67202.1|  hypothetical protein OsI_34085                        60.1    3e-11   
tpg|DAA49561.1|  TPA: hypothetical protein ZEAMMB73_299457            57.8    3e-11   
ref|XP_008664844.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  57.8    3e-11   
ref|XP_008664845.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  57.8    3e-11   
tpg|DAA49563.1|  TPA: hypothetical protein ZEAMMB73_299457            57.8    3e-11   
ref|XP_010236618.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  62.0    3e-11   
ref|XP_008664847.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  57.8    3e-11   
ref|XP_008664848.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  57.8    3e-11   
emb|CDP11349.1|  unnamed protein product                              59.7    4e-11   
ref|XP_006343690.1|  PREDICTED: dicer-like protein 4-like isoform X1  53.5    4e-11   
ref|XP_006343691.1|  PREDICTED: dicer-like protein 4-like isoform X2  53.5    4e-11   
ref|XP_010261807.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  60.1    4e-11   
ref|XP_010261808.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  60.1    4e-11   
ref|XP_011458182.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  61.2    5e-11   
gb|ABR17101.1|  unknown                                               57.4    5e-11   
ref|XP_006400600.1|  hypothetical protein EUTSA_v100124261mg          65.9    7e-11   
ref|XP_006447611.1|  hypothetical protein CICLE_v10016164mg           57.8    8e-11   
ref|XP_006661878.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  58.9    9e-11   
ref|XP_006469759.1|  PREDICTED: uncharacterized protein LOC102609714  58.2    9e-11   
gb|AFB32892.1|  hypothetical protein 0_6448_02                        67.0    1e-10   
sp|Q7XD96.2|DCL3B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...  58.9    1e-10   
ref|XP_006581317.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  49.3    1e-10   
gb|AEW07599.1|  hypothetical protein 0_6448_02                        67.0    1e-10   
ref|XP_006581316.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  49.3    1e-10   
gb|AEW07598.1|  hypothetical protein 0_6448_02                        67.0    1e-10   
gb|EEE51167.1|  hypothetical protein OsJ_31945                        58.9    1e-10   
ref|NP_001064898.2|  Os10g0485600                                     58.9    1e-10   
gb|AFB32889.1|  hypothetical protein 0_6448_02                        67.0    1e-10   
gb|AFB32888.1|  hypothetical protein 0_6448_02                        66.6    2e-10   
emb|CBI38729.3|  unnamed protein product                              67.8    2e-10   
ref|NP_189978.1|  endoribonuclease Dicer-like 3                       57.8    2e-10   
ref|NP_001154663.2|  endoribonuclease Dicer-like 3                    57.8    2e-10   
ref|NP_001154662.2|  endoribonuclease Dicer-like 3                    57.8    2e-10   
ref|XP_003560753.1|  PREDICTED: ribonuclease 3-like protein 3 iso...  56.6    2e-10   
emb|CBI20740.3|  unnamed protein product                              58.5    3e-10   
ref|XP_010906745.1|  PREDICTED: endoribonuclease Dicer homolog 3b...  52.8    3e-10   
ref|XP_002994689.1|  hypothetical protein SELMODRAFT_432592           67.4    3e-10   
ref|XP_010648400.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.2    3e-10   
ref|XP_010648401.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  58.2    3e-10   
emb|CDP19693.1|  unnamed protein product                              52.0    3e-10   
ref|NP_001057601.1|  Os06g0358800                                     57.8    4e-10   
gb|EAZ00889.1|  hypothetical protein OsI_22916                        57.8    4e-10   
ref|XP_006293341.1|  hypothetical protein CARUB_v100165770mg          57.8    4e-10   
ref|XP_009358497.1|  PREDICTED: dicer-like protein 4                  55.5    4e-10   
gb|AIO05702.1|  putative endoribonuclease dicer 3b-like protein       62.0    6e-10   
gb|EMT13587.1|  Endoribonuclease Dicer-3b-like protein                61.6    6e-10   
ref|XP_011007194.1|  PREDICTED: ribonuclease 3-like protein 3 iso...  58.2    7e-10   
ref|XP_006290500.1|  hypothetical protein CARUB_v10016574mg           58.2    7e-10   
ref|XP_002467056.1|  hypothetical protein SORBIDRAFT_01g018890        58.2    8e-10   
emb|CDY35811.1|  BnaC09g37430D                                        59.3    8e-10   
emb|CDX92469.1|  BnaA10g15080D                                        58.9    9e-10   
ref|XP_010427121.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  58.2    1e-09   
gb|KCW46961.1|  hypothetical protein EUGRSUZ_K00771                   54.7    2e-09   
emb|CDP13802.1|  unnamed protein product                              49.7    2e-09   
emb|CBI28843.3|  unnamed protein product                              55.8    2e-09   
ref|XP_011078683.1|  PREDICTED: dicer-like protein 4 isoform X1       51.6    2e-09   
ref|XP_002301611.2|  ribonuclease 3 family protein                    58.5    2e-09   
ref|XP_011078684.1|  PREDICTED: dicer-like protein 4 isoform X2       51.6    2e-09   
gb|AFD22621.1|  dicer-like 4 protein                                  49.3    2e-09   
ref|XP_010503059.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  57.4    2e-09   
ref|XP_010503060.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  57.4    2e-09   
ref|XP_006404521.1|  hypothetical protein EUTSA_v10010061mg           57.4    2e-09   
gb|AIY54874.1|  hypothetical protein                                  63.2    2e-09   
gb|AIY54865.1|  hypothetical protein                                  63.2    2e-09   
ref|XP_006404520.1|  hypothetical protein EUTSA_v10010061mg           57.4    2e-09   
ref|XP_010514745.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  57.4    2e-09   
ref|XP_010514744.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  57.4    2e-09   
ref|XP_010514746.1|  PREDICTED: endoribonuclease Dicer homolog 3-...  57.0    2e-09   
ref|XP_010434988.1|  PREDICTED: ribonuclease 3-like protein 3         56.6    2e-09   
ref|XP_010240123.1|  PREDICTED: endoribonuclease Dicer homolog 4      67.0    2e-09   
gb|EMT29907.1|  Ribonuclease 3-like protein 3                         48.9    2e-09   
emb|CDY21223.1|  BnaC03g54010D                                        53.9    2e-09   
ref|XP_002270948.3|  PREDICTED: ribonuclease 3-like protein 3         55.5    2e-09   
ref|XP_011033477.1|  PREDICTED: dicer-like protein 4                  54.7    2e-09   
ref|XP_009334949.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  67.0    2e-09   
gb|EMT23468.1|  Ribonuclease 3-like protein 3                         50.8    3e-09   
ref|XP_010245534.1|  PREDICTED: dicer-like protein 4 isoform X1       53.5    3e-09   
ref|XP_007136903.1|  hypothetical protein PHAVU_009G083800g           57.0    3e-09   
ref|XP_008801683.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  59.7    3e-09   
gb|EMS60827.1|  Ribonuclease 3-like protein 3                         50.1    4e-09   
ref|XP_002875633.1|  hypothetical protein ARALYDRAFT_484824           57.4    4e-09   
gb|KFM82755.1|  Endoribonuclease Dcr-1                                53.1    4e-09   
ref|XP_010323858.1|  PREDICTED: ribonuclease 3-like protein 3         64.3    4e-09   
ref|XP_007213439.1|  hypothetical protein PRUPE_ppa025272mg           57.0    4e-09   
ref|XP_009120817.1|  PREDICTED: dicer-like protein 4                  56.6    4e-09   
pdb|3C4T|A  Chain A, Structure Of Rnaseiiib And Dsrna Binding Dom...  52.8    5e-09   
ref|XP_007012010.1|  Dicer-like protein, putative isoform 1           52.0    5e-09   
ref|XP_007012011.1|  Dicer-like protein isoform 2                     52.0    5e-09   
emb|CDY30942.1|  BnaA06g19710D                                        55.1    6e-09   
ref|XP_009150278.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  55.1    6e-09   
ref|XP_009150279.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  55.1    6e-09   
ref|XP_007155126.1|  hypothetical protein PHAVU_003G1757001g          52.0    6e-09   
ref|XP_009150277.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...  55.1    6e-09   
emb|CAN62473.1|  hypothetical protein VITISV_005321                   53.9    6e-09   
ref|XP_010451497.1|  PREDICTED: ribonuclease 3-like protein 3         55.1    6e-09   
ref|XP_010227687.1|  PREDICTED: ribonuclease 3-like protein 3 iso...  52.0    6e-09   
ref|NP_197532.3|  dicer-like protein 4                                60.5    7e-09   
dbj|BAG90040.1|  unnamed protein product                              65.5    7e-09   
ref|NP_001053278.1|  Os04g0509300                                     65.5    7e-09   
ref|XP_010227688.1|  PREDICTED: ribonuclease 3-like protein 3 iso...  51.2    8e-09   
ref|NP_001190348.1|  dicer-like protein 4                             60.1    8e-09   
ref|XP_008337203.1|  PREDICTED: dicer-like protein 4                  51.2    9e-09   
ref|XP_006653591.1|  PREDICTED: endoribonuclease Dicer homolog 4-...  65.5    9e-09   
gb|AFW58817.1|  hypothetical protein ZEAMMB73_714278                  64.3    9e-09   
ref|XP_007204799.1|  hypothetical protein PRUPE_ppa000144mg           55.1    9e-09   
ref|XP_008352221.1|  PREDICTED: dicer-like protein 4                  51.2    9e-09   
ref|XP_010440313.1|  PREDICTED: ribonuclease 3-like protein 3         55.1    9e-09   
ref|XP_006594229.1|  PREDICTED: dicer-like protein 4-like isoform X3  53.5    1e-08   
ref|XP_002873991.1|  predicted protein                                58.9    1e-08   
gb|EEC77616.1|  hypothetical protein OsI_16596                        65.1    1e-08   
emb|CAE03362.1|  OSJNBb0065L13.5                                      65.1    1e-08   
dbj|BAF80150.1|  SHOOT ORGANIZATION1                                  65.1    1e-08   
sp|A7LFZ6.1|DCL4_ORYSJ  RecName: Full=Endoribonuclease Dicer homo...  65.1    1e-08   
ref|XP_006594227.1|  PREDICTED: dicer-like protein 4-like isoform X1  53.1    1e-08   
gb|KHN22101.1|  Dicer-like protein 4                                  53.1    1e-08   
ref|XP_006594228.1|  PREDICTED: dicer-like protein 4-like isoform X2  53.1    1e-08   
ref|XP_008382783.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  65.1    1e-08   
ref|XP_010424192.1|  PREDICTED: dicer-like protein 4                  58.5    1e-08   
ref|XP_004502137.1|  PREDICTED: ribonuclease 3-like protein 3-like    52.4    1e-08   
gb|EMT06391.1|  Endoribonuclease Dicer-4-like protein                 64.7    1e-08   
ref|XP_007142309.1|  hypothetical protein PHAVU_008G269800g           52.8    1e-08   
gb|AAF26461.1|AC007323_2  T25K16.4                                    64.7    2e-08   
gb|KFK32317.1|  hypothetical protein AALP_AA6G226200                  56.2    2e-08   
ref|XP_006578099.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  52.8    2e-08   
ref|XP_002308384.2|  hypothetical protein POPTR_0006s20310g           53.9    2e-08   
gb|KHN29665.1|  Endoribonuclease Dicer like 3a                        52.8    2e-08   
ref|XP_010495321.1|  PREDICTED: dicer-like protein 4                  58.2    2e-08   
gb|AAL84637.1|AF484523_1  endoribonuclease Dicer                      52.0    2e-08   
ref|XP_006578101.1|  PREDICTED: endoribonuclease Dicer homolog 3a...  52.8    2e-08   
dbj|BAE23515.1|  unnamed protein product                              51.6    2e-08   
ref|XP_004292050.2|  PREDICTED: endoribonuclease Dicer homolog 3-...  63.9    2e-08   
gb|EMS51466.1|  Endoribonuclease Dicer-like protein 4                 63.9    2e-08   
dbj|BAC98051.1|  mKIAA0928 protein                                    51.2    2e-08   
ref|XP_010454337.1|  PREDICTED: dicer-like protein 4                  57.8    2e-08   
gb|EYU31800.1|  hypothetical protein MIMGU_mgv1a000153mg              47.8    3e-08   
ref|XP_002965641.1|  hypothetical protein SELMODRAFT_84784            63.5    3e-08   
gb|EYU31801.1|  hypothetical protein MIMGU_mgv1a000153mg              47.8    3e-08   
ref|NP_683750.2|  endoribonuclease Dicer                              51.2    3e-08   
sp|Q8R418.3|DICER_MOUSE  RecName: Full=Endoribonuclease Dicer; Al...  51.2    3e-08   
gb|EDL18788.1|  Dicer1, Dcr-1 homolog (Drosophila), isoform CRA_b     51.2    3e-08   
gb|AAM21495.1|AF430845_1  dicer-like protein                          51.2    3e-08   
gb|EDL18787.1|  Dicer1, Dcr-1 homolog (Drosophila), isoform CRA_a     51.2    3e-08   
ref|XP_002989272.1|  hypothetical protein SELMODRAFT_129431           63.5    3e-08   
ref|XP_008243098.1|  PREDICTED: dicer-like protein 4                  52.4    3e-08   
gb|KHN18588.1|  Dicer-like protein 4                                  53.1    3e-08   
ref|XP_011467219.1|  PREDICTED: endoribonuclease Dicer homolog 3a     63.5    3e-08   
dbj|BAC15765.1|  double-strand-specific ribonuclease MDCR             50.8    4e-08   
gb|AES71611.2|  ribonuclease III domain protein                       49.3    4e-08   
ref|XP_009623599.1|  PREDICTED: ribonuclease 3-like protein 3 iso...  62.0    4e-08   
ref|XP_009575579.1|  PREDICTED: endoribonuclease Dicer                51.2    5e-08   
ref|XP_010710191.1|  PREDICTED: endoribonuclease Dicer-like           51.2    5e-08   
ref|XP_009623598.1|  PREDICTED: ribonuclease 3-like protein 3 iso...  62.0    5e-08   
ref|XP_008785813.1|  PREDICTED: ribonuclease 3-like protein 3         47.0    5e-08   
ref|XP_002438089.1|  hypothetical protein SORBIDRAFT_10g007870        58.9    7e-08   
ref|XP_009765936.1|  PREDICTED: dicer-like protein 4 isoform X3       48.9    7e-08   
ref|XP_009777737.1|  PREDICTED: endoribonuclease Dicer homolog 3a     62.4    7e-08   
ref|XP_009765934.1|  PREDICTED: dicer-like protein 4 isoform X1       48.5    7e-08   
ref|XP_010656556.1|  PREDICTED: dicer-like protein 4 isoform X1       52.0    7e-08   
emb|CBI25610.3|  unnamed protein product                              52.0    8e-08   
ref|XP_009765935.1|  PREDICTED: dicer-like protein 4 isoform X2       48.5    8e-08   
ref|XP_002264486.2|  PREDICTED: dicer-like protein 4 isoform X2       52.0    8e-08   
ref|XP_006025539.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  51.2    8e-08   
ref|XP_008385859.1|  PREDICTED: ribonuclease 3-like protein 2 iso...  47.4    8e-08   
ref|XP_010916135.1|  PREDICTED: ribonuclease 3-like protein 3 iso...  47.0    8e-08   
ref|XP_010520559.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...  48.1    9e-08   
ref|XP_010916133.1|  PREDICTED: ribonuclease 3-like protein 3 iso...  46.6    9e-08   
ref|XP_002523532.1|  Ribonuclease III, putative                       54.7    9e-08   
ref|XP_006357941.1|  PREDICTED: ribonuclease 3-like protein 3-like    58.2    1e-07   
ref|XP_008385857.1|  PREDICTED: ribonuclease 3-like protein 2 iso...  47.0    1e-07   
ref|XP_007529168.1|  PREDICTED: endoribonuclease Dicer                50.1    1e-07   
ref|XP_003601360.1|  Endoribonuclease Dicer-like protein              49.7    1e-07   
ref|XP_005068417.1|  PREDICTED: endoribonuclease Dicer isoform X3     50.1    1e-07   
ref|XP_010192237.1|  PREDICTED: endoribonuclease Dicer-like           50.1    1e-07   
ref|XP_008835795.1|  PREDICTED: endoribonuclease Dicer                50.1    1e-07   
ref|XP_008249715.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  50.1    1e-07   
ref|XP_004665669.1|  PREDICTED: endoribonuclease Dicer                50.1    1e-07   
ref|NP_001184123.1|  endoribonuclease Dicer                           50.1    1e-07   
ref|XP_010047156.1|  PREDICTED: dicer-like protein 4 isoform X1       42.4    1e-07   



>gb|KJB61693.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1306

 Score =   120 bits (302),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 54/100 (54%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             MES+AGAI++DSG + +IVF+ IRP+LEPM+TPE++ ++PVKEL ELCQK  Y +++P+V
Sbjct  1197  MESLAGAIFVDSGYKKEIVFQSIRPLLEPMITPETMTVHPVKELYELCQKEHYELRKPIV  1256

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H+DG +  TIEV ANG V   +S+A ++K AK+LA + +
Sbjct  1257  SHEDGISSITIEVEANGKVFKHTSTACDKKMAKKLASKEV  1296


 Score = 69.3 bits (168),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VKAG H +IL SS  L   I + V++ ++ S   TFGW  + 
Sbjct  1128  LTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYKDIKETVESFQELSLEYTFGWESEK  1187

Query  535   SFP  527
             SFP
Sbjct  1188  SFP  1190



>gb|KJB61692.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61694.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61695.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1395

 Score =   120 bits (301),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 54/100 (54%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             MES+AGAI++DSG + +IVF+ IRP+LEPM+TPE++ ++PVKEL ELCQK  Y +++P+V
Sbjct  1286  MESLAGAIFVDSGYKKEIVFQSIRPLLEPMITPETMTVHPVKELYELCQKEHYELRKPIV  1345

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H+DG +  TIEV ANG V   +S+A ++K AK+LA + +
Sbjct  1346  SHEDGISSITIEVEANGKVFKHTSTACDKKMAKKLASKEV  1385


 Score = 69.7 bits (169),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VKAG H +IL SS  L   I + V++ ++ S   TFGW  + 
Sbjct  1217  LTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYKDIKETVESFQELSLEYTFGWESEK  1276

Query  535   SFP  527
             SFP
Sbjct  1277  SFP  1279



>gb|KJB61696.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1076

 Score =   120 bits (301),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 54/100 (54%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             MES+AGAI++DSG + +IVF+ IRP+LEPM+TPE++ ++PVKEL ELCQK  Y +++P+V
Sbjct  967   MESLAGAIFVDSGYKKEIVFQSIRPLLEPMITPETMTVHPVKELYELCQKEHYELRKPIV  1026

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H+DG +  TIEV ANG V   +S+A ++K AK+LA + +
Sbjct  1027  SHEDGISSITIEVEANGKVFKHTSTACDKKMAKKLASKEV  1066


 Score = 69.3 bits (168),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN CYALS+VKAG H +IL SS  L   I + V++ ++ S   TFGW  + 
Sbjct  898  LTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYKDIKETVESFQELSLEYTFGWESEK  957

Query  535  SFP  527
            SFP
Sbjct  958  SFP  960



>ref|XP_002514810.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47364.1| ATP binding protein, putative [Ricinus communis]
Length=1388

 Score =   118 bits (295),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  IRP+LEP++TPE++RL+P +ELTELCQK+ +  ++PVV
Sbjct  1278  IESLAGAIFVDSGYNKEVVFNSIRPLLEPLITPETIRLHPTRELTELCQKQHFDRRKPVV  1337

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                +G +C T+EV ANG V   +S+A  RKTAKRLA + +
Sbjct  1338  SRNNGMSCVTVEVEANGVVFKHTSAAAERKTAKRLASKEV  1377


 Score = 72.0 bits (175),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S+V+ GLH YILH+S  L   I   V N ++ S+ STFGW  + 
Sbjct  1209  LTDMRSASVNNDCYAQSAVREGLHKYILHASQKLHKDIVSTVANCKEFSSESTFGWESEI  1268

Query  535   SFP  527
             SFP
Sbjct  1269  SFP  1271



>ref|XP_011466081.1| PREDICTED: endoribonuclease Dicer homolog 2 [Fragaria vesca subsp. 
vesca]
Length=1397

 Score =   112 bits (279),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+ GAIY+DSG   DIVFE IRP+LEP++TPE++ L+P +EL E C K  Y MK+P+ 
Sbjct  1288  VESLGGAIYVDSGYNKDIVFESIRPLLEPLITPETMTLHPARELNEYCSKMHYDMKKPLK  1347

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++  A  TIEV ANG     SS+A ++KTAK+LAC+ +
Sbjct  1348  SFQNDAATVTIEVEANGVTYRHSSTASDKKTAKKLACKEV  1387


 Score = 73.9 bits (180),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S+VKAGLH +ILH+S  L   I   + N +  S  STFGW  +T
Sbjct  1219  LTDMRSASVNNDCYARSAVKAGLHKHILHASQKLHKDIVQTISNFQTLSTESTFGWESET  1278

Query  535   SFP  527
             SFP
Sbjct  1279  SFP  1281



>ref|XP_007029209.1| Dicer-like protein isoform 2 [Theobroma cacao]
 gb|EOY09711.1| Dicer-like protein isoform 2 [Theobroma cacao]
Length=1307

 Score =   106 bits (265),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG     VF  IRP+LEP++TPE+++ +PVKEL ELCQK  +  +   V
Sbjct  1194  IESLAGAIFVDSGYDKHAVFRSIRPLLEPLITPETIKFHPVKELNELCQKEHFEQRPATV  1253

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H +G    T EV ANG V   +SSA N+K A++LAC+ +
Sbjct  1254  SHDNGVTSITTEVEANGMVFKHTSSASNKKMARKLACKEV  1293


 Score = 77.4 bits (189),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VKAGLH YILH+S  L   IA+ V++ ++ S   TFGW    
Sbjct  1125  LTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHKEIAETVESFKELSMKYTFGWECDK  1184

Query  535   SFP  527
             SFP
Sbjct  1185  SFP  1187



>ref|XP_007208392.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
 gb|EMJ09591.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
Length=1415

 Score =   109 bits (272),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG    IVF+ I P+++P+VTPE++RL+PV+EL E CQK  Y +K+PV 
Sbjct  1308  IESLAGAIFVDSGYDKKIVFQSISPLIQPLVTPETMRLHPVRELNEHCQKMHYNLKKPVK  1367

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++  A  TIEV ANG     SS+A N+KTA +LAC+ +
Sbjct  1368  SFQNNVATVTIEVEANGYTYKHSSTASNKKTALKLACKEV  1407


 Score = 75.1 bits (183),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S++KAGLH +ILH+S  L   I   ++N E+ S+ STFGW  +T
Sbjct  1239  LTDMRSASVNNDCYARSAIKAGLHKHILHASHKLHKDIVYTIENFERLSSESTFGWESET  1298

Query  535   SFP  527
             SFP
Sbjct  1299  SFP  1301



>ref|XP_007029213.1| Dicer-like protein isoform 6 [Theobroma cacao]
 gb|EOY09715.1| Dicer-like protein isoform 6 [Theobroma cacao]
Length=1114

 Score =   106 bits (265),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG     VF  IRP+LEP++TPE+++ +PVKEL ELCQK  +  +   V
Sbjct  1001  IESLAGAIFVDSGYDKHAVFRSIRPLLEPLITPETIKFHPVKELNELCQKEHFEQRPATV  1060

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H +G    T EV ANG V   +SSA N+K A++LAC+ +
Sbjct  1061  SHDNGVTSITTEVEANGMVFKHTSSASNKKMARKLACKEV  1100


 Score = 77.8 bits (190),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN CYALS+VKAGLH YILH+S  L   IA+ V++ ++ S   TFGW    
Sbjct  932  LTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHKEIAETVESFKELSMKYTFGWECDK  991

Query  535  SFP  527
            SFP
Sbjct  992  SFP  994



>ref|XP_007029208.1| Dicer-like protein isoform 1 [Theobroma cacao]
 gb|EOY09710.1| Dicer-like protein isoform 1 [Theobroma cacao]
Length=1418

 Score =   106 bits (264),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG     VF  IRP+LEP++TPE+++ +PVKEL ELCQK  +  +   V
Sbjct  1305  IESLAGAIFVDSGYDKHAVFRSIRPLLEPLITPETIKFHPVKELNELCQKEHFEQRPATV  1364

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H +G    T EV ANG V   +SSA N+K A++LAC+ +
Sbjct  1365  SHDNGVTSITTEVEANGMVFKHTSSASNKKMARKLACKEV  1404


 Score = 77.8 bits (190),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VKAGLH YILH+S  L   IA+ V++ ++ S   TFGW    
Sbjct  1236  LTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHKEIAETVESFKELSMKYTFGWECDK  1295

Query  535   SFP  527
             SFP
Sbjct  1296  SFP  1298



>ref|XP_007029210.1| Dicer-like protein isoform 3 [Theobroma cacao]
 gb|EOY09712.1| Dicer-like protein isoform 3 [Theobroma cacao]
Length=1202

 Score =   106 bits (264),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG     VF  IRP+LEP++TPE+++ +PVKEL ELCQK  +  +   V
Sbjct  1089  IESLAGAIFVDSGYDKHAVFRSIRPLLEPLITPETIKFHPVKELNELCQKEHFEQRPATV  1148

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H +G    T EV ANG V   +SSA N+K A++LAC+ +
Sbjct  1149  SHDNGVTSITTEVEANGMVFKHTSSASNKKMARKLACKEV  1188


 Score = 77.8 bits (190),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VKAGLH YILH+S  L   IA+ V++ ++ S   TFGW    
Sbjct  1020  LTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHKEIAETVESFKELSMKYTFGWECDK  1079

Query  535   SFP  527
             SFP
Sbjct  1080  SFP  1082



>ref|XP_007029212.1| Dicer-like protein isoform 5 [Theobroma cacao]
 gb|EOY09714.1| Dicer-like protein isoform 5 [Theobroma cacao]
Length=1077

 Score =   105 bits (263),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG     VF  IRP+LEP++TPE+++ +PVKEL ELCQK  +  +   V
Sbjct  964   IESLAGAIFVDSGYDKHAVFRSIRPLLEPLITPETIKFHPVKELNELCQKEHFEQRPATV  1023

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H +G    T EV ANG V   +SSA N+K A++LAC+ +
Sbjct  1024  SHDNGVTSITTEVEANGMVFKHTSSASNKKMARKLACKEV  1063


 Score = 77.8 bits (190),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN CYALS+VKAGLH YILH+S  L   IA+ V++ ++ S   TFGW    
Sbjct  895  LTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHKEIAETVESFKELSMKYTFGWECDK  954

Query  535  SFP  527
            SFP
Sbjct  955  SFP  957



>ref|XP_009361581.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
 ref|XP_009361582.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
Length=1410

 Score =   114 bits (285),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAIY+DSG    IVF+ I P+L+P++TPE+L+L+PV+EL E CQK  Y MK+PV 
Sbjct  1297  VESLAGAIYVDSGYDKKIVFQSISPLLQPLITPETLKLHPVRELNEHCQKMHYDMKKPVK  1356

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                +G A  TIEV ANG + + +S+A N+KTA +LAC+++
Sbjct  1357  TSHNGVAAITIEVEANGFMYTDTSTASNKKTALKLACKKV  1396


 Score = 68.9 bits (167),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S++KA L+ +ILH+S  L   I   ++N E+ S  STFGW  +T
Sbjct  1228  LTDMRSASVNNDCYARSAIKAELYKHILHASHKLHKDIVYTIENFERLSTESTFGWESET  1287

Query  535   SFP  527
             SFP
Sbjct  1288  SFP  1290



>ref|XP_008370841.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
 ref|XP_008370842.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
Length=1397

 Score =   114 bits (285),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAIY+DSG     VF+ I P+L+P++TPE+L+L+PV+EL E CQK  Y MK+PV 
Sbjct  1284  VESLAGAIYVDSGYDKXXVFQSISPLLQPLITPETLKLHPVRELNEHCQKMHYDMKKPVK  1343

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                +GEA  TIEV ANG     +S+A N+KTA +LAC+ +
Sbjct  1344  TSHNGEAAITIEVEANGVTHKHTSTASNKKTALKLACKEV  1383


 Score = 68.9 bits (167),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S++KA L+ +ILH+S  L   I   ++N E+ S  STFGW  +T
Sbjct  1215  LTDMRSASVNNDCYARSAIKAELYKHILHASHKLHKDIVYTIENFERLSTESTFGWDSET  1274

Query  535   SFP  527
             SFP
Sbjct  1275  SFP  1277



>ref|XP_006480493.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X6 [Citrus 
sinensis]
Length=1396

 Score =   111 bits (278),  Expect(2) = 4e-37, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF+ IRP+LEPM+TPE++R +PV+ELTE CQK  + MK+PV 
Sbjct  1286  IESLAGAIFVDSGCNREVVFQSIRPLLEPMITPETMRFHPVRELTEYCQKNHFSMKKPVA  1345

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                 G+A  T+EV ANG +   +    ++KTAK++AC+ +
Sbjct  1346  SRISGKAAVTVEVQANGRLFEHTFLDADKKTAKKVACKEV  1385


 Score = 70.9 bits (172),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYALSSVK GLH +ILH+S  L   I   V + E+ S  STFGW   T
Sbjct  1217  LTDMRSASVNNDCYALSSVKHGLHKHILHASHELYKRINITVDSFEKLSLGSTFGWESVT  1276

Query  535   SFP  527
             SFP
Sbjct  1277  SFP  1279



>ref|XP_006428679.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|ESR41919.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|KDO45680.1| hypothetical protein CISIN_1g000607mg [Citrus sinensis]
Length=1396

 Score =   111 bits (278),  Expect(2) = 4e-37, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF+ IRP+LEPM+TPE++R +PV+ELTE CQK  + MK+PV 
Sbjct  1286  IESLAGAIFVDSGCNREVVFQSIRPLLEPMITPETMRFHPVRELTEYCQKNHFSMKKPVA  1345

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                 G+A  T+EV ANG +   +    ++KTAK++AC+ +
Sbjct  1346  SRISGKAAVTVEVQANGRLFEHTFLDADKKTAKKVACKEV  1385


 Score = 70.9 bits (172),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYALSSVK GLH +ILH+S  L   I   V + E+ S  STFGW   T
Sbjct  1217  LTDMRSASVNNDCYALSSVKHGLHKHILHASHELYKRINITVDSFEKLSLGSTFGWESVT  1276

Query  535   SFP  527
             SFP
Sbjct  1277  SFP  1279



>gb|KHG30499.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1358

 Score =   112 bits (280),  Expect(2) = 4e-37, Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             MES+AGAI++DSG   + VF  IRP+LEP++T E++ ++PVKEL ELCQK+ Y  ++P+V
Sbjct  1249  MESLAGAIFVDSGYNKETVFRSIRPLLEPLITLETMTVHPVKELNELCQKKHYEQRKPIV  1308

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H +G +  TIEV ANG V   +S+A +RK AK+LA + +
Sbjct  1309  SHDNGVSSVTIEVEANGEVLKHTSTASDRKMAKKLASKEI  1348


 Score = 69.7 bits (169),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VKAGLH +IL SS  L   I + V++  + S   TFGW  + 
Sbjct  1180  LTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYKHIKETVESFRELSLDCTFGWESEK  1239

Query  535   SFP  527
             SFP
Sbjct  1240  SFP  1242



>gb|KHG30500.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1290

 Score =   112 bits (280),  Expect(2) = 5e-37, Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             MES+AGAI++DSG   + VF  IRP+LEP++T E++ ++PVKEL ELCQK+ Y  ++P+V
Sbjct  1181  MESLAGAIFVDSGYNKETVFRSIRPLLEPLITLETMTVHPVKELNELCQKKHYEQRKPIV  1240

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H +G +  TIEV ANG V   +S+A +RK AK+LA + +
Sbjct  1241  SHDNGVSSVTIEVEANGEVLKHTSTASDRKMAKKLASKEI  1280


 Score = 69.7 bits (169),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VKAGLH +IL SS  L   I + V++  + S   TFGW  + 
Sbjct  1112  LTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYKHIKETVESFRELSLDCTFGWESEK  1171

Query  535   SFP  527
             SFP
Sbjct  1172  SFP  1174



>ref|XP_008218472.1| PREDICTED: endoribonuclease Dicer homolog 2 [Prunus mume]
Length=1396

 Score =   105 bits (261),  Expect(2) = 5e-37, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG    IVF+ I P+++P+VTPE++RL+PV+EL E CQK  Y +K+ V 
Sbjct  1289  IESLAGAIFVDSGYDKKIVFQSISPLIQPLVTPETMRLHPVRELNEHCQKMHYNLKKHVK  1348

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++  A  TIEV ANG     SS+A ++KTA++LAC+ +
Sbjct  1349  SFQNNVATITIEVEANGFTYKHSSTASDKKTARKLACKEV  1388


 Score = 77.0 bits (188),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S++KAGLH +ILH+S  L   I   ++N EQ S+ STFGW  +T
Sbjct  1220  LTDMRSASVNNDCYARSAIKAGLHKHILHASHKLHKDIVYTIENFEQLSSESTFGWESET  1279

Query  535   SFP  527
             SFP
Sbjct  1280  SFP  1282



>ref|XP_009340367.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009340372.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
Length=1397

 Score =   112 bits (281),  Expect(2) = 6e-37, Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAIY+DSG    IVF+ I P+L+P++TPE+L+L+PV+EL E CQK  Y MK+PV 
Sbjct  1284  VESLAGAIYVDSGYDKKIVFQSISPLLQPLITPETLKLHPVRELNEHCQKMHYDMKKPVK  1343

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                +G A  TIEV ANG     +S+A N+KTA +LAC+ +
Sbjct  1344  TSHNGVAAITIEVEANGFTYEHTSTASNKKTALKLACKEV  1383


 Score = 68.9 bits (167),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S++KA L+ +ILH+S  L   I   ++N E+ S  STFGW  +T
Sbjct  1215  LTDMRSASVNNDCYARSAIKAELYKHILHASHKLHKDIVYTIENFERLSTESTFGWESET  1274

Query  535   SFP  527
             SFP
Sbjct  1275  SFP  1277



>ref|XP_010101236.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB88160.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1429

 Score =   106 bits (264),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF+ IRP+LEP++TPE+++L+P KEL ELCQK  + MK+PV 
Sbjct  1319  IESLAGAIFVDSGYDKELVFQSIRPLLEPLITPETVKLHPAKELNELCQKMHFDMKKPVK  1378

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++G +  TIEV ANG     +S+  ++K  K++AC+ +
Sbjct  1379  SRENGVSSITIEVEANGVTYRHTSNVSDKKIGKKVACKEV  1418


 Score = 74.7 bits (182),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYALS+VKAGL  +IL++S  L   IA+ + N E+ S+ STFGW  +T
Sbjct  1250  LTDMRSASVNNDCYALSAVKAGLQKHILYTSHQLHKEIANTIINFEKLSSESTFGWESET  1309

Query  535   SFP  527
             SFP
Sbjct  1310  SFP  1312



>gb|KJB14793.1| hypothetical protein B456_002G143000 [Gossypium raimondii]
Length=1393

 Score =   110 bits (274),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             MESIAGAI++DSG   + VF  IRP+LEP++T E++ ++PVKEL ELCQK+ Y  ++P+V
Sbjct  1284  MESIAGAIFVDSGYNKETVFRSIRPLLEPLITLETMTVHPVKELNELCQKKHYEQRKPIV  1343

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H +G +  TIEV ANG V   +S+A ++K AK+LA + +
Sbjct  1344  SHGNGVSSVTIEVEANGEVLKHTSTACDKKMAKKLASKEI  1383


 Score = 70.9 bits (172),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VKAGLH +IL SS  L   I + V++ ++ S   TFGW  + 
Sbjct  1215  LTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYKHIKETVESFQELSLDCTFGWESEK  1274

Query  535   SFP  527
             SFP
Sbjct  1275  SFP  1277



>ref|XP_008240740.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=804

 Score =   106 bits (265),  Expect(2) = 6e-36, Method: Composition-based stats.
 Identities = 54/99 (55%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAI++DS    + VF+ IRP+LEP+VTPE++ LNPVKE  + CQK +Y MK+PV 
Sbjct  697  IESLAGAIFVDSEYDKNAVFQSIRPLLEPLVTPETMPLNPVKEFHDYCQKMQYIMKKPVK  756

Query  347  VHKDGEACTTIEVMANGGVR-SCSSSARNRKTAKRLACE  234
              ++G A  TIEV ANG V+ + +S+A N  TAKRLAC+
Sbjct  757  SIQNGVATRTIEVEANGVVKHTHTSTASNNDTAKRLACK  795


 Score = 72.4 bits (176),  Expect(2) = 6e-36, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYA ++V+AGLH +IL S + L + IA+ V N E+ S  STFGW  +T
Sbjct  628  LTDMRSASVNNVCYARTAVRAGLHKHILASDSVLHTDIANTVNNFERLSMESTFGWESET  687

Query  535  SF  530
            SF
Sbjct  688  SF  689



>ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
 gb|EEE89564.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
Length=1468

 Score =   105 bits (262),  Expect(2) = 8e-36, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++VFE IRP+LEP++TPE+LRL PV+EL ELCQ++ +  K+P+V
Sbjct  1351  IESLAGAILVDSGYNKEVVFESIRPLLEPLITPETLRLQPVRELNELCQRQHFDYKKPIV  1410

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                   A  TIEV ANG +   +++  ++ TAK+LA + +
Sbjct  1411  SRNGRNASVTIEVEANGLIFKHTATVADKTTAKKLASKEV  1450


 Score = 72.4 bits (176),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYALS+VK GL  +ILH+S  L   I   VK I++ S  STFGW  +T
Sbjct  1282  LTDLRSASVNNDCYALSAVKVGLDRHILHASHDLHKHIVATVKKIQEFSLESTFGWESET  1341

Query  535   SFP  527
             +FP
Sbjct  1342  AFP  1344



>gb|KDP26899.1| hypothetical protein JCGZ_18057 [Jatropha curcas]
Length=424

 Score =   104 bits (260),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAIY+DSG   + VF  IRP+LEP++TPE++RL+PV+EL ELCQK  +   + VV
Sbjct  308  IESLAGAIYVDSGYNKEAVFRSIRPLLEPLITPETIRLHPVRELNELCQKNNFEKSKSVV  367

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              K+G    T EV+A+G +   +S A ++KTAKR+A + +
Sbjct  368  QRKNGMYSVTEEVVAHGEIFKHTSEAADKKTAKRVASKEV  407


 Score = 72.0 bits (175),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYA S+V+ GLH YI H+S  L   IA  V+N    S++ TFGW  +T
Sbjct  239  LTDMRSASVNNDCYAQSAVRGGLHKYICHASQKLHKDIAIAVENFNNVSSAPTFGWESET  298

Query  535  SFP  527
            SFP
Sbjct  299  SFP  301



>ref|XP_011006570.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Populus euphratica]
Length=1406

 Score =   107 bits (268),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG + ++VFE IRP+LEP++TPE+LRL PV+EL ELCQ++ +  K+P+V
Sbjct  1289  IESLAGAILVDSGYKKEVVFESIRPLLEPLITPETLRLQPVRELNELCQRQHFDYKKPIV  1348

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                   A  TIEV ANG +   +++  ++KTA++LA + +
Sbjct  1349  SRNGRNASVTIEVEANGLIFKHTATVADKKTAQKLASKEV  1388


 Score = 68.2 bits (165),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VK GL  +ILH+S  L   I   VK  ++ S  STFGW  +T
Sbjct  1220  LTDLRSASVNNDCYAQSAVKVGLDRHILHASHDLHKHIVATVKKFQEFSLESTFGWESET  1279

Query  535   SFP  527
             +FP
Sbjct  1280  AFP  1282



>gb|KDO45678.1| hypothetical protein CISIN_1g0030622mg, partial [Citrus sinensis]
Length=346

 Score =   103 bits (257),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES++GAI++DSG   ++VFE IRP+LEPM+TPE++RL P +EL E CQK  + MK+ V 
Sbjct  236  IESLSGAIFVDSGCNKEVVFESIRPLLEPMITPETMRLQPARELNEYCQKHHFSMKKTVA  295

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               +G+A  T+EV ANG +   + +  +++TAK++A + +
Sbjct  296  PRINGKAAVTVEVHANGTLFKHTHADADKETAKKVASKEV  335


 Score = 71.6 bits (174),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYALSSVK GLH +ILH+S  L   I   V + E+ S  STFGW  +T
Sbjct  167  LTDMRSASVNNDCYALSSVKHGLHKHILHASQELYKWINITVDSFERLSLESTFGWESET  226

Query  535  SFP  527
            SFP
Sbjct  227  SFP  229



>ref|XP_006480488.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480489.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Citrus 
sinensis]
Length=1401

 Score =   103 bits (256),  Expect(2) = 8e-35, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES++GAI++DSG   ++VFE IRP+LEPM+TPE++RL P +EL E CQK  + MK+ V 
Sbjct  1286  IESLSGAIFVDSGCNKEVVFESIRPLLEPMITPETMRLQPARELNEYCQKHHFAMKKTVA  1345

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                +G+A  T+EV ANG +   + +  +++TAK++A + +
Sbjct  1346  PRINGKAAVTVEVHANGTLFKHTHADADKETAKKVASKEV  1385


 Score = 71.6 bits (174),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYALSSVK GLH +ILH+S  L   I   V + E+ S  STFGW  +T
Sbjct  1217  LTDMRSASVNNDCYALSSVKHGLHKHILHASQELYKWINITVDSFERLSLESTFGWESET  1276

Query  535   SFP  527
             SFP
Sbjct  1277  SFP  1279



>ref|XP_006428678.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
 gb|ESR41918.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
Length=1401

 Score =   103 bits (256),  Expect(2) = 8e-35, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES++GAI++DSG   ++VFE IRP+LEPM+TPE++RL P +EL E CQK  + MK+ V 
Sbjct  1286  IESLSGAIFVDSGCNKEVVFESIRPLLEPMITPETMRLQPARELNEYCQKHHFAMKKTVA  1345

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                +G+A  T+EV ANG +   + +  +++TAK++A + +
Sbjct  1346  PRINGKAAVTVEVHANGTLFKHTHADADKETAKKVASKEV  1385


 Score = 71.6 bits (174),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYALSSVK GLH +ILH+S  L   I   V + E+ S  STFGW  +T
Sbjct  1217  LTDMRSASVNNDCYALSSVKHGLHKHILHASQELYKWINITVDSFERLSLESTFGWESET  1276

Query  535   SFP  527
             SFP
Sbjct  1277  SFP  1279



>ref|XP_006480490.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006480491.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006480492.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X5 [Citrus 
sinensis]
Length=1401

 Score =   103 bits (256),  Expect(2) = 9e-35, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES++GAI++DSG   ++VFE IRP+LEPM+TPE++RL P +EL E CQK  + MK+ V 
Sbjct  1286  IESLSGAIFVDSGCNKEVVFESIRPLLEPMITPETMRLQPARELNEYCQKHHFAMKKTVA  1345

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                +G+A  T+EV ANG +   + +  +++TAK++A + +
Sbjct  1346  PRINGKAAVTVEVHANGTLFKHTHADADKETAKKVASKEV  1385


 Score = 71.6 bits (174),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYALSSVK GLH +ILH+S  L   I   V + E+ S  STFGW  +T
Sbjct  1217  LTDMRSASVNNDCYALSSVKHGLHKHILHASQELYKWINITVDSFERLSLESTFGWESET  1276

Query  535   SFP  527
             SFP
Sbjct  1277  SFP  1279



>gb|AFD22619.1| dicer-like 2 protein [Nicotiana attenuata]
Length=1403

 Score = 99.4 bits (246),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   D+VF+ +R +LEP++TP++++L+PV+EL+ELC ++ Y  K+ VV
Sbjct  1293  IESLAGAIFVDSGFNKDVVFQSVRTLLEPLITPDTVKLHPVRELSELCDQKGYIKKKNVV  1352

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++G A  T+EV A+G     + S R++K A+++AC+ +
Sbjct  1353  SRENGVAYITVEVEADGVSHKFTCSERDKKMAEKVACKNV  1392


 Score = 74.3 bits (181),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             +T+LRS SVNN CYA ++VKAGLH +ILH+S  L+  I + V N E+   +STFGW  +T
Sbjct  1224  ITDLRSASVNNECYAQAAVKAGLHKHILHASQDLQRQIVNTVLNFEKLDPASTFGWESET  1283

Query  535   SFP  527
             +FP
Sbjct  1284  TFP  1286



>ref|XP_008240779.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=781

 Score =   105 bits (261),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAI++DS    + VF+ IRP+LEP+V+PE++ LNPV+E  + CQK +Y MK+PV 
Sbjct  674  IESLAGAIFVDSEYDKNAVFQSIRPLLEPLVSPETMPLNPVREFHDYCQKMQYIMKKPVK  733

Query  347  VHKDGEACTTIEVMANGGVR-SCSSSARNRKTAKRLACERM  228
              ++G A  TIEV ANG V+ + +S+A N  TAKRLAC+  
Sbjct  734  SIQNGVATRTIEVEANGVVKYTYTSTASNNDTAKRLACKEF  774


 Score = 67.8 bits (164),  Expect(2) = 3e-34, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYALS+VKA LH +IL +S  + S+IA+ V N E+ S  STFGW   T
Sbjct  606  LTDMRSASVNNNCYALSAVKARLHEHIL-ASDNVHSNIANTVNNFERLSMESTFGWESDT  664

Query  535  SF  530
            SF
Sbjct  665  SF  666



>ref|XP_009625898.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana tomentosiformis]
Length=1403

 Score =   100 bits (249),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   D+VF+ IR +LEP++TP++++L+PV+EL+ELC ++ Y  K+ VV
Sbjct  1293  IESLAGAIFVDSGFNKDVVFQSIRTLLEPLITPDTVKLHPVRELSELCDQKGYIKKKNVV  1352

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++G A  T+EV A+G     + S R++K A+++AC+ +
Sbjct  1353  SRENGVAYITVEVEADGVSHKFTCSERDKKMAEKVACKNV  1392


 Score = 72.4 bits (176),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             +T+LRS SVNN CYA ++VKAGLH +ILH+S  L+  + + V N E+    STFGW  +T
Sbjct  1224  ITDLRSASVNNECYAQAAVKAGLHKHILHASQDLQRQMVNTVLNFEKLDPVSTFGWESET  1283

Query  535   SFP  527
             +FP
Sbjct  1284  TFP  1286



>ref|XP_011015068.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011015076.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Populus 
euphratica]
 ref|XP_011015084.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
Length=1409

 Score =   100 bits (248),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   +IVF+ IRP+LEP++TP ++RL+P +EL+ELCQK+ +  K+ VV
Sbjct  1291  IESLAGAILVDSGYNKEIVFQSIRPLLEPLITPATVRLHPARELSELCQKQHFDYKKSVV  1350

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
                   A  TI V ANG +   +++A N+KTAK+LA
Sbjct  1351  PCNGRNASVTIVVGANGVIFKHTATAANKKTAKKLA  1386


 Score = 71.2 bits (173),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILH+S  L   I +  +  ++SS  STFGW  +T
Sbjct  1222  LTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHKQIVETAEIFQKSSLGSTFGWESET  1281

Query  535   SFP  527
             SFP
Sbjct  1282  SFP  1284



>ref|XP_010038609.1| PREDICTED: endoribonuclease Dicer homolog 2 [Eucalyptus grandis]
Length=1403

 Score =   100 bits (250),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DS    + VF+ IRP+LEP+VTPE++RL+PV+EL+ELCQK ++ + +P+V
Sbjct  1293  IESLAGAILVDSNYDKERVFQSIRPLLEPLVTPETVRLHPVRELSELCQKERFILGKPIV  1352

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               +DG +  TI+V A G V   ++   ++KTAKRLA
Sbjct  1353  SREDGVSSVTIQVEAEGVVYCHTTREADKKTAKRLA  1388


 Score = 70.5 bits (171),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN  YA S++K GLH +ILH+S  L   IAD   N E+ S+  TFGW  +T
Sbjct  1224  LTDLRSASVNNNFYAQSAMKVGLHKHILHASHVLHKHIADVANNFEKLSSEFTFGWESET  1283

Query  535   SFP  527
             SFP
Sbjct  1284  SFP  1286



>gb|KCW84635.1| hypothetical protein EUGRSUZ_B01461 [Eucalyptus grandis]
Length=1194

 Score =   100 bits (249),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DS    + VF+ IRP+LEP+VTPE++RL+PV+EL+ELCQK ++ + +P+V
Sbjct  1084  IESLAGAILVDSNYDKERVFQSIRPLLEPLVTPETVRLHPVRELSELCQKERFILGKPIV  1143

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               +DG +  TI+V A G V   ++   ++KTAKRLA
Sbjct  1144  SREDGVSSVTIQVEAEGVVYCHTTREADKKTAKRLA  1179


 Score = 70.5 bits (171),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN  YA S++K GLH +ILH+S  L   IAD   N E+ S+  TFGW  +T
Sbjct  1015  LTDLRSASVNNNFYAQSAMKVGLHKHILHASHVLHKHIADVANNFEKLSSEFTFGWESET  1074

Query  535   SFP  527
             SFP
Sbjct  1075  SFP  1077



>ref|XP_009783913.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana sylvestris]
Length=1403

 Score = 98.6 bits (244),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 44/100 (44%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   DIVF+ +R +LEP++TP++++L+PV+EL+ELC ++ Y  K+ VV
Sbjct  1293  IESLAGAIFVDSGFNKDIVFQSVRTLLEPLITPDTVKLHPVRELSELCDQKGYIKKKNVV  1352

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                +G A  T+EV A+G     + S R++K A+++AC+ +
Sbjct  1353  SRVNGVAYITVEVEADGVSHKFTCSERDKKMAEKVACKNV  1392


 Score = 72.4 bits (176),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             +T+LRS SVNN CYA ++V+AGLH +ILH+S  L+  I + V N E+    STFGW  +T
Sbjct  1224  ITDLRSASVNNECYAQAAVRAGLHKHILHASQDLQRQIVNTVLNFEKLDPVSTFGWESET  1283

Query  535   SFP  527
             +FP
Sbjct  1284  TFP  1286



>emb|CDP04170.1| unnamed protein product [Coffea canephora]
Length=1351

 Score =   103 bits (258),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   D+VF+ IRP+LEPM+TP+ L+L+PV+E  ELCQK  Y   +   
Sbjct  1239  IESLAGAILIDSGYNKDVVFQSIRPLLEPMITPDKLKLHPVREFHELCQKEGYIRNKRDW  1298

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +++G+A  T+EV ANG   + S SA ++ TAK+LAC+ +
Sbjct  1299  NYENGKATITLEVEANGITHNYSCSAADKNTAKKLACKAL  1338


 Score = 66.6 bits (161),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS S +N CYA S+VKAGL+ +IL++S  L+  I   V+N EQ S  STFGW  +T
Sbjct  1170  LTDLRSASASNDCYAQSAVKAGLYKHILYASQELQRHIVSAVQNFEQLSMDSTFGWESET  1229

Query  535   SFP  527
               P
Sbjct  1230  KIP  1232



>ref|XP_011015091.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Populus 
euphratica]
Length=1408

 Score = 99.0 bits (245),  Expect(2) = 2e-33, Method: Composition-based stats.
 Identities = 51/108 (47%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   +IVF+ IRP+LEP++TP ++RL+P +EL+ELCQK+ +  K+ VV
Sbjct  1290  IESLAGAILVDSGYNKEIVFQSIRPLLEPLITPATVRLHPARELSELCQKQHFDYKKSVV  1349

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERMlellesET  204
                   A  TI V ANG +   +++A N+KTAK+LA + +L+ L+  T
Sbjct  1350  PCNGRNASVTIVVGANGVIFKHTATAANKKTAKKLASKEVLKSLKEST  1397


 Score = 71.2 bits (173),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILH+S  L   I +  +  ++SS  STFGW  +T
Sbjct  1221  LTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHKQIVETAEIFQKSSLGSTFGWESET  1280

Query  535   SFP  527
             SFP
Sbjct  1281  SFP  1283



>ref|XP_011015099.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Populus 
euphratica]
Length=1407

 Score = 99.0 bits (245),  Expect(2) = 2e-33, Method: Composition-based stats.
 Identities = 51/108 (47%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   +IVF+ IRP+LEP++TP ++RL+P +EL+ELCQK+ +  K+ VV
Sbjct  1289  IESLAGAILVDSGYNKEIVFQSIRPLLEPLITPATVRLHPARELSELCQKQHFDYKKSVV  1348

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERMlellesET  204
                   A  TI V ANG +   +++A N+KTAK+LA + +L+ L+  T
Sbjct  1349  PCNGRNASVTIVVGANGVIFKHTATAANKKTAKKLASKEVLKSLKEST  1396


 Score = 71.2 bits (173),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILH+S  L   I +  +  ++SS  STFGW  +T
Sbjct  1220  LTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHKQIVETAEIFQKSSLGSTFGWESET  1279

Query  535   SFP  527
             SFP
Sbjct  1280  SFP  1282



>ref|XP_011084676.1| PREDICTED: endoribonuclease Dicer homolog 2 [Sesamum indicum]
Length=1398

 Score =   110 bits (276),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF+ +RP+LEP+VTPE+L+L+PV+EL ELCQ   Y  K+  V
Sbjct  1287  IESLAGAIFVDSGYNMEVVFQCVRPLLEPLVTPETLKLHPVRELVELCQSEHYVFKKTTV  1346

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
              +++G+AC T+EV A+G V        +RKTAKRLAC+
Sbjct  1347  CNQNGKACATVEVEASGVVYKEMRCEADRKTAKRLACK  1384


 Score = 59.3 bits (142),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA ++VKA L+ ++LH+S  L   I   V N     ++STFGW  +T
Sbjct  1218  LTDLRSASVNNDCYAQAAVKAELYKHVLHASPELHRHIVHAVCNHVVVPSASTFGWESET  1277

Query  535   SFP  527
             ++P
Sbjct  1278  NYP  1280



>ref|XP_007217819.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
 gb|EMJ19018.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
Length=758

 Score =   103 bits (256),  Expect(2) = 4e-33, Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAI++DS    + VF+ IRP+LEP+V+PE++ LNP KE  + CQK +Y MK+PV 
Sbjct  651  IESLAGAIFVDSEYDKNAVFKSIRPLLEPLVSPETMPLNPAKEFHDYCQKMQYIMKKPVK  710

Query  347  VHKDGEACTTIEVMANGGVR-SCSSSARNRKTAKRLAC  237
              ++G A  TIEV ANG V+ + +S+A N  TAKRLAC
Sbjct  711  SIQNGVATRTIEVEANGVVKYTHTSTASNNDTAKRLAC  748


 Score = 65.9 bits (159),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYA ++V+AGLH +IL S   L + IA+ V N    SA STFGW  +T
Sbjct  582  LTDMRSASVNNICYARTAVRAGLHKHILASDCVLHTDIANTVNNFGSLSAESTFGWESET  641

Query  535  SF  530
             F
Sbjct  642  YF  643



>ref|XP_007216887.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
 gb|EMJ18086.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
Length=752

 Score =   105 bits (262),  Expect(2) = 6e-33, Method: Composition-based stats.
 Identities = 53/99 (54%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAI++DS    + VF+ IRP+LEP+V+PE++ LNPVKE  + CQK +Y MK+PV 
Sbjct  645  IESLAGAIFVDSEYDKNAVFQSIRPLLEPLVSPETMPLNPVKEFHDYCQKMQYIMKKPVK  704

Query  347  VHKDGEACTTIEVMANGGVR-SCSSSARNRKTAKRLACE  234
              ++G A  TIEV ANG V+ + +S+A N  TAKRLAC+
Sbjct  705  SIQNGVATRTIEVEANGVVKYTYTSTASNNDTAKRLACK  743


 Score = 63.2 bits (152),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYALS+VK  LH +IL +   + S+IA+ V N E+ S  STFGW  +T
Sbjct  577  LTDMRSASVNNNCYALSAVKHRLHEHIL-APDNVHSNIANTVNNFERLSMESTFGWESET  635

Query  535  SF  530
            SF
Sbjct  636  SF  637



>ref|XP_002315119.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
 gb|EEF01290.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
Length=1408

 Score = 98.2 bits (243),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   +IVF+ IRP+LEP++TP ++RL+P +EL+ELCQK+ +  K+ VV
Sbjct  1290  IESLAGAILVDSGYNKEIVFQSIRPLLEPLITPATVRLHPARELSELCQKQHFDYKKSVV  1349

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +    A  TI V ANG     +++A ++KTAK+LA + +
Sbjct  1350  SYNGRNASITIVVGANGVTFKHTATAADKKTAKKLASKEV  1389


 Score = 69.7 bits (169),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VK  LH +ILH+S  L   I +  +  ++SS  STFGW  +T
Sbjct  1221  LTDLRSASVNNDCYAQSAVKGDLHKHILHTSQDLHKHIVETAEIFQKSSLGSTFGWESET  1280

Query  535   SFP  527
             SFP
Sbjct  1281  SFP  1283



>ref|XP_010312608.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Solanum lycopersicum]
Length=1406

 Score = 94.7 bits (234),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 47/112 (42%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = -1

Query  545   AQDKFP------MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC  384
             A+  FP      +ES+ GAI++DSG   +  F+ IRP+LEP+VTP++L+ +PV+EL+ELC
Sbjct  1281  AETTFPKVLGDVIESLGGAIFVDSGFDKETTFQCIRPLLEPLVTPQTLKPHPVRELSELC  1340

Query  383   QKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              ++ Y  K+ VV  ++G A  T+EV ANG V   + S R++  AK++A + +
Sbjct  1341  DQKGYIRKKDVVSRENGIAYITVEVEANGVVHKSTCSGRDKLIAKKVASKNV  1392


 Score = 72.8 bits (177),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             +T+LRS SVNN CYA S+VKAGLH +ILH+S  L+  I   V++ ++ +  STFGW  +T
Sbjct  1224  ITDLRSASVNNECYAQSAVKAGLHKHILHASQDLQRQICSTVEDFDKLNLDSTFGWEAET  1283

Query  535   SFP  527
             +FP
Sbjct  1284  TFP  1286



>ref|XP_010673887.1| PREDICTED: endoribonuclease Dicer homolog 2 [Beta vulgaris subsp. 
vulgaris]
Length=1432

 Score = 98.2 bits (243),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF+ I P+LEP++TP++L+LNPV EL  LCQ   Y M +   
Sbjct  1323  IESLAGAIFVDSGFNKEVVFKSISPLLEPLITPKTLKLNPVSELNHLCQTHHYTMTKKKT  1382

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               ++G A  TIEV ANG V   + +A +RKTAK+LA
Sbjct  1383  C-ENGVASITIEVEANGVVHRHTRTASDRKTAKKLA  1417


 Score = 68.9 bits (167),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CY L +++AGLH +ILH+S  L   +A  V + +QSS  STFGW  + 
Sbjct  1254  LTDLRSASVNNECYGLCAIRAGLHKHILHASQILYKQMAAAVASFQQSSLESTFGWESEI  1313

Query  535   SFP  527
             + P
Sbjct  1314  NLP  1316



>ref|XP_004303843.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Fragaria vesca 
subsp. vesca]
Length=1393

 Score = 94.4 bits (233),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 44/100 (44%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+ GAI++DSG   ++VF+ IRP+LEP++T E++RL+P +EL E C K  Y MK+P+ 
Sbjct  1282  IESLGGAIFVDSGYDKNVVFQSIRPLLEPLITLETMRLHPARELNEFCAKMHYDMKKPLK  1341

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++  A  TIEV ANG     +S A ++KT  +LA + +
Sbjct  1342  SFENDVATITIEVEANGVTYKHTSKASDKKTGIKLASKEV  1381


 Score = 72.4 bits (176),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA SSVKA LH +ILH+S  L   I   V N E+    STFGW  +T
Sbjct  1213  LTDMRSASVNNDCYARSSVKAELHKHILHASQKLHREIVHTVDNFEKLHTESTFGWESET  1272

Query  535   SFP  527
             SFP
Sbjct  1273  SFP  1275



>ref|XP_010649216.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Vitis 
vinifera]
Length=1460

 Score = 97.1 bits (240),  Expect(2) = 3e-32, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 78/112 (70%), Gaps = 8/112 (7%)
 Frame = -1

Query  545   AQDKFP------MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC  384
             ++  FP      +ES+AGAI +DS    ++VF+ IRP+LEP++TPE+++L+P +EL ELC
Sbjct  1273  SESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEPLITPETVKLHPARELGELC  1332

Query  383   QKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
             QK  Y +K  VVV ++G+A  TIEV ANG     +S++ +++TA +LA + +
Sbjct  1333  QKEHYDIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DKRTATKLASKEV  1382


 Score = 69.7 bits (169),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I   V N ++    STFGW  ++
Sbjct  1216  LTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHIVVTVGNFDKLPVESTFGWESES  1275

Query  535   SFP  527
             SFP
Sbjct  1276  SFP  1278



>ref|XP_010649214.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Vitis 
vinifera]
Length=1468

 Score = 97.1 bits (240),  Expect(2) = 3e-32, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 78/112 (70%), Gaps = 8/112 (7%)
 Frame = -1

Query  545   AQDKFP------MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC  384
             ++  FP      +ES+AGAI +DS    ++VF+ IRP+LEP++TPE+++L+P +EL ELC
Sbjct  1281  SESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEPLITPETVKLHPARELGELC  1340

Query  383   QKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
             QK  Y +K  VVV ++G+A  TIEV ANG     +S++ +++TA +LA + +
Sbjct  1341  QKEHYDIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DKRTATKLASKEV  1390


 Score = 69.7 bits (169),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I   V N ++    STFGW  ++
Sbjct  1224  LTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHIVVTVGNFDKLPVESTFGWESES  1283

Query  535   SFP  527
             SFP
Sbjct  1284  SFP  1286



>ref|XP_010649215.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Vitis 
vinifera]
Length=1461

 Score = 96.7 bits (239),  Expect(2) = 3e-32, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 78/112 (70%), Gaps = 8/112 (7%)
 Frame = -1

Query  545   AQDKFP------MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC  384
             ++  FP      +ES+AGAI +DS    ++VF+ IRP+LEP++TPE+++L+P +EL ELC
Sbjct  1281  SESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEPLITPETVKLHPARELGELC  1340

Query  383   QKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
             QK  Y +K  VVV ++G+A  TIEV ANG     +S++ +++TA +LA + +
Sbjct  1341  QKEHYDIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DKRTATKLASKEV  1390


 Score = 69.7 bits (169),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I   V N ++    STFGW  ++
Sbjct  1224  LTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHIVVTVGNFDKLPVESTFGWESES  1283

Query  535   SFP  527
             SFP
Sbjct  1284  SFP  1286



>ref|XP_010649218.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Vitis 
vinifera]
Length=1405

 Score = 96.3 bits (238),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DS    ++VF+ IRP+LEP++TPE+++L+P +EL ELCQK  Y +K  VV
Sbjct  1293  IESLAGAILVDSDYNKEVVFQSIRPLLEPLITPETVKLHPARELGELCQKEHYDIKR-VV  1351

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             V ++G+A  TIEV ANG     +S++ +++TA +LA
Sbjct  1352  VSQNGKASVTIEVEANGAKHKHTSTS-DKRTATKLA  1386


 Score = 69.7 bits (169),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I   V N ++    STFGW  ++
Sbjct  1224  LTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHIVVTVGNFDKLPVESTFGWESES  1283

Query  535   SFP  527
             SFP
Sbjct  1284  SFP  1286



>emb|CBI17597.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score = 96.3 bits (238),  Expect(2) = 4e-32, Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DS    ++VF+ IRP+LEP++TPE+++L+P +EL ELCQK  Y +K  VV
Sbjct  1230  IESLAGAILVDSDYNKEVVFQSIRPLLEPLITPETVKLHPARELGELCQKEHYDIKR-VV  1288

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
             V ++G+A  TIEV ANG     +S++ +++TA +LA + +
Sbjct  1289  VSQNGKASVTIEVEANGAKHKHTSTS-DKRTATKLASKEV  1327


 Score = 69.7 bits (169),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I   V N ++    STFGW  ++
Sbjct  1161  LTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHIVVTVGNFDKLPVESTFGWESES  1220

Query  535   SFP  527
             SFP
Sbjct  1221  SFP  1223



>ref|XP_010312606.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Solanum 
lycopersicum]
Length=1406

 Score = 96.7 bits (239),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   D  F  IRP+LEP++TP++L+++P +EL ELC ++ Y  ++ VV
Sbjct  1296  IESLAGAIFVDSGFNQDTTFLCIRPLLEPLITPQTLKVHPARELRELCHQKGYIKQKNVV  1355

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++G    T+EV ANG +   S+S RN+K A+++A + +
Sbjct  1356  FRENGIVYVTVEVEANGVIHKDSNSGRNQKMAEKVASKYL  1395


 Score = 68.9 bits (167),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             +T+LRS SVNN CYALS+VKAGLH++IL+    L+  I+  V++ ++ +  STFGW  +T
Sbjct  1227  ITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQRHISSTVEDFKKLNLVSTFGWEAET  1286

Query  535   SFP  527
             ++P
Sbjct  1287  TYP  1289



>gb|EYU39730.1| hypothetical protein MIMGU_mgv1a0003142mg, partial [Erythranthe 
guttata]
Length=1143

 Score = 97.4 bits (241),  Expect(2) = 5e-32, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   +IVF+ +RP+LEP+VT E+LRL+PV+EL ELCQ+  +  ++ +V
Sbjct  1035  IESLAGAIFVDSGHNKEIVFQSLRPLLEPLVTLETLRLHPVRELNELCQREHFNFQK-LV  1093

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
                +G    TIEV A G V   + SA ++ TAKRLAC+
Sbjct  1094  TKLNGLVYATIEVEARGVVHKETRSAADKDTAKRLACK  1131


 Score = 68.2 bits (165),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKAGLH +ILH S  L   I   + N ++ ++ STFGW  +T
Sbjct  966   LTDLRSASVNNDCYANSAVKAGLHKHILHLSPELHRHINTALSNFDEINSKSTFGWESET  1025

Query  535   SFP  527
             ++P
Sbjct  1026  TYP  1028



>ref|XP_010312607.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Solanum 
lycopersicum]
Length=1370

 Score = 96.7 bits (239),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   D  F  IRP+LEP++TP++L+++P +EL ELC ++ Y  ++ VV
Sbjct  1260  IESLAGAIFVDSGFNQDTTFLCIRPLLEPLITPQTLKVHPARELRELCHQKGYIKQKNVV  1319

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++G    T+EV ANG +   S+S RN+K A+++A + +
Sbjct  1320  FRENGIVYVTVEVEANGVIHKDSNSGRNQKMAEKVASKYL  1359


 Score = 68.9 bits (167),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             +T+LRS SVNN CYALS+VKAGLH++IL+    L+  I+  V++ ++ +  STFGW  +T
Sbjct  1191  ITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQRHISSTVEDFKKLNLVSTFGWEAET  1250

Query  535   SFP  527
             ++P
Sbjct  1251  TYP  1253



>emb|CAN77284.1| hypothetical protein VITISV_043738 [Vitis vinifera]
Length=1296

 Score = 97.1 bits (240),  Expect(2) = 5e-32, Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DS    ++VF+ IRP+LEP++TPE+++L+P +EL ELCQK  Y +K  VV
Sbjct  1186  IESLAGAILVDSDYNKEVVFQSIRPLLEPLITPETVKLHPARELXELCQKEHYXIKR-VV  1244

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
             V ++G+A  TIEV ANG     +S++ +++TA +LA + +
Sbjct  1245  VSQNGKASVTIEVEANGAKHKHTSTS-DKRTAXKLASKEV  1283


 Score = 68.6 bits (166),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I   V + ++    STFGW  ++
Sbjct  1117  LTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHIVVTVGBFDKLPXESTFGWESES  1176

Query  535   SFP  527
             SFP
Sbjct  1177  SFP  1179



>gb|KEH42074.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1385

 Score = 96.7 bits (239),  Expect(2) = 8e-32, Method: Composition-based stats.
 Identities = 47/101 (47%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++V++ IRP+LEP+VTP++L ++P++ELTELCQK  Y M E  +
Sbjct  1274  IESLAGAIFVDSGYNKEVVWQSIRPLLEPLVTPDTLTIHPIRELTELCQKMNYTM-EKNL  1332

Query  347   VHKDGEACTTIEVMANGGVRSCS-SSARNRKTAKRLACERM  228
                DG     IEV+A+G +       + ++KTA RLAC+R+
Sbjct  1333  SRNDGVTSCRIEVIADGIIHQYEYKGSTDKKTATRLACKRV  1373


 Score = 68.2 bits (165),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA+S++K  LH ++LH+S  L   IA  +   ++ S+S TFGW  + 
Sbjct  1205  LTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHIAATLDKFDEQSSSQTFGWESEA  1264

Query  535   SFP  527
             SFP
Sbjct  1265  SFP  1267



>ref|XP_010312604.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312605.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
Length=1433

 Score = 95.1 bits (235),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   D  F  IRP+LEP++TP++L+++P +EL ELC ++ Y  ++ VV
Sbjct  1323  IESLAGAIFVDSGFNQDTTFLCIRPLLEPLITPQTLKVHPARELRELCHQKGYIKQKNVV  1382

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               ++G    T+EV ANG +   S+S RN+K A+++A + +
Sbjct  1383  FRENGIVYVTVEVEANGVIHKDSNSGRNQKMAEKVASKYL  1422


 Score = 68.9 bits (167),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             +T+LRS SVNN CYALS+VKAGLH++IL+    L+  I+  V++ ++ +  STFGW  +T
Sbjct  1254  ITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQRHISSTVEDFKKLNLVSTFGWEAET  1313

Query  535   SFP  527
             ++P
Sbjct  1314  TYP  1316



>ref|XP_010249398.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Nelumbo 
nucifera]
Length=1188

 Score =   102 bits (255),  Expect(2) = 5e-31, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DS    D+V++ ++P+LEP+VTP++++L+PV+EL ELCQ+  Y MK   V
Sbjct  1078  IESLAGAILVDSEYNKDVVWKSMQPLLEPIVTPDTVKLHPVRELHELCQRHSYVMKPYSV  1137

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
              +K+G A  TIEV A G   S + +  N+KTAKRLAC+
Sbjct  1138  SYKEGLASITIEVEAYGITYSHTCTGENKKTAKRLACK  1175


 Score = 59.3 bits (142),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN  YA +++KAGLH +ILH+S  L   I+  +   EQ +   T GW  + 
Sbjct  1009  LTDLRSASVNNDSYANAALKAGLHKHILHASPKLHQQISSILNYHEQINLGPTIGWDSEM  1068

Query  535   SFP  527
             +FP
Sbjct  1069  TFP  1071



>ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Nelumbo 
nucifera]
Length=1394

 Score =   102 bits (255),  Expect(2) = 6e-31, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DS    D+V++ ++P+LEP+VTP++++L+PV+EL ELCQ+  Y MK   V
Sbjct  1284  IESLAGAILVDSEYNKDVVWKSMQPLLEPIVTPDTVKLHPVRELHELCQRHSYVMKPYSV  1343

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
              +K+G A  TIEV A G   S + +  N+KTAKRLAC+
Sbjct  1344  SYKEGLASITIEVEAYGITYSHTCTGENKKTAKRLACK  1381


 Score = 59.3 bits (142),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN  YA +++KAGLH +ILH+S  L   I+  +   EQ +   T GW  + 
Sbjct  1215  LTDLRSASVNNDSYANAALKAGLHKHILHASPKLHQQISSILNYHEQINLGPTIGWDSEM  1274

Query  535   SFP  527
             +FP
Sbjct  1275  TFP  1277



>ref|XP_004486471.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cicer arietinum]
Length=1400

 Score = 94.7 bits (234),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTP++L+++PV+ELTELCQ+  Y M E  +
Sbjct  1289  IESLAGAILVDSGYNKEVVWKSIRPLLEPLVTPDTLKVHPVRELTELCQEMNYTM-EKTL  1347

Query  347   VHKDGEACTTIEVMANGGVRSCSSSAR-NRKTAKRLACE  234
                DG     +EV+A+G +         ++KTAKRLAC+
Sbjct  1348  SRNDGVTSCRVEVIADGVIHQSEYKGYADKKTAKRLACK  1386


 Score = 67.4 bits (163),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA+S++K  LH ++LH+S  L   I   +   ++ S+SSTFGW  + 
Sbjct  1220  LTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHIVATLDKFDEVSSSSTFGWESEA  1279

Query  535   SFP  527
             SFP
Sbjct  1280  SFP  1282



>emb|CDP06207.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 95.1 bits (235),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 71/100 (71%), Gaps = 9/100 (9%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAIY+DSG   ++VF+ I+P+LEP+VTPE+L+L P +EL ELC+K  +  KE   
Sbjct  644  IESLAGAIYVDSGYDKEVVFQSIKPLLEPLVTPETLKLQPGRELKELCEKENFVKKE---  700

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +DG+    +EV ANG +  C  +A N+KTA+++A  R+
Sbjct  701  --EDGK----LEVNANGAIYVCGLTAANKKTAEKIASMRI  734


 Score = 65.9 bits (159),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYI-LHSSTALRSSIADFVKNIEQSSASSTFGW  548
            LT+LRS SVNN CYA +++KAGLH +I LH S  L+  I   VKN +QSS  ST GW
Sbjct  575  LTDLRSASVNNDCYARAAIKAGLHQHILLHDSQHLKPRILAIVKNFKQSSQDSTSGW  631



>ref|XP_007147466.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147467.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147468.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19460.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19461.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19462.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
Length=1392

 Score = 94.4 bits (233),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTPE+L+L+P++E  ELCQKR YR+ + VV
Sbjct  1278  LESLAGAILVDSGYDKEVVWQSIRPLLEPLVTPETLKLHPIREFYELCQKRNYRIIQSVV  1337

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRK-TAKRLACERM  228
               KDG     + V A+G +          K TAK++ C+++
Sbjct  1338  SRKDGVTNYKMGVEADGVIHEYEYLGSALKDTAKKIVCKKL  1378


 Score = 65.9 bits (159),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  ++K GLH ++LH+S  L   IA  + N E+ S+SSTFG+  +T
Sbjct  1209  LTDMRSASVNNDCYAWCTIKHGLHKHVLHASQELHMHIAVTLDNFEKLSSSSTFGYESET  1268

Query  535   SFP  527
             S P
Sbjct  1269  SLP  1271



>ref|XP_007140643.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
 gb|ESW12637.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
Length=1420

 Score = 92.0 bits (227),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTPE+L+L+P++EL ELCQKR Y + + +V
Sbjct  1311  IESLAGAILVDSGYNKEVVWQSIRPLLEPLVTPETLKLHPIRELNELCQKRSYNIIQDIV  1370

Query  347   VHKDGEACTTIEVMANG  297
               KDG     +EV A+G
Sbjct  1371  TRKDGVTNYRMEVEADG  1387


 Score = 67.8 bits (164),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S++K GLH ++LH+S  L   IA  + + ++ S+SSTFG+ L+T
Sbjct  1242  LTDMRSASVNNDCYAWSAIKHGLHKHVLHASQELHKHIAISLDSFDKVSSSSTFGYELET  1301

Query  535   SFP  527
             S P
Sbjct  1302  SLP  1304



>ref|XP_006300010.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
 gb|EOA32908.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
Length=1392

 Score = 90.1 bits (222),  Expect(2) = 1e-29, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   D+VF  I+P+L  ++TPE+++L+PV+ELTELCQ+ ++ + + V 
Sbjct  1284  IESLAGAIFVDSGYNKDVVFASIKPLLGCLITPETVKLHPVRELTELCQREQFELSK-VQ  1342

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               K+GEA   +EV A G   + ++ A ++K AK+LA
Sbjct  1343  GFKNGEAYFVVEVKAKGMSFAHTAKASDKKMAKKLA  1378


 Score = 67.4 bits (163),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  +VKA LH +ILH+S  L   I+  V   E+SS  STFGW    
Sbjct  1215  LTDMRSASVNNDCYAQVAVKANLHKHILHASHDLHKHISRTVSEFERSSLQSTFGWESDI  1274

Query  535   SFP  527
             SFP
Sbjct  1275  SFP  1277



>ref|XP_006586847.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Glycine 
max]
Length=1387

 Score = 94.7 bits (234),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTPE+L+L+P++EL ELCQKR Y++    V
Sbjct  1279  IESLAGAILVDSGFNKEVVWQSIRPLLEPLVTPETLKLHPIRELNELCQKRSYKIVLEDV  1338

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARN-RKTAKRLACERM  228
               KDG     ++V A+G +     +    R TAK++AC+ +
Sbjct  1339  SRKDGVTNYRMKVEADGVIHEYEYTGPALRDTAKKIACKEI  1379


 Score = 62.4 bits (150),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++R+ SVNN CYA S++K GLH ++LH+S  L   IA  + N ++ S+SSTFG+  + 
Sbjct  1210  LTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHIAVTLNNFDKLSSSSTFGYESEA  1269

Query  535   SFP  527
             S P
Sbjct  1270  SPP  1272



>gb|KHN23014.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1324

 Score = 94.7 bits (234),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTPE+L+L+P++EL ELCQKR Y++    V
Sbjct  1216  IESLAGAILVDSGFNKEVVWQSIRPLLEPLVTPETLKLHPIRELNELCQKRSYKIVLEDV  1275

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARN-RKTAKRLACERM  228
               KDG     ++V A+G +     +    R TAK++AC+ +
Sbjct  1276  SRKDGVTNYRMKVEADGVIHEYEYTGPALRDTAKKIACKEI  1316


 Score = 62.4 bits (150),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++R+ SVNN CYA S++K GLH ++LH+S  L   IA  + N ++ S+SSTFG+  + 
Sbjct  1147  LTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHIAVTLNNFDKLSSSSTFGYESEA  1206

Query  535   SFP  527
             S P
Sbjct  1207  SPP  1209



>ref|XP_003534774.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
Length=1421

 Score = 94.4 bits (233),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTPE+L+L+P++EL ELCQKR Y++    V
Sbjct  1313  IESLAGAILVDSGFNKEVVWQSIRPLLEPLVTPETLKLHPIRELNELCQKRSYKIVLEDV  1372

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARN-RKTAKRLACERM  228
               KDG     ++V A+G +     +    R TAK++AC+ +
Sbjct  1373  SRKDGVTNYRMKVEADGVIHEYEYTGPALRDTAKKIACKEI  1413


 Score = 62.4 bits (150),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++R+ SVNN CYA S++K GLH ++LH+S  L   IA  + N ++ S+SSTFG+  + 
Sbjct  1244  LTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHIAVTLNNFDKLSSSSTFGYESEA  1303

Query  535   SFP  527
             S P
Sbjct  1304  SPP  1306



>ref|XP_006586846.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
Length=1420

 Score = 94.7 bits (234),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTPE+L+L+P++EL ELCQKR Y++    V
Sbjct  1312  IESLAGAILVDSGFNKEVVWQSIRPLLEPLVTPETLKLHPIRELNELCQKRSYKIVLEDV  1371

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARN-RKTAKRLACERM  228
               KDG     ++V A+G +     +    R TAK++AC+ +
Sbjct  1372  SRKDGVTNYRMKVEADGVIHEYEYTGPALRDTAKKIACKEI  1412


 Score = 62.4 bits (150),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++R+ SVNN CYA S++K GLH ++LH+S  L   IA  + N ++ S+SSTFG+  + 
Sbjct  1243  LTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHIAVTLNNFDKLSSSSTFGYESEA  1302

Query  535   SFP  527
             S P
Sbjct  1303  SPP  1305



>emb|CDP20270.1| unnamed protein product [Coffea canephora]
Length=353

 Score = 86.3 bits (212),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 9/96 (9%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            ++S+AGAIY+DSG   ++VF  I+P+LEP+ TPE+L+L PV+EL ELC K  + +KE   
Sbjct  245  IKSLAGAIYVDSGYDKEVVFRSIKPLLEPLPTPETLKLQPVRELEELCAKEHFDLKE---  301

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +DG+    ++V ANG + +   SA N+KTA++ A
Sbjct  302  --EDGK----LKVNANGVIYARRLSAANKKTARKTA  331


 Score = 67.8 bits (164),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW  548
            LT+LRS SVNN  YA +++K GLH +ILH S  L+  I   VKN +QSS  STFGW
Sbjct  177  LTDLRSASVNNDRYARTAIKTGLHKHILHDSQDLQRRILAIVKNFKQSSQDSTFGW  232



>ref|XP_010508928.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Camelina 
sativa]
Length=1355

 Score = 85.9 bits (211),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG    +VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ +     
Sbjct  1246  IESLAGAIFVDSGYNKSVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELST-AK  1304

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               K+GEA  T+EV A     + +S A ++K AK++A +++
Sbjct  1305  GFKNGEAYFTVEVKAKEMSFAHTSKASDKKLAKKMAYKQV  1344


 Score = 68.2 bits (165),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  +VKA LH +ILH+S  L   I+  V   E+SS  STFGW    
Sbjct  1177  LTDMRSASVNNECYAQVAVKANLHKHILHASHDLHKHISRTVSEFERSSLQSTFGWESDV  1236

Query  535   SFP  527
             SFP
Sbjct  1237  SFP  1239



>emb|CDO96787.1| unnamed protein product [Coffea canephora]
Length=349

 Score = 85.9 bits (211),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 9/96 (9%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            ++S+AGAIY+DSG   ++VF  I+P+LEP+ TPE+L+L PV+EL ELC K  + +KE   
Sbjct  241  IKSLAGAIYVDSGYDKEVVFRSIKPLLEPLPTPETLKLQPVRELEELCAKEHFDLKE---  297

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +DG+    ++V ANG + +   SA N+KTA++ A
Sbjct  298  --EDGK----LKVNANGVIYARRLSAANKKTARKTA  327


 Score = 67.8 bits (164),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW  548
            LT+LRS SVNN  YA +++K GLH +ILH S  L+  I   VKN +QSS  STFGW
Sbjct  173  LTDLRSASVNNDRYARTAIKTGLHKHILHDSQDLQRRILAIVKNFKQSSQDSTFGW  228



>ref|XP_010508629.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
 ref|XP_010508709.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
Length=1397

 Score = 85.5 bits (210),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG    +VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ +     
Sbjct  1288  IESLAGAIFVDSGYNKSVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELST-AK  1346

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               K+GEA  T+EV A     + +S A ++K AK++A +++
Sbjct  1347  GFKNGEAYFTVEVKAKEMSFAHTSKASDKKLAKKMAYKQV  1386


 Score = 68.2 bits (165),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  +VKA LH +ILH+S  L   I+  V   E+SS  STFGW    
Sbjct  1219  LTDMRSASVNNECYAQVAVKANLHKHILHASHDLHKHISRTVSEFERSSLQSTFGWESDV  1278

Query  535   SFP  527
             SFP
Sbjct  1279  SFP  1281



>ref|XP_010508779.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
 ref|XP_010508854.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
Length=1394

 Score = 85.5 bits (210),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG    +VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ +     
Sbjct  1285  IESLAGAIFVDSGYNKSVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELST-AK  1343

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               K+GEA  T+EV A     + +S A ++K AK++A +++
Sbjct  1344  GFKNGEAYFTVEVKAKEMSFAHTSKASDKKLAKKMAYKQV  1383


 Score = 67.8 bits (164),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  +VKA LH +ILH+S  L   I+  V   E+SS  STFGW    
Sbjct  1216  LTDMRSASVNNECYAQVAVKANLHKHILHASHDLHKHISRTVSEFERSSLQSTFGWESDV  1275

Query  535   SFP  527
             SFP
Sbjct  1276  SFP  1278



>ref|XP_003535104.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
 ref|XP_006586845.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
 gb|KHN23015.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1414

 Score = 92.4 bits (228),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTPE+L+L+P++EL ELCQKR Y++    V
Sbjct  1280  VESLAGAILVDSGYNKEVVWQSIRPLLEPLVTPETLKLHPIRELNELCQKRSYKIILEDV  1339

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARN-RKTAKRLACERM  228
               KDG     +EV A+G +          R TAK++ C+ +
Sbjct  1340  SRKDGLTYYRMEVEADGIIHKYEYKGDALRDTAKKIVCKEI  1380


 Score = 60.5 bits (145),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S++K GLH ++LH+S  L   ++  +   ++ S+ STFG+  +T
Sbjct  1211  LTDMRSASVNNDCYAWSAIKHGLHKHVLHASQELHMHVSATLNKFDKLSSLSTFGYEAET  1270

Query  535   SFP  527
             S P
Sbjct  1271  SLP  1273



>ref|XP_010549776.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Tarenaya 
hassleriana]
Length=1350

 Score = 90.9 bits (224),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 72/108 (67%), Gaps = 7/108 (6%)
 Frame = -1

Query  545   AQDKFP------MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC  384
             A+  FP      +ES+AGAI +DSG  T+ VF  I+P+L  MVTPE+L+++PV+ELTELC
Sbjct  1227  AETSFPKVLGDVIESLAGAILVDSGYNTEAVFASIQPLLGCMVTPETLKIHPVRELTELC  1286

Query  383   QKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             QK  + +K+     K+G+A  T+EV AN      +S A ++ TAKRLA
Sbjct  1287  QKEHFEIKKEKGF-KNGKAYFTVEVKANRETFVHTSKAPHKDTAKRLA  1333


 Score = 60.8 bits (146),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN  YA +++KA LH +ILH+S  L   +   V   E   + STFGW  +T
Sbjct  1170  LTDMRSASVNNDHYARAAMKAKLHKHILHASHDLHKHMTRTVDEFEHLPSDSTFGWEAET  1229

Query  535   SFP  527
             SFP
Sbjct  1230  SFP  1232



>ref|XP_007216896.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
 gb|EMJ18095.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
Length=806

 Score = 86.7 bits (213),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAI++DS    DIVF+ IRP+LEP+VTPE++ LN ++E  ++C+K +Y MK+P +
Sbjct  672  IESLAGAIFVDSEYDKDIVFQSIRPLLEPLVTPETMPLNHIREFKDICKKMQYIMKKPAI  731

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARN  264
               +G    TIEV A G V    +S  N
Sbjct  732  YTPNGVVTRTIEVEAKGVVIYKHTSTHN  759


 Score = 65.1 bits (157),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            +T++RS SVNN CYALS+VKAGLH +IL +S  + + IA+ V N  + S  STFGW ++T
Sbjct  604  ITDMRSASVNNDCYALSAVKAGLHKHIL-ASDNVDNDIANTVNNFGRLSIESTFGWEIET  662

Query  535  SF  530
             F
Sbjct  663  YF  664



>ref|XP_006604892.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Glycine 
max]
Length=788

 Score = 96.7 bits (239),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAI++DSG + ++VF+ I+P+LEP+VTPE+ R +P+ EL ELCQK+ Y+MK    
Sbjct  644  IESIAGAIFVDSGYKKEVVFQSIKPLLEPLVTPETARRHPISELHELCQKKGYKMKVYPP  703

Query  347  VHKDGEACTTIEVMANGGV--RSCSSSARNRKTAKRLACE  234
            V  +GE   TIEV  NG     +  + A N  TA++LA +
Sbjct  704  VRVNGETSVTIEVKTNGITYKNNPPAKASNNDTARKLAAK  743


 Score = 55.1 bits (131),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             T +RS SVNN CYALS++KA L  +IL  S  ++++IA  ++ ++  S  STFGW L+T
Sbjct  576  FTNMRSISVNNECYALSAIKAKLDEHILCDS-VVKNNIAQTMEGVKNLSLESTFGWELET  634

Query  535  SF  530
             F
Sbjct  635  YF  636



>ref|XP_003553782.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Glycine 
max]
Length=756

 Score = 96.7 bits (239),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAI++DSG + ++VF+ I+P+LEP+VTPE+ R +P+ EL ELCQK+ Y+MK    
Sbjct  644  IESIAGAIFVDSGYKKEVVFQSIKPLLEPLVTPETARRHPISELHELCQKKGYKMKVYPP  703

Query  347  VHKDGEACTTIEVMANGGV--RSCSSSARNRKTAKRLACE  234
            V  +GE   TIEV  NG     +  + A N  TA++LA +
Sbjct  704  VRVNGETSVTIEVKTNGITYKNNPPAKASNNDTARKLAAK  743


 Score = 55.1 bits (131),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             T +RS SVNN CYALS++KA L  +IL  S  ++++IA  ++ ++  S  STFGW L+T
Sbjct  576  FTNMRSISVNNECYALSAIKAKLDEHILCDS-VVKNNIAQTMEGVKNLSLESTFGWELET  634

Query  535  SF  530
             F
Sbjct  635  YF  636



>ref|XP_010549772.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549773.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549775.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
Length=1395

 Score = 90.9 bits (224),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 72/108 (67%), Gaps = 7/108 (6%)
 Frame = -1

Query  545   AQDKFP------MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC  384
             A+  FP      +ES+AGAI +DSG  T+ VF  I+P+L  MVTPE+L+++PV+ELTELC
Sbjct  1272  AETSFPKVLGDVIESLAGAILVDSGYNTEAVFASIQPLLGCMVTPETLKIHPVRELTELC  1331

Query  383   QKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             QK  + +K+     K+G+A  T+EV AN      +S A ++ TAKRLA
Sbjct  1332  QKEHFEIKKEKGF-KNGKAYFTVEVKANRETFVHTSKAPHKDTAKRLA  1378


 Score = 60.8 bits (146),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN  YA +++KA LH +ILH+S  L   +   V   E   + STFGW  +T
Sbjct  1215  LTDMRSASVNNDHYARAAMKAKLHKHILHASHDLHKHMTRTVDEFEHLPSDSTFGWEAET  1274

Query  535   SFP  527
             SFP
Sbjct  1275  SFP  1277



>ref|XP_003594551.1| Endoribonuclease Dicer [Medicago truncatula]
Length=1418

 Score = 91.7 bits (226),  Expect(2) = 8e-28, Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   + V++ IRP+LEP+VTP++L ++P++EL ELCQK  Y  KE  +
Sbjct  1312  IESLAGAIFVDSGYDKEAVWKSIRPLLEPLVTPDTLTIHPIRELNELCQKMNY-TKEKTL  1370

Query  347   VHKDGEACTTIEVMANGGVRSCS-SSARNRKTAKRLACE  234
                DG     IEV+A+G +       + ++KTA RLAC+
Sbjct  1371  SRNDGVTSCKIEVIADGVIHQFEYKGSTDKKTATRLACK  1409


 Score = 59.7 bits (143),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA+S++K  LH ++LH+S  L   I   +   +  S SS+FGW  + 
Sbjct  1244  LTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHIVATLDKFDDQS-SSSFGWESEA  1302

Query  535   SFP  527
             +FP
Sbjct  1303  TFP  1305



>gb|KHN43108.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=836

 Score = 96.3 bits (238),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAI++DSG + ++VF+ I+P+LEP+VTPE+ R +P+ EL ELCQK+ Y+MK    
Sbjct  692  IESIAGAIFVDSGYKKEVVFQSIKPLLEPLVTPETARRHPISELHELCQKKGYKMKVYPP  751

Query  347  VHKDGEACTTIEVMANGGV--RSCSSSARNRKTAKRLACE  234
            V  +GE   TIEV  NG     +  + A N  TA++LA +
Sbjct  752  VRVNGETSVTIEVKTNGITYKNNPPAKASNNDTARKLAAK  791


 Score = 55.1 bits (131),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             T +RS SVNN CYALS++KA L  +IL  S  ++++IA  ++ ++  S  STFGW L+T
Sbjct  624  FTNMRSISVNNECYALSAIKAKLDEHILCDS-VVKNNIAQTMEGVKNLSLESTFGWELET  682

Query  535  SF  530
             F
Sbjct  683  YF  684



>gb|AES64802.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1377

 Score = 91.3 bits (225),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   + V++ IRP+LEP+VTP++L ++P++EL ELCQK  Y  KE  +
Sbjct  1271  IESLAGAIFVDSGYDKEAVWKSIRPLLEPLVTPDTLTIHPIRELNELCQKMNY-TKEKTL  1329

Query  347   VHKDGEACTTIEVMANGGVRSCS-SSARNRKTAKRLACE  234
                DG     IEV+A+G +       + ++KTA RLAC+
Sbjct  1330  SRNDGVTSCKIEVIADGVIHQFEYKGSTDKKTATRLACK  1368


 Score = 59.7 bits (143),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA+S++K  LH ++LH+S  L   I   +   +  S SS+FGW  + 
Sbjct  1203  LTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHIVATLDKFDDQS-SSSFGWESEA  1261

Query  535   SFP  527
             +FP
Sbjct  1262  TFP  1264



>ref|XP_002884369.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60628.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
Length=2033

 Score = 79.7 bits (195),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 5/96 (5%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1929  IESLAGAIFVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKSQFELSKA--  1986

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               KD     T+EV A     + ++ A ++K AK+LA
Sbjct  1987  --KDFNY-FTVEVKAKEMSFAHTAKASDKKMAKKLA  2019


 Score = 71.2 bits (173),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYAL +VK  LH +ILH+S  L   I+  V   EQSS  STFGW    
Sbjct  1860  LTDMRSASVNNECYALVAVKENLHKHILHASHVLHKHISRTVSEFEQSSLQSTFGWECDI  1919

Query  535   SFP  527
             SFP
Sbjct  1920  SFP  1922



>ref|XP_009348590.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=775

 Score = 93.6 bits (231),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +E++AGAI++DSG    IVF+ IR +LEP+V+PE+LRL+P ++  + CQK+ Y +++ V 
Sbjct  667  VEALAGAIFIDSGYDKQIVFQSIRRLLEPLVSPETLRLHPGRDFNDYCQKKHYNVQKLVE  726

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              ++GEA  TIEV A G      S+A N+ TA++LA
Sbjct  727  CLQNGEAMVTIEVEAEGVTYKHKSTASNKITARKLA  762


 Score = 57.4 bits (137),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYA S+VKAGLH +IL S    R +I   V N    S  STFG+  +T
Sbjct  599  LTDMRSASVNNDCYARSAVKAGLHEHILASDIVHR-NIDSTVNNFGLLSTESTFGFESET  657

Query  535  SF  530
            SF
Sbjct  658  SF  659



>ref|XP_007029214.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
 gb|EOY09716.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
Length=947

 Score = 77.8 bits (190),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN CYALS+VKAGLH YILH+S  L   IA+ V++ ++ S   TFGW    
Sbjct  825  LTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHKEIAETVESFKELSMKYTFGWECDK  884

Query  535  SFP  527
            SFP
Sbjct  885  SFP  887


 Score = 73.2 bits (178),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKY  369
            +ES+AGAI++DSG     VF  IRP+LEP++TPE+++ +PVKEL ELCQK  +
Sbjct  894  IESLAGAIFVDSGYDKHAVFRSIRPLLEPLITPETIKFHPVKELNELCQKEHF  946



>ref|XP_007147294.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
 gb|ESW19288.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
Length=754

 Score = 89.4 bits (220),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAI++DSG + +IVF+ IRP+LEP+VTPE+ R +P+  L ELCQK +Y+M+    
Sbjct  644  IESIAGAIFVDSGYKKEIVFKSIRPLLEPLVTPETARRHPISVLQELCQKNQYKMEVQSP  703

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
            V  +     TI+V AN      ++ A N+  A+++A + +
Sbjct  704  VSDNDGTLVTIKVKANRITYQHTAKASNKDKARKVASKEL  743


 Score = 61.6 bits (148),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT +RS SVNN CYALS++KA LH +IL     +  +I + +K++E  S  STFGW L+T
Sbjct  576  LTTMRSISVNNECYALSAIKAELHKHIL-CDPVVEKNIKETIKSVENLSLESTFGWELET  634

Query  535  SF  530
             F
Sbjct  635  YF  636



>emb|CDO96789.1| unnamed protein product [Coffea canephora]
Length=801

 Score = 78.2 bits (191),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPV  351
            +ES+AGAIY+DSG   ++VF  I+P+LEP+VTPE+L+L PV+EL ELC K ++ M + V
Sbjct  657  IESLAGAIYVDSGYDKEVVFRSIKPLLEPLVTPETLKLQPVRELEELCAKEQFVMNKAV  715


 Score = 72.4 bits (176),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW  548
            LT+LRS SVNN CYA ++++AGLH +ILH S  L+  I   V+N EQSS  STFGW
Sbjct  589  LTDLRSASVNNDCYARTAIRAGLHKHILHGSQDLQRRILAIVENFEQSSQDSTFGW  644



>ref|XP_010485666.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010485667.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
Length=1398

 Score = 85.9 bits (211),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG    +VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1289  IESLAGAIFVDSGYNKGVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELSK-AK  1347

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               K+GEA  T+EV A     + ++ A ++K AK+LA +++
Sbjct  1348  GFKNGEAYFTVEVKAKEMSFAHTAEASDKKMAKKLAYKQV  1387


 Score = 64.7 bits (156),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V   E+SS  STFGW    
Sbjct  1220  LTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTVSEFERSSLQSTFGWESDV  1279

Query  535   SFP  527
             SFP
Sbjct  1280  SFP  1282



>ref|XP_010485668.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010485669.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
Length=1395

 Score = 85.9 bits (211),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG    +VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1286  IESLAGAIFVDSGYNKGVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELSK-AK  1344

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               K+GEA  T+EV A     + ++ A ++K AK+LA +++
Sbjct  1345  GFKNGEAYFTVEVKAKEMSFAHTAEASDKKMAKKLAYKQV  1384


 Score = 64.7 bits (156),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V   E+SS  STFGW    
Sbjct  1217  LTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTVSEFERSSLQSTFGWESDV  1276

Query  535   SFP  527
             SFP
Sbjct  1277  SFP  1279



>ref|XP_010485670.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Camelina 
sativa]
Length=1354

 Score = 85.9 bits (211),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG    +VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1245  IESLAGAIFVDSGYNKGVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELSK-AK  1303

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               K+GEA  T+EV A     + ++ A ++K AK+LA +++
Sbjct  1304  GFKNGEAYFTVEVKAKEMSFAHTAEASDKKMAKKLAYKQV  1343


 Score = 64.7 bits (156),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V   E+SS  STFGW    
Sbjct  1176  LTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTVSEFERSSLQSTFGWESDV  1235

Query  535   SFP  527
             SFP
Sbjct  1236  SFP  1238



>gb|AAF26098.1|AC012328_1 unknown protein [Arabidopsis thaliana]
Length=2042

 Score = 80.9 bits (198),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 68/96 (71%), Gaps = 5/96 (5%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1938  IESLAGAIFVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKWQFELSKA--  1995

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               KD ++  T+EV A     + ++ A ++K AK+LA
Sbjct  1996  --KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKLA  2028


 Score = 69.3 bits (168),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V   EQSS  STFGW    
Sbjct  1869  LTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSEFEQSSLQSTFGWESDI  1928

Query  535   SFP  527
             SFP
Sbjct  1929  SFP  1931



>ref|NP_001078101.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73925.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1374

 Score = 80.5 bits (197),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 68/96 (71%), Gaps = 5/96 (5%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1270  IESLAGAIFVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKWQFELSKA--  1327

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               KD ++  T+EV A     + ++ A ++K AK+LA
Sbjct  1328  --KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKLA  1360


 Score = 69.3 bits (168),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V   EQSS  STFGW    
Sbjct  1201  LTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSEFEQSSLQSTFGWESDI  1260

Query  535   SFP  527
             SFP
Sbjct  1261  SFP  1263



>gb|ABF19798.1| dicer-like 2 spliceform 2 [Arabidopsis thaliana]
Length=1374

 Score = 80.5 bits (197),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 68/96 (71%), Gaps = 5/96 (5%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1270  IESLAGAIFVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKWQFELSKA--  1327

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               KD ++  T+EV A     + ++ A ++K AK+LA
Sbjct  1328  --KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKLA  1360


 Score = 69.3 bits (168),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V   EQSS  STFGW    
Sbjct  1201  LTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSEFEQSSLQSTFGWESDI  1260

Query  535   SFP  527
             SFP
Sbjct  1261  SFP  1263



>ref|XP_006844770.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
 gb|ERN06445.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
Length=1424

 Score = 83.6 bits (205),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = -1

Query  545   AQDKFP------MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC  384
             A  +FP      +ESIAGAI +DSG   ++V+  IRP+LEP+VT E++++ PV+EL ELC
Sbjct  1301  ADTEFPKVLGDVIESIAGAILVDSGFNKEVVWRSIRPILEPLVTLETVKIEPVRELEELC  1360

Query  383   QKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
              KR Y+ KE      DG    T  V  +G   S + SARNR
Sbjct  1361  SKRSYK-KEKSFSVADGLTYATFTVKVDGVSYSNTCSARNR  1400


 Score = 66.2 bits (160),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS-STFGWVLK  539
             LT+LRS SVNN CYA  +VKAGLH +IL++S+ L S IA  +K I+  S S S FGW   
Sbjct  1243  LTDLRSASVNNYCYAHVAVKAGLHKHILYASSELHSQIASSIKCIKDLSLSASMFGWEAD  1302

Query  538   TSFP  527
             T FP
Sbjct  1303  TEFP  1306



>ref|NP_566199.4| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 ref|NP_001189798.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 sp|Q3EBC8.2|DCL2_ARATH RecName: Full=Endoribonuclease Dicer homolog 2; AltName: Full=Dicer-like 
protein 2; Short=AtDCL2 [Arabidopsis thaliana]
 gb|AEE73924.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73926.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1388

 Score = 79.7 bits (195),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 68/96 (71%), Gaps = 5/96 (5%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1284  IESLAGAIFVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKWQFELSKA--  1341

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               KD ++  T+EV A     + ++ A ++K AK+LA
Sbjct  1342  --KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKLA  1374


 Score = 69.3 bits (168),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V   EQSS  STFGW    
Sbjct  1215  LTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSEFEQSSLQSTFGWESDI  1274

Query  535   SFP  527
             SFP
Sbjct  1275  SFP  1277



>gb|ABF19797.1| dicer-like 2 spliceform 1 [Arabidopsis thaliana]
Length=1386

 Score = 79.7 bits (195),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 68/96 (71%), Gaps = 5/96 (5%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1282  IESLAGAIFVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKWQFELSKA--  1339

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               KD ++  T+EV A     + ++ A ++K AK+LA
Sbjct  1340  --KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKLA  1372


 Score = 69.3 bits (168),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V   EQSS  STFGW    
Sbjct  1213  LTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSEFEQSSLQSTFGWESDI  1272

Query  535   SFP  527
             SFP
Sbjct  1273  SFP  1275



>ref|XP_008373030.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Malus 
domestica]
Length=776

 Score = 91.7 bits (226),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +E++AGAI++DSG    IVF+ IR +LEP+V+PE+LRL+P ++  + CQK+ Y +++ V 
Sbjct  668  VEALAGAIFIDSGYDKQIVFQSIRRLLEPLVSPETLRLHPGRDFNDYCQKKHYNVQKLVE  727

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              ++GEA  TIEV A       +S+A N+ TA++LA
Sbjct  728  CFQNGEAMVTIEVEAEXVTYKHTSTASNKITARKLA  763


 Score = 57.0 bits (136),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYA S+VKAGLH +IL S    R +I   V N    S  STFG+  +T
Sbjct  600  LTDMRSASVNNDCYARSAVKAGLHEHILASDIVHR-NIDSTVNNFGLLSTESTFGFESET  658

Query  535  SF  530
            SF
Sbjct  659  SF  660



>ref|XP_006408318.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
 gb|ESQ49771.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
Length=1390

 Score = 83.6 bits (205),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK +  + +   
Sbjct  1282  IESLAGAIFVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKSQLELSK-AK  1340

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               ++G+A  T+EV A     S ++ A ++K AK+LA
Sbjct  1341  GFENGKAFFTVEVKAKEMSFSHTAKASDKKMAKKLA  1376


 Score = 64.3 bits (155),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA  +VK+ LH +ILH+S  L   I   V   E+SS  STFGW    
Sbjct  1213  LTDMRSASVNNECYAQVAVKSNLHKHILHASHDLHKHIFRTVSEFERSSLQSTFGWESDI  1272

Query  535   SFP  527
             +FP
Sbjct  1273  AFP  1275



>ref|XP_010088523.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB36440.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1077

 Score = 87.0 bits (214),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   DIVF+ IRP+LEP VTP++L+LNP +EL ELC K+ +   +   
Sbjct  968   IESVAGAIFIDSGYNKDIVFQSIRPLLEPFVTPKTLKLNPTRELRELCTKKGFPTNQSKK  1027

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               ++G   TT+EV ANG      S    +   +R+A
Sbjct  1028  C-ENGAYSTTVEVEANGSTFKGMSMVSGKDLRERIA  1062


 Score = 60.8 bits (146),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT++RS SVNN CYA  +VKAGLH +IL  S  L ++I   V N  + S+ S FGW  +T
Sbjct  899  LTDMRSASVNNECYARCAVKAGLHEHILRDSRELDNNIVATVNNFGKLSSESIFGWESET  958

Query  535  SF  530
             F
Sbjct  959  YF  960



>ref|XP_007147469.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 ref|XP_007147470.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19463.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19464.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
Length=1388

 Score = 96.7 bits (239),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 47/103 (46%), Positives = 71/103 (69%), Gaps = 5/103 (5%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI +DSG   ++V++ IRP+LEP+VTPE+L+L+PV+EL ELCQKR Y + +  V
Sbjct  1277  IESLAGAILVDSGFNIEVVWQSIRPLLEPLVTPETLKLHPVRELNELCQKRSYNIVQETV  1336

Query  347   VHKDGEACTTIEVMANGGVRS---CSSSARNRKTAKRLACERM  228
                DG     +EV A+G +     C SS ++  TAK++ C+ +
Sbjct  1337  SRTDGVTRYKMEVEADGVIHQYEYCGSSLKD--TAKKIVCKEI  1377


 Score = 50.8 bits (120),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CYA S++  GLH ++LH+S  L   IA  + N ++ S+SSTFG+  +T
Sbjct  1208  LTDMRSASVNNDCYAWSAINHGLHKHVLHASQELHKHIAITLANFDKLSSSSTFGFGSET  1267

Query  535   SFP  527
             S P
Sbjct  1268  SLP  1270



>emb|CDO96788.1| unnamed protein product [Coffea canephora]
Length=726

 Score = 80.1 bits (196),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 5/96 (5%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            ++S+AGAIY+DSG    +VF+ I+P+LEP+ TPE+L+L PV+EL E C K+ + M +  V
Sbjct  625  IKSLAGAIYVDSGYDKGVVFQSIKPLLEPLPTPETLKLQPVRELEEFCAKQHFDMNKS-V  683

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +++GE    +   ANG   +   +A N+KTA++ A
Sbjct  684  TYENGE----VSANANGVPCARRLTAANKKTARKTA  715


 Score = 66.6 bits (161),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW  548
            LT+LRS SVNN C A ++++AGLH +ILH S  L+  I    +N EQSS  STFGW
Sbjct  557  LTDLRSASVNNDCCARTAIRAGLHKHILHDSQDLQRRILAIAENFEQSSRDSTFGW  612



>ref|XP_010233057.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Brachypodium distachyon]
Length=1248

 Score = 82.8 bits (203),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIYLDS    ++V+  ++P+LEP+ TPE++  +PVKEL E C +R Y  +    
Sbjct  1125  IESIAGAIYLDSKYDKEMVWRSMKPLLEPLATPETVERDPVKELQEFCDRRSYS-RSYTK  1183

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H+ G +    EV   G + S + S R++  A++LA + +
Sbjct  1184  THEGGVSSVVAEVQVEGTIYSATRSGRDKTVAQKLAVKSL  1223


 Score = 63.5 bits (153),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA +SVKAGL+ +ILHSST L   +A +++N  Q+    + GW    
Sbjct  1056  LTDLRSASVNNNCYAHASVKAGLNKHILHSSTELHRKMAYYLENFGQAFTGPSHGWEAGI  1115

Query  535   SFP  527
               P
Sbjct  1116  GLP  1118



>ref|XP_010233062.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
 ref|XP_010233066.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
Length=1144

 Score = 81.6 bits (200),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIYLDS    ++V+  ++P+LEP+ TPE++  +PVKEL E C +R Y  +    
Sbjct  1021  IESIAGAIYLDSKYDKEMVWRSMKPLLEPLATPETVERDPVKELQEFCDRRSYS-RSYTK  1079

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              H+ G +    EV   G + S + S R++  A++LA + +
Sbjct  1080  THEGGVSSVVAEVQVEGTIYSATRSGRDKTVAQKLAVKSL  1119


 Score = 63.5 bits (153),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA +SVKAGL+ +ILHSST L   +A +++N  Q+    + GW    
Sbjct  952   LTDLRSASVNNNCYAHASVKAGLNKHILHSSTELHRKMAYYLENFGQAFTGPSHGWEAGI  1011

Query  535   SFP  527
               P
Sbjct  1012  GLP  1014



>emb|CDY43132.1| BnaA05g32540D [Brassica napus]
Length=1388

 Score = 84.3 bits (207),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1280  IESLAGAIHVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELSK-AK  1338

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               ++GEA  T+EV A     + ++ A ++K AK+LA
Sbjct  1339  GFENGEAFFTVEVEAKEMSFAHTARASDKKMAKKLA  1374


 Score = 59.7 bits (143),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ-SSASSTFGWVLK  539
             LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V   E+ SS  S+FGW  +
Sbjct  1210  LTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSEFERLSSVQSSFGWESE  1269

Query  538   TSFP  527
              +FP
Sbjct  1270  IAFP  1273



>ref|XP_009130358.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
 ref|XP_009130359.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
Length=1388

 Score = 84.3 bits (207),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1280  IESLAGAIHVDSGYNKEVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELSK-AK  1338

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               ++GEA  T+EV A     + ++ A ++K AK+LA
Sbjct  1339  GFENGEAFFTVEVEAKEMSFAHTARASDKKMAKKLA  1374


 Score = 59.7 bits (143),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ-SSASSTFGWVLK  539
             LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V   E+ SS  S+FGW  +
Sbjct  1210  LTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSEFERLSSVQSSFGWESE  1269

Query  538   TSFP  527
              +FP
Sbjct  1270  IAFP  1273



>ref|NP_001131630.1| uncharacterized protein LOC100192986 [Zea mays]
 gb|ACF80129.1| unknown [Zea mays]
Length=365

 Score = 73.2 bits (178),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++   EQS +  + GW    
Sbjct  178  LTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYLDKFEQSFSGPSHGWEAGI  237

Query  535  SFP  527
            S P
Sbjct  238  SLP  240


 Score = 69.3 bits (168),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAIY+D+     +V+  ++ +LEP+VTP++L+ +PVKEL E C  + Y + E  V
Sbjct  247  VESIAGAIYIDAKHDKGVVWRSMKRILEPLVTPDTLQNDPVKELQEFCDSKGYTL-EYTV  305

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               +G +    EV   G     + +  ++  AK+LA
Sbjct  306  TRDNGVSSVVAEVRTEGTTYKATRTGFSKLDAKKLA  341



>emb|CDY50692.1| BnaC05g47910D [Brassica napus]
Length=1389

 Score = 82.8 bits (203),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + +   
Sbjct  1281  IESLAGAIHVDSGYDKEVVFACIKPLLGCMITPETVKLHPVRELTELCQKAQFELTK-AK  1339

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               ++GEA  T+EV A     + ++ A ++K AK+LA
Sbjct  1340  GFENGEAYFTVEVEAKEMSFAHTAKASDKKMAKKLA  1375


 Score = 59.3 bits (142),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ-SSASSTFGWVLK  539
             LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V   E+ SS  S+FGW  +
Sbjct  1211  LTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSEFERLSSVQSSFGWESE  1270

Query  538   TSFP  527
              +FP
Sbjct  1271  IAFP  1274



>gb|ACE60552.1| dicer-like protein 2 [Brassica rapa]
Length=1392

 Score = 82.4 bits (202),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGAI++DSG   ++VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + + V 
Sbjct  1284  IESLAGAIHVDSGYNKEVVFACIKPLLGCMITPETVKLHPVRELTELCQKAQFELSK-VK  1342

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               ++GEA   +EV A     + ++ A ++K AK+LA
Sbjct  1343  GFENGEAFFPVEVEAKEMSFAHTARAFDKKMAKKLA  1378


 Score = 59.7 bits (143),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ-SSASSTFGWVLK  539
             LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V   E+ SS  S+FGW  +
Sbjct  1214  LTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSEFERLSSVQSSFGWESE  1273

Query  538   TSFP  527
              +FP
Sbjct  1274  IAFP  1277



>gb|AFW68290.1| hypothetical protein ZEAMMB73_539070 [Zea mays]
Length=707

 Score = 72.8 bits (177),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++   EQS +  + GW    
Sbjct  520  LTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYLDKFEQSFSGPSHGWEAGI  579

Query  535  SFP  527
            S P
Sbjct  580  SLP  582


 Score = 68.6 bits (166),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAIY+D+     +V+  ++ +LEP+VTP++L+ +PVKEL E C  + Y + E  V
Sbjct  589  VESIAGAIYIDAKHDKGVVWRSMKRILEPLVTPDTLQNDPVKELQEFCDSKGYTL-EYTV  647

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               +G +    EV   G     + +  ++  AK+LA
Sbjct  648  TRDNGVSSVVAEVRTEGTTYKATRTGFSKLDAKKLA  683



>ref|XP_008681082.1| PREDICTED: uncharacterized protein LOC100192986 isoform X2 [Zea 
mays]
Length=1401

 Score = 72.4 bits (176),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++   EQS +  + GW    
Sbjct  1214  LTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYLDKFEQSFSGPSHGWEAGI  1273

Query  535   SFP  527
             S P
Sbjct  1274  SLP  1276


 Score = 68.6 bits (166),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIY+D+     +V+  ++ +LEP+VTP++L+ +PVKEL E C  + Y + E  V
Sbjct  1283  VESIAGAIYIDAKHDKGVVWRSMKRILEPLVTPDTLQNDPVKELQEFCDSKGYTL-EYTV  1341

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
                +G +    EV   G     + +  ++  AK+LA
Sbjct  1342  TRDNGVSSVVAEVRTEGTTYKATRTGFSKLDAKKLA  1377



>ref|XP_008681081.1| PREDICTED: uncharacterized protein LOC100192986 isoform X1 [Zea 
mays]
Length=1408

 Score = 72.4 bits (176),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++   EQS +  + GW    
Sbjct  1221  LTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYLDKFEQSFSGPSHGWEAGI  1280

Query  535   SFP  527
             S P
Sbjct  1281  SLP  1283


 Score = 68.6 bits (166),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIY+D+     +V+  ++ +LEP+VTP++L+ +PVKEL E C  + Y + E  V
Sbjct  1290  VESIAGAIYIDAKHDKGVVWRSMKRILEPLVTPDTLQNDPVKELQEFCDSKGYTL-EYTV  1348

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
                +G +    EV   G     + +  ++  AK+LA
Sbjct  1349  TRDNGVSSVVAEVRTEGTTYKATRTGFSKLDAKKLA  1384



>ref|XP_004982513.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=1404

 Score = 72.0 bits (175),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA ++VKAGLH +ILHSS+AL   +AD+++N +QS +  + GW    
Sbjct  1226  LTDLRSASVNNNCYAHAAVKAGLHKHILHSSSALHKRMADYLENFKQSFSGPSHGWEAGI  1285

Query  535   SFP  527
               P
Sbjct  1286  GLP  1288


 Score = 67.8 bits (164),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 35/98 (36%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIY+DS    ++V+  ++ +LEP+ TP++L ++PVKEL ELC +  Y +    V
Sbjct  1295  IESIAGAIYIDSKCDKEVVWRSMKRLLEPLATPDTLDVDPVKELQELCGREAYSITYN-V  1353

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
             + +D       EV   G     + +  ++  AK+LA +
Sbjct  1354  IREDRVTSVVAEVQTKGTAFKAARTGLSKLDAKKLAAK  1391



>ref|XP_002464290.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
 gb|EER91288.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
Length=1385

 Score = 70.9 bits (172),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN+CYA ++VKAGLH +ILHSS+AL   +AD++   EQS +  + GW    
Sbjct  1198  LTDLRSASVNNSCYAHAAVKAGLHKHILHSSSALHKKMADYLDKFEQSFSGPSHGWEAGI  1257

Query  535   SFP  527
               P
Sbjct  1258  CLP  1260


 Score = 68.9 bits (167),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIY+D+     +V+ K++ +LEP+ TP++L ++PVKEL E C  +   +K   V
Sbjct  1267  IESIAGAIYIDTKNDKKVVWRKMKRLLEPLATPDTLEIDPVKELHEFCDPKTCSIKY-TV  1325

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
               +D      +EV   G     + +   ++ AK+LA +
Sbjct  1326  AREDRVTSVAVEVQTKGTTYKATRTGLTKRDAKKLAAK  1363



>ref|XP_010229604.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2a-like [Brachypodium distachyon]
Length=1398

 Score = 77.8 bits (190),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 40/98 (41%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIYLDS    ++V+  I+ +LEP+ TPE++  +PVKEL E C  R Y M     
Sbjct  1291  IESIAGAIYLDSQYDKEVVWRSIKRLLEPLATPETVACDPVKELQEFCDHRSYSMSY-TK  1349

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
               KDG +    EV   G   S + +  ++  AK+LA +
Sbjct  1350  TQKDGVSSFVAEVQVEGTTYSATQTGHDKLVAKKLAAK  1387


 Score = 61.6 bits (148),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN+CYA ++VKAGL+ +ILHSS+ L   +A +++N  Q+    + GW    
Sbjct  1222  LTDLRSASVNNSCYAHAAVKAGLNKHILHSSSELHRKMAYYLENFGQTFRGPSHGWEAGI  1281

Query  535   SFP  527
               P
Sbjct  1282  GLP  1284



>gb|EMS67761.1| Endoribonuclease Dicer-like protein 2a [Triticum urartu]
Length=537

 Score = 74.3 bits (181),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAIYLDS    ++V++ ++ +LEP+ TPE++  +PVK L E C +R Y       
Sbjct  430  IESLAGAIYLDSKYDKEVVWKSMKQLLEPLATPETVERDPVKLLQEFCARRSYS-SSYTK  488

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
             HKDG +    EV   G   + + +  ++  AK+LA + +
Sbjct  489  AHKDGVSSVVAEVQVEGTTYTATETGPDKIVAKKLAAKSL  528


 Score = 58.9 bits (141),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN CYA ++ KAGL+ +ILHSS  L   +A + +N +Q     + GW    
Sbjct  361  LTDLRSASVNNNCYAHAAAKAGLNKHILHSSLQLHGRMAYYFENFKQPFTGPSHGWEAGI  420

Query  535  SFP  527
              P
Sbjct  421  GLP  423



>gb|ABK24820.1| unknown [Picea sitchensis]
Length=330

 Score = 77.0 bits (188),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYR--MKEP  354
            +ESIAGA+ +DS   T +V+  ++P+LEP+VTP++++  PV+EL ELCQK  Y     + 
Sbjct  220  IESIAGAVLVDSEFDTQLVWNAMKPLLEPLVTPKTIKYQPVRELQELCQKEFYTCCFDDS  279

Query  353  VVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                ++G +   +EV   G     +  A N++TAK+LA E++
Sbjct  280  ---QEEGTSTVKVEVRVKGDSYIETCEASNKRTAKKLAAEKV  318


 Score = 55.8 bits (133),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST--FGW  548
            LT+LRS +VNN CYA ++VK  LH  + H+S+ L + I +F K I  SSAS    FGW
Sbjct  148  LTDLRSAAVNNDCYAQAAVKCNLHQQLRHASSELHNQITEFAKLISSSSASGDHFFGW  205



>ref|XP_006651573.1| PREDICTED: endoribonuclease Dicer homolog 2a-like [Oryza brachyantha]
Length=1348

 Score = 70.5 bits (171),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIY+DS    D+V+  ++ +LEP+ TPE++  +PVK L E C +  Y++     
Sbjct  1233  IESIAGAIYVDSRSNKDVVWRSMKRLLEPLATPETIEPDPVKGLQEFCDRGAYKITYE-E  1291

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              H DG +     V A G   S + S   +  AK+LA
Sbjct  1292  THVDGVSSVIARVKAGGTTYSATKSGPTKLVAKKLA  1327


 Score = 61.2 bits (147),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA ++VK+GL+ YILHSS+ L   ++ +++N  QS    + GW    
Sbjct  1164  LTDLRSASVNNNCYAHAAVKSGLNKYILHSSSELHRKMSYYLENFGQSFTGPSHGWEAGI  1223

Query  535   SFP  527
               P
Sbjct  1224  GLP  1226



>ref|XP_004157159.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
Length=132

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAIY+DSG   +IVF  IRP+LEP+V+PE+L+ +P +EL ELCQK  Y++K+ V 
Sbjct  20   IESLAGAIYVDSGYDKEIVFRSIRPLLEPLVSPETLKKHPRRELNELCQKENYKLKKTVT  79

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               +G +  T+EV  NG +   +  + +R+T +++A + +
Sbjct  80   SRVNGRSYVTVEVEVNGRIFKHTEISLDRETGEKVASKEV  119



>ref|XP_004982511.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Setaria italica]
Length=719

 Score = 75.1 bits (183),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 2/102 (2%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAIYLDS  + ++V+  +R +LEP+ TP+++ + PV EL E+C++RKY       
Sbjct  608  IESIAGAIYLDSKHKKEVVWRAMRRLLEPLATPKTVEVYPVSELKEICERRKYPKPSYSP  667

Query  347  VHKDGEACTTI--EVMANGGVRSCSSSARNRKTAKRLACERM  228
               DG   T +  +V A G V   +   RN+K AK LA + +
Sbjct  668  TRDDGVGVTRVVAKVKAAGKVYYGTGEGRNQKVAKILAAKAL  709


 Score = 50.8 bits (120),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+  +  I D ++N   S +  + GW    
Sbjct  542  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS--KQMIND-LENSGWSFSGPSHGWEPGI  598

Query  535  SFPWNL  518
              P +L
Sbjct  599  GLPEDL  604



>ref|XP_004982510.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Setaria italica]
Length=720

 Score = 75.1 bits (183),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 2/102 (2%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAIYLDS  + ++V+  +R +LEP+ TP+++ + PV EL E+C++RKY       
Sbjct  609  IESIAGAIYLDSKHKKEVVWRAMRRLLEPLATPKTVEVYPVSELKEICERRKYPKPSYSP  668

Query  347  VHKDGEACTTI--EVMANGGVRSCSSSARNRKTAKRLACERM  228
               DG   T +  +V A G V   +   RN+K AK LA + +
Sbjct  669  TRDDGVGVTRVVAKVKAAGKVYYGTGEGRNQKVAKILAAKAL  710


 Score = 50.8 bits (120),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+  +  I D ++N   S +  + GW    
Sbjct  543  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS--KQMIND-LENSGWSFSGPSHGWEPGI  599

Query  535  SFPWNL  518
              P +L
Sbjct  600  GLPEDL  605



>ref|XP_004982509.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=755

 Score = 75.1 bits (183),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 2/102 (2%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAIYLDS  + ++V+  +R +LEP+ TP+++ + PV EL E+C++RKY       
Sbjct  644  IESIAGAIYLDSKHKKEVVWRAMRRLLEPLATPKTVEVYPVSELKEICERRKYPKPSYSP  703

Query  347  VHKDGEACTTI--EVMANGGVRSCSSSARNRKTAKRLACERM  228
               DG   T +  +V A G V   +   RN+K AK LA + +
Sbjct  704  TRDDGVGVTRVVAKVKAAGKVYYGTGEGRNQKVAKILAAKAL  745


 Score = 50.8 bits (120),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+  +  I D ++N   S +  + GW    
Sbjct  578  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS--KQMIND-LENSGWSFSGPSHGWEPGI  634

Query  535  SFPWNL  518
              P +L
Sbjct  635  GLPEDL  640



>gb|EEC75643.1| hypothetical protein OsI_12390 [Oryza sativa Indica Group]
Length=1318

 Score = 67.0 bits (162),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIYLDS    ++V+  ++ +LEP+ TPE++  +PVK L E C +R +++     
Sbjct  1204  IESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETIEPDPVKGLQEFCDRRSFKITYE-K  1262

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              H DG +     V A     S + S   +  AK+LA
Sbjct  1263  NHVDGVSSVIARVKAGETTYSATKSGPCKLVAKKLA  1298


 Score = 58.5 bits (140),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +++   QS    ++GW    
Sbjct  1135  LTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYYLEEFGQSFTGPSYGWEAGI  1194

Query  535   SFP  527
               P
Sbjct  1195  GLP  1197



>ref|NP_001050564.1| Os03g0583900 [Oryza sativa Japonica Group]
 sp|Q10HL3.1|DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2a; AltName: Full=Dicer-like 
protein 2a; Short=OsDCL2a [Oryza sativa Japonica 
Group]
 gb|AAT76309.1| putative RNA helicase/RNAseIII protein, C-terminus truncated 
[Oryza sativa Japonica Group]
 gb|ABF97330.1| Type III restriction enzyme, res subunit family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12478.1| Os03g0583900 [Oryza sativa Japonica Group]
 dbj|BAG92928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1410

 Score = 67.0 bits (162),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIYLDS    ++V+  ++ +LEP+ TPE++  +PVK L E C +R +++     
Sbjct  1296  IESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETIEPDPVKGLQEFCDRRSFKITYE-K  1354

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              H DG +     V A     S + S   +  AK+LA
Sbjct  1355  NHVDGVSSVIARVKAGETTYSATKSGPCKLVAKKLA  1390


 Score = 58.5 bits (140),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +++   QS    ++GW    
Sbjct  1227  LTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYYLEEFGQSFTGPSYGWEAGI  1286

Query  535   SFP  527
               P
Sbjct  1287  GLP  1289



>gb|AAS07189.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=1017

 Score = 66.2 bits (160),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAIYLDS    ++V+  ++ +LEP+ TPE++  +PVK L E C +R +++     
Sbjct  903  IESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETIEPDPVKGLQEFCDRRSFKITYE-K  961

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             H DG +     V A     S + S   +  AK+LA
Sbjct  962  NHVDGVSSVIARVKAGETTYSATKSGPCKLVAKKLA  997


 Score = 58.5 bits (140),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +++   QS    ++GW    
Sbjct  834  LTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYYLEEFGQSFTGPSYGWEAGI  893

Query  535  SFP  527
              P
Sbjct  894  GLP  896



>gb|EAZ27614.1| hypothetical protein OsJ_11558 [Oryza sativa Japonica Group]
Length=258

 Score = 65.1 bits (157),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESIAGAIYLDS    ++V+  ++ +LEP+ TPE++  +PVK L E C +R +++     
Sbjct  144  IESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETIEPDPVKGLQEFCDRRSFKITYE-K  202

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             H DG +     V A     S + S   +  AK+LA
Sbjct  203  NHVDGVSSVIARVKAGETTYSATKSGPCKLVAKKLA  238


 Score = 58.9 bits (141),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +++   QS    ++GW    
Sbjct  75   LTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYYLEEFGQSFTGPSYGWEAGI  134

Query  535  SFP  527
              P
Sbjct  135  GLP  137



>ref|XP_008644680.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X5 
[Zea mays]
Length=674

 Score = 65.9 bits (159),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (4%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             E+IAGAIY+DSG   ++V+  IR +LEP+ TP ++  +PV EL ELC+ + Y  K    
Sbjct  563  FEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPGTMEPDPVSELKELCEHKHYP-KPSYS  621

Query  347  VHKDGEACTT---IEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +D  A  T    +V A   V S + + RN+  A+ LA + +
Sbjct  622  PTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDVAEVLAAKAL  664


 Score = 55.1 bits (131),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++N  +S +  + GW    
Sbjct  497  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLENSGRSFSGPSHGWEAGI  553

Query  535  SFPWNL  518
            S P +L
Sbjct  554  SLPEDL  559



>ref|XP_004139098.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
 gb|KGN66658.1| hypothetical protein Csa_1G654870 [Cucumis sativus]
Length=1393

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 88/147 (60%), Gaps = 9/147 (6%)
 Frame = -1

Query  641   LYSSLVHCSSEQY---S*FC*EYRAVISLINIWMGAQDKFP------MESIAGAIYLDSG  489
             L+ S++HCS + +   S     +  + S       ++  FP      +ES+AGAIY+DSG
Sbjct  1234  LHKSILHCSHDLHKHISSAVQNFETLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSG  1293

Query  488   LRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEV  309
                +IVF  IRP+LEP+V+PE+L+ +P +EL ELCQK  Y++K+ V    +G +  T+EV
Sbjct  1294  YDKEIVFRSIRPLLEPLVSPETLKKHPRRELNELCQKENYKLKKTVTSRVNGRSYVTVEV  1353

Query  308   MANGGVRSCSSSARNRKTAKRLACERM  228
               NG +   +  + +R+T +++A + +
Sbjct  1354  EVNGRIFKHTEISLDRETGEKVASKEV  1380


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SV+N CY+ +++KA LH  ILH S  L   I+  V+N E  S+ +T+GW  + 
Sbjct  1212  LTDMRSASVSNDCYSRTALKAQLHKSILHCSHDLHKHISSAVQNFETLSSEATYGWESEI  1271

Query  535   SFP  527
             SFP
Sbjct  1272  SFP  1274



>gb|AFD22618.1| dicer-like 1 protein, partial [Nicotiana attenuata]
Length=1690

 Score = 74.3 bits (181),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 62/98 (63%), Gaps = 3/98 (3%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
              ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1487  FESIAGAIFLDSGCDTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAQGLE--YK  1544

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
               + G    T+EV  +G     + + + RK A+++ C+
Sbjct  1545  ASRSGN-IATVEVYVDGIQVGMAQNPQKRKMAQKVGCQ  1581


 Score = 45.4 bits (106),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK GLH ++ H S+AL   I DFV  ++   +   F
Sbjct  1416  LTDLRAAAVNNENFARVAVKHGLHLHLRHGSSALEKQIRDFVIEVKNELSKPGF  1469



>gb|AFW68291.1| hypothetical protein ZEAMMB73_565304 [Zea mays]
Length=462

 Score = 65.1 bits (157),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (4%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             E+IAGAIY+DSG   ++V+  IR +LEP+ TP ++  +PV EL ELC+ + Y  K    
Sbjct  351  FEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPGTMEPDPVSELKELCEHKHYP-KPSYS  409

Query  347  VHKDGEACTT---IEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +D  A  T    +V A   V S + + RN+  A+ LA + +
Sbjct  410  PTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDVAEVLAAKAL  452


 Score = 54.3 bits (129),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++N  +S +  + GW    
Sbjct  285  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLENSGRSFSGPSHGWEAGI  341

Query  535  SFPWNL  518
            S P +L
Sbjct  342  SLPEDL  347



>ref|XP_008644678.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Zea mays]
Length=717

 Score = 65.1 bits (157),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (4%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             E+IAGAIY+DSG   ++V+  IR +LEP+ TP ++  +PV EL ELC+ + Y  K    
Sbjct  606  FEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPGTMEPDPVSELKELCEHKHYP-KPSYS  664

Query  347  VHKDGEACTT---IEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +D  A  T    +V A   V S + + RN+  A+ LA + +
Sbjct  665  PTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDVAEVLAAKAL  707


 Score = 54.3 bits (129),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++N  +S +  + GW    
Sbjct  540  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLENSGRSFSGPSHGWEAGI  596

Query  535  SFPWNL  518
            S P +L
Sbjct  597  SLPEDL  602



>ref|XP_008644679.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Zea mays]
Length=682

 Score = 65.1 bits (157),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (4%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             E+IAGAIY+DSG   ++V+  IR +LEP+ TP ++  +PV EL ELC+ + Y  K    
Sbjct  571  FEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPGTMEPDPVSELKELCEHKHYP-KPSYS  629

Query  347  VHKDGEACTT---IEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +D  A  T    +V A   V S + + RN+  A+ LA + +
Sbjct  630  PTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDVAEVLAAKAL  672


 Score = 54.3 bits (129),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++N  +S +  + GW    
Sbjct  505  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLENSGRSFSGPSHGWEAGI  561

Query  535  SFPWNL  518
            S P +L
Sbjct  562  SLPEDL  567



>ref|XP_008644683.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X8 
[Zea mays]
Length=479

 Score = 65.1 bits (157),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (4%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             E+IAGAIY+DSG   ++V+  IR +LEP+ TP ++  +PV EL ELC+ + Y  K    
Sbjct  368  FEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPGTMEPDPVSELKELCEHKHYP-KPSYS  426

Query  347  VHKDGEACTT---IEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +D  A  T    +V A   V S + + RN+  A+ LA + +
Sbjct  427  PTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDVAEVLAAKAL  469


 Score = 54.3 bits (129),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++N  +S +  + GW    
Sbjct  302  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLENSGRSFSGPSHGWEAGI  358

Query  535  SFPWNL  518
            S P +L
Sbjct  359  SLPEDL  364



>ref|XP_008644682.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X7 
[Zea mays]
Length=486

 Score = 65.1 bits (157),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (4%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             E+IAGAIY+DSG   ++V+  IR +LEP+ TP ++  +PV EL ELC+ + Y  K    
Sbjct  375  FEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPGTMEPDPVSELKELCEHKHYP-KPSYS  433

Query  347  VHKDGEACTT---IEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +D  A  T    +V A   V S + + RN+  A+ LA + +
Sbjct  434  PTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDVAEVLAAKAL  476


 Score = 54.3 bits (129),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++N  +S +  + GW    
Sbjct  309  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLENSGRSFSGPSHGWEAGI  365

Query  535  SFPWNL  518
            S P +L
Sbjct  366  SLPEDL  371



>ref|XP_008644676.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Zea mays]
Length=751

 Score = 65.1 bits (157),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (4%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             E+IAGAIY+DSG   ++V+  IR +LEP+ TP ++  +PV EL ELC+ + Y  K    
Sbjct  640  FEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPGTMEPDPVSELKELCEHKHYP-KPSYS  698

Query  347  VHKDGEACTT---IEVMANGGVRSCSSSARNRKTAKRLACERM  228
              +D  A  T    +V A   V S + + RN+  A+ LA + +
Sbjct  699  PTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDVAEVLAAKAL  741


 Score = 54.3 bits (129),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++N  +S +  + GW    
Sbjct  574  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLENSGRSFSGPSHGWEAGI  630

Query  535  SFPWNL  518
            S P +L
Sbjct  631  SLPEDL  636



>ref|XP_008644677.1| PREDICTED: uncharacterized protein LOC103626078 isoform X2 [Zea 
mays]
Length=737

 Score = 64.3 bits (155),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -1

Query  524  ESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVV  345
            E+IAGAIY+DSG   ++V+  IR +LEP+ TP ++  +PV EL ELC+ + Y  K     
Sbjct  627  EAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPGTMEPDPVSELKELCEHKHYP-KPSYSP  685

Query  344  HKDGEACTT---IEVMANGGVRSCSSSARNRKTAKRLACERM  228
             +D  A  T    +V A   V S + + RN+  A+ LA + +
Sbjct  686  TRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDVAEVLAAKAL  727


 Score = 54.7 bits (130),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
            LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++N  +S +  + GW    
Sbjct  560  LTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLENSGRSFSGPSHGWEAGI  616

Query  535  SFPWNL  518
            S P +L
Sbjct  617  SLPEDL  622



>ref|XP_003546271.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Glycine max]
 gb|KHN14318.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=285

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ES+AGAI +DS    ++V++ IRP+LEP+VTPE+L+L+P++EL ELCQKR Y++    V
Sbjct  176  IESLAGAILVDSRFNKEVVWQSIRPLLEPLVTPETLKLHPIRELNELCQKRSYKIVLEDV  235

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARN-RKTAKRLACERM  228
              KDG     +E+ A+G +     +    R TAK++AC+ +
Sbjct  236  SRKDGVTNYRMELEADGVIHEYEYTGPALRDTAKKIACKEI  276



>ref|XP_008783544.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Phoenix 
dactylifera]
Length=1932

 Score = 70.9 bits (172),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LD+GL T IV+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1726  VESIAGAIFLDNGLDTSIVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1785

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1786  --RTGN-VATVEVFID-GVQMGVAQNPQKKMAQKLAA  1818


 Score = 47.8 bits (112),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK+++   +   F
Sbjct  1655  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVQDELSKPGF  1708



>ref|XP_008443670.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443671.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443672.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
Length=1393

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 88/147 (60%), Gaps = 9/147 (6%)
 Frame = -1

Query  641   LYSSLVHCSSEQY---S*FC*EYRAVISLINIWMGAQDKFP------MESIAGAIYLDSG  489
             L+ S++HCS + +   S     +  + S       ++  FP      +ES+AGAIY+DSG
Sbjct  1234  LHKSILHCSHDLHKHISSTLHNFEMLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSG  1293

Query  488   LRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEV  309
                + VF  IRP+LEP+V+PE+L+ +P +EL ELCQK KY +K+ V    +G +  T+EV
Sbjct  1294  YDKEKVFGCIRPLLEPLVSPETLKKHPRRELNELCQKEKYNLKKTVTSRVNGRSHVTVEV  1353

Query  308   MANGGVRSCSSSARNRKTAKRLACERM  228
               NG +   ++ + +R+T K++A + +
Sbjct  1354  EVNGRIFKHTAISLDRETGKKVASKEV  1380


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CY+ +++KA LH  ILH S  L   I+  + N E  S+ +T+GW  + 
Sbjct  1212  LTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKHISSTLHNFEMLSSEATYGWESEI  1271

Query  535   SFP  527
             SFP
Sbjct  1272  SFP  1274



>ref|XP_008443675.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Cucumis 
melo]
Length=1346

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 88/147 (60%), Gaps = 9/147 (6%)
 Frame = -1

Query  641   LYSSLVHCSSEQY---S*FC*EYRAVISLINIWMGAQDKFP------MESIAGAIYLDSG  489
             L+ S++HCS + +   S     +  + S       ++  FP      +ES+AGAIY+DSG
Sbjct  1187  LHKSILHCSHDLHKHISSTLHNFEMLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSG  1246

Query  488   LRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEV  309
                + VF  IRP+LEP+V+PE+L+ +P +EL ELCQK KY +K+ V    +G +  T+EV
Sbjct  1247  YDKEKVFGCIRPLLEPLVSPETLKKHPRRELNELCQKEKYNLKKTVTSRVNGRSHVTVEV  1306

Query  308   MANGGVRSCSSSARNRKTAKRLACERM  228
               NG +   ++ + +R+T K++A + +
Sbjct  1307  EVNGRIFKHTAISLDRETGKKVASKEV  1333


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CY+ +++KA LH  ILH S  L   I+  + N E  S+ +T+GW  + 
Sbjct  1165  LTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKHISSTLHNFEMLSSEATYGWESEI  1224

Query  535   SFP  527
             SFP
Sbjct  1225  SFP  1227



>ref|XP_008443676.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
 ref|XP_008443677.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
Length=1306

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 88/147 (60%), Gaps = 9/147 (6%)
 Frame = -1

Query  641   LYSSLVHCSSEQY---S*FC*EYRAVISLINIWMGAQDKFP------MESIAGAIYLDSG  489
             L+ S++HCS + +   S     +  + S       ++  FP      +ES+AGAIY+DSG
Sbjct  1147  LHKSILHCSHDLHKHISSTLHNFEMLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSG  1206

Query  488   LRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEV  309
                + VF  IRP+LEP+V+PE+L+ +P +EL ELCQK KY +K+ V    +G +  T+EV
Sbjct  1207  YDKEKVFGCIRPLLEPLVSPETLKKHPRRELNELCQKEKYNLKKTVTSRVNGRSHVTVEV  1266

Query  308   MANGGVRSCSSSARNRKTAKRLACERM  228
               NG +   ++ + +R+T K++A + +
Sbjct  1267  EVNGRIFKHTAISLDRETGKKVASKEV  1293


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CY+ +++KA LH  ILH S  L   I+  + N E  S+ +T+GW  + 
Sbjct  1125  LTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKHISSTLHNFEMLSSEATYGWESEI  1184

Query  535   SFP  527
             SFP
Sbjct  1185  SFP  1187



>ref|XP_008443674.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Cucumis 
melo]
Length=1365

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 88/147 (60%), Gaps = 9/147 (6%)
 Frame = -1

Query  641   LYSSLVHCSSEQY---S*FC*EYRAVISLINIWMGAQDKFP------MESIAGAIYLDSG  489
             L+ S++HCS + +   S     +  + S       ++  FP      +ES+AGAIY+DSG
Sbjct  1206  LHKSILHCSHDLHKHISSTLHNFEMLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSG  1265

Query  488   LRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEV  309
                + VF  IRP+LEP+V+PE+L+ +P +EL ELCQK KY +K+ V    +G +  T+EV
Sbjct  1266  YDKEKVFGCIRPLLEPLVSPETLKKHPRRELNELCQKEKYNLKKTVTSRVNGRSHVTVEV  1325

Query  308   MANGGVRSCSSSARNRKTAKRLACERM  228
               NG +   ++ + +R+T K++A + +
Sbjct  1326  EVNGRIFKHTAISLDRETGKKVASKEV  1352


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT++RS SVNN CY+ +++KA LH  ILH S  L   I+  + N E  S+ +T+GW  + 
Sbjct  1184  LTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKHISSTLHNFEMLSSEATYGWESEI  1243

Query  535   SFP  527
             SFP
Sbjct  1244  SFP  1246



>gb|AIO05700.1| putative endoribonuclease dicer-like protein 1, partial [Cocos 
nucifera]
Length=1720

 Score = 70.1 bits (170),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LD+GL T IV+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1512  VESIAGAIFLDNGLDTSIVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1571

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1572  --RIGN-IATVEVFID-GVQMGVAQNPQKKMAQKLAA  1604


 Score = 47.8 bits (112),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK+++   +   F
Sbjct  1441  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVQDELSKPGF  1494



>gb|EYU35897.1| hypothetical protein MIMGU_mgv1a000073mg [Erythranthe guttata]
Length=1905

 Score = 68.6 bits (166),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LD+G  T +V++  +P+L+PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1701  VESIAGAIFLDTGCNTAVVWKVFQPLLDPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1760

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               + G    T+EV  + GV+   +    +K A++LA
Sbjct  1761  --RSGN-LATVEVYVD-GVQVGLAHNPQKKMAQKLA  1792


 Score = 49.3 bits (116),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  SVK  LH ++ H S+AL   I DFVK +E
Sbjct  1630  LTDLRAAAVNNENFARVSVKHNLHTHLRHGSSALEKQIRDFVKEVE  1675



>ref|XP_010934026.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Elaeis 
guineensis]
Length=1847

 Score = 70.5 bits (171),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LD+GL T IV+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1639  VESIAGAIFLDNGLDTSIVWGVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1698

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1699  --RTGN-IATVEVFID-GVQMGVAQNPQKKMAQKLAA  1731


 Score = 46.6 bits (109),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK++    +   F
Sbjct  1568  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVHDELSKPGF  1621



>ref|XP_010934025.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Elaeis 
guineensis]
Length=1933

 Score = 70.1 bits (170),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LD+GL T IV+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1725  VESIAGAIFLDNGLDTSIVWGVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1784

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1785  --RTGN-IATVEVFID-GVQMGVAQNPQKKMAQKLAA  1817


 Score = 46.6 bits (109),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK++    +   F
Sbjct  1654  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVHDELSKPGF  1707



>gb|EEE59414.1| hypothetical protein OsJ_11564 [Oryza sativa Japonica Group]
Length=1371

 Score = 63.5 bits (153),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIYLDS    ++V+  ++ +LEP+ TPE++  +PVK L E C +R +++     
Sbjct  1258  IESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETIEPDPVKGLQEFCDRRSFKITYE-K  1316

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              H DG +     V A     S + S    K AK+LA
Sbjct  1317  NHVDGVSSVIARVKAGETTYSATKSGPC-KLAKKLA  1351


 Score = 53.1 bits (126),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ ++    QS    ++GW    
Sbjct  1192  LTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYYLG---QSFTGPSYGWEAGI  1248

Query  535   SFP  527
               P
Sbjct  1249  GLP  1251



>ref|XP_010229289.1| PREDICTED: endoribonuclease Dicer homolog 1 [Brachypodium distachyon]
Length=1930

 Score = 68.9 bits (167),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 63/99 (64%), Gaps = 8/99 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T  V++  +P+L+PMVTPE+L ++P++EL E CQ++   ++    
Sbjct  1721  IESIAGAIFLDSGYDTSAVWKVFQPLLDPMVTPETLPMHPIRELQERCQQQAEGLE----  1776

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
              +K   A    T+EV  + G++   +    +K A++LA 
Sbjct  1777  -YKASRAGNVATVEVFVD-GIQIGVAQNPQKKMAQKLAA  1813


 Score = 47.8 bits (112),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++ +  + S F
Sbjct  1650  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVREEISKSGF  1703



>dbj|BAD34005.1| CAF protein-like [Oryza sativa Japonica Group]
 dbj|BAD36404.1| CAF protein-like [Oryza sativa Japonica Group]
Length=1375

 Score = 63.9 bits (154),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIYLDS    ++V+  ++ +LEP+ TPE++  +PVK L E C +R +++     
Sbjct  1262  IESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETIEPDPVKGLQEFCDRRSFKITYE-K  1320

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              H DG +     V A     S + S    K AK+LA
Sbjct  1321  NHVDGVSSVIARVKAGETTYSATKSGPC-KLAKKLA  1355


 Score = 53.1 bits (126),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ ++    QS    ++GW    
Sbjct  1196  LTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYYLG---QSFTGPSYGWEAGI  1252

Query  535   SFP  527
               P
Sbjct  1253  GLP  1255



>sp|Q69LX2.2|DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2b; AltName: Full=Dicer-like 
protein 2b; Short=OsDCL2b [Oryza sativa Japonica 
Group]
Length=1377

 Score = 63.5 bits (153),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAIYLDS    ++V+  ++ +LEP+ TPE++  +PVK L E C +R +++     
Sbjct  1264  IESIAGAIYLDSKCDKEVVWRSMKRLLEPLATPETIEPDPVKGLQEFCDRRSFKITYE-K  1322

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              H DG +     V A     S + S    K AK+LA
Sbjct  1323  NHVDGVSSVIARVKAGETTYSATKSGPC-KLAKKLA  1357


 Score = 53.1 bits (126),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT  536
             LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ ++    QS    ++GW    
Sbjct  1198  LTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYYLG---QSFTGPSYGWEAGI  1254

Query  535   SFP  527
               P
Sbjct  1255  GLP  1257



>ref|XP_004985932.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Setaria italica]
Length=1933

 Score = 70.5 bits (171),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 61/101 (60%), Gaps = 12/101 (12%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR----KYRMK  360
              ESIAGAI+LDSG  T IV++  +P+L+PMVTP++L ++PV+EL E CQ++    +Y+  
Sbjct  1725  FESIAGAIFLDSGYNTSIVWKVFQPLLDPMVTPDTLPMHPVRELQERCQQQAEGLEYKAS  1784

Query  359   EPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
                 V        T+EV  + G++        +K A++LA 
Sbjct  1785  RTANV-------ATVEVFVD-GIQIGVGQNPQKKMAQKLAA  1817


 Score = 46.2 bits (108),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++  +   F
Sbjct  1654  LTDLRAAAVNNENFARIAVKHKLHVHLRHGSSALETQIREFVKDVQEELSKPGF  1707



>gb|EAY88320.1| hypothetical protein OsI_09779 [Oryza sativa Indica Group]
Length=1883

 Score = 70.5 bits (171),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (64%), Gaps = 8/99 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1674  VESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE----  1729

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
              +K   A    T+EV  + GV+   +    +K A++LA 
Sbjct  1730  -YKASRAGNIATVEVFVD-GVQIGVAQNPQKKMAQKLAA  1766


 Score = 45.8 bits (107),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  575
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++
Sbjct  1603  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQE  1649



>ref|XP_006650986.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Oryza brachyantha]
Length=1855

 Score = 70.5 bits (171),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 63/98 (64%), Gaps = 8/98 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1647  VESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE----  1702

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1703  -YKASRAGNVATVEVFVD-GVQIGIAQNPQKKMAQKLA  1738


 Score = 45.8 bits (107),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  575
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++
Sbjct  1576  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQE  1622



>gb|EAZ25399.1| hypothetical protein OsJ_09217 [Oryza sativa Japonica Group]
Length=1883

 Score = 70.5 bits (171),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (64%), Gaps = 8/99 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1674  VESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE----  1729

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
              +K   A    T+EV  + GV+   +    +K A++LA 
Sbjct  1730  -YKASRAGNIATVEVFVD-GVQIGVAQNPQKKMAQKLAA  1766


 Score = 45.8 bits (107),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  575
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++
Sbjct  1603  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQE  1649



>sp|Q8LMR2.1|DCL1_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 1; AltName: Full=Dicer-like 
protein 1; Short=OsDCL1 [Oryza sativa Japonica Group]
 gb|AAM52322.1|AC105363_11 Putative CAF protein [Oryza sativa Japonica Group]
 gb|ABF93701.1| DEAD/DEAH box helicase carpel factory, putative, expressed [Oryza 
sativa Japonica Group]
Length=1883

 Score = 70.5 bits (171),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (64%), Gaps = 8/99 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1674  VESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE----  1729

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
              +K   A    T+EV  + GV+   +    +K A++LA 
Sbjct  1730  -YKASRAGNIATVEVFVD-GVQIGVAQNPQKKMAQKLAA  1766


 Score = 45.8 bits (107),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  575
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++
Sbjct  1603  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQE  1649



>gb|EMS58929.1| Endoribonuclease Dicer-like protein 1 [Triticum urartu]
Length=1577

 Score = 68.6 bits (166),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 63/98 (64%), Gaps = 8/98 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGA++LDSG  T  V++  +P+LEP+VTPE+L ++P++EL E CQ++   ++    
Sbjct  1371  IESIAGAVFLDSGYDTSAVWKVFQPLLEPLVTPETLPMHPIRELQERCQQQAEGLE----  1426

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1427  -YKASRAGNVATVEVFVD-GVQIGVAQNPQKKMAQKLA  1462


 Score = 47.4 bits (111),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +V+  LH ++ H S+AL   I +FVK++ +  + S F
Sbjct  1300  LTDLRAAAVNNENFARVAVRRKLHTHLRHGSSALEKQIREFVKDVREEISKSGF  1353



>gb|EMT07624.1| Endoribonuclease Dicer-1-like protein [Aegilops tauschii]
Length=1724

 Score = 68.6 bits (166),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 63/98 (64%), Gaps = 8/98 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGA++LDSG  T  V++  +P+LEP+VTPE+L ++P++EL E CQ++   ++    
Sbjct  1518  IESIAGAVFLDSGYDTSAVWKVFQPLLEPLVTPETLPMHPIRELQERCQQQAEGLE----  1573

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1574  -YKASRAGNVATVEVFVD-GVQIGVAQNPQKKMAQKLA  1609


 Score = 47.4 bits (111),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +V+  LH ++ H S+AL   I +FVK++ +  + S F
Sbjct  1447  LTDLRAAAVNNENFARVAVRRKLHGHLRHGSSALEKQIREFVKDVREEISKSGF  1500



>tpg|DAA43005.1| TPA: hypothetical protein ZEAMMB73_941906 [Zea mays]
Length=1307

 Score = 69.3 bits (168),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
              ESIAGAI+LDSG  T +V++  +P+L+PMVTP++L ++PV+EL E CQ++   ++    
Sbjct  1101  FESIAGAIFLDSGCATSVVWKVFQPLLDPMVTPDTLPMHPVRELQERCQQQAEGLE--YK  1158

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV+ + G++   +    +K A++LA 
Sbjct  1159  ASRTGNVA-TVEVLVD-GIQIGVAQNPQKKMAQKLAA  1193


 Score = 46.6 bits (109),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++  +   F
Sbjct  1030  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELSKPGF  1083



>ref|XP_009794783.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nicotiana sylvestris]
Length=1178

 Score = 68.9 bits (167),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
              ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  977   FESIAGAIFLDSGCDTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAQGLE--YK  1034

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + G++   +    +K A++LA 
Sbjct  1035  ASRSGN-IATVEVYVD-GIQVGMAQNPQKKMAQKLAA  1069


 Score = 46.6 bits (109),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
            LT+LR+ +VNN  +A  +VK GLH ++ H S+AL   I DFV  ++   +   F
Sbjct  906  LTDLRAAAVNNENFARVAVKHGLHLHLRHGSSALEKQIRDFVSEVKNELSKPGF  959



>gb|KFK42493.1| hypothetical protein AALP_AA1G000600 [Arabis alpina]
Length=1791

 Score = 64.7 bits (156),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1577  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1627


 Score = 50.1 bits (118),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+   F
Sbjct  1506  LTDLRAAAVNNENFARVAVKHKLHFYLRHGSSALEKQIRDFVKEVQTESSKPGF  1559



>ref|XP_010457181.1| PREDICTED: endoribonuclease Dicer homolog 1 [Camelina sativa]
Length=1908

 Score = 64.7 bits (156),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1695  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1745


 Score = 50.1 bits (118),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+   F
Sbjct  1624  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVQTESSKPGF  1677



>ref|XP_006846422.1| hypothetical protein AMTR_s00018p00015000 [Amborella trichopoda]
 gb|ERN08097.1| hypothetical protein AMTR_s00018p00015000 [Amborella trichopoda]
Length=2044

 Score = 69.7 bits (169),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI++DSGL T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1842  VESIAGAIFMDSGLNTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE----  1897

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +K   A    T++V  + G+   ++    +K A++LA
Sbjct  1898  -YKASRAGNLATVQVFVD-GIEIGTAQNPQKKMAQKLA  1933


 Score = 45.1 bits (105),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL S I +FV++++   +   F
Sbjct  1771  LTDLRAAAVNNENFARVAVKRKLHVHLRHGSSALESQIRNFVRDVQDELSKPGF  1824



>ref|XP_010474688.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X2 [Camelina 
sativa]
Length=1908

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1695  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1745


 Score = 50.1 bits (118),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+   F
Sbjct  1624  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVQTESSKPGF  1677



>ref|XP_010474687.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Camelina 
sativa]
Length=1907

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1694  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1744


 Score = 49.7 bits (117),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+   F
Sbjct  1623  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVQTESSKPGF  1676



>ref|XP_008681621.1| PREDICTED: uncharacterized protein LOC100381417 isoform X1 [Zea 
mays]
Length=1801

 Score = 67.8 bits (164),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = -1

Query  524   ESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVV  345
             ESIAGAI+LDSG  T +V++  +P+L+PMVTP++L ++PV+EL E CQ++   ++     
Sbjct  1596  ESIAGAIFLDSGCATSVVWKVFQPLLDPMVTPDTLPMHPVRELQERCQQQAEGLEYK--A  1653

Query  344   HKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              + G    T+EV+ + G++   +    +K A++LA
Sbjct  1654  SRTGNV-ATVEVLVD-GIQIGVAQNPQKKMAQKLA  1686


 Score = 47.0 bits (110),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++  +   F
Sbjct  1524  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELSKPGF  1577



>ref|XP_006306578.1| hypothetical protein CARUB_v10008073mg [Capsella rubella]
 gb|EOA39476.1| hypothetical protein CARUB_v10008073mg [Capsella rubella]
Length=1906

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1695  VESIAGAIFLDSGRDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1745


 Score = 49.7 bits (117),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+   F
Sbjct  1624  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVQTESSKPGF  1677



>gb|KEH24704.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1841

 Score = 68.2 bits (165),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1639  LESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1689


 Score = 46.2 bits (108),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1568  LTDLRAAAVNNENFARVTVKHNLHLHLRHGSSALEKQIKDFVKEVQDELSKPGF  1621



>gb|AES82838.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1880

 Score = 68.2 bits (165),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1678  LESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1728


 Score = 45.8 bits (107),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1607  LTDLRAAAVNNENFARVTVKHNLHLHLRHGSSALEKQIKDFVKEVQDELSKPGF  1660



>ref|XP_010661522.1| PREDICTED: endoribonuclease Dicer homolog 1 [Vitis vinifera]
Length=1974

 Score = 68.2 bits (165),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1771  VESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1830

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1831  --RSGN-LATVEVFID-GVQIGIAQNPQKKMAQKLAA  1863


 Score = 45.8 bits (107),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1700  LTDLRAAAVNNENFARVAVKHKLHIHLRHGSSALEKQIRDFVKEVQDELSKPGF  1753



>ref|XP_002978277.1| hypothetical protein SELMODRAFT_108314 [Selaginella moellendorffii]
 gb|EFJ20934.1| hypothetical protein SELMODRAFT_108314 [Selaginella moellendorffii]
Length=1728

 Score = 67.0 bits (162),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (62%), Gaps = 11/97 (11%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR----KYRMK  360
             +ESIAGAI+LD+GL  D V++    +LEPMVTP++L ++PV+EL E CQ++    +YR  
Sbjct  1520  LESIAGAIFLDTGLAADEVWKVFERLLEPMVTPDTLPVHPVRELQERCQQQAEGLEYRAS  1579

Query  359   EPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAK  249
                   ++G +  T+EV  +G    C+ + + +   K
Sbjct  1580  ------REG-SIATVEVFVDGVQIGCAQNTQKKMAQK  1609


 Score = 47.0 bits (110),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  SVK   H ++ H S+AL + I DFVK+I+
Sbjct  1449  LTDLRAAAVNNENFARISVKHSFHLHLRHGSSALEAQIKDFVKDIQ  1494



>ref|XP_007051387.1| Helicase, C-terminal, Argonaute and Dicer protein, PAZ, Ribonuclease 
III, bacterial isoform 2 [Theobroma cacao]
 gb|EOX95544.1| Helicase, C-terminal, Argonaute and Dicer protein, PAZ, Ribonuclease 
III, bacterial isoform 2 [Theobroma cacao]
Length=1610

 Score = 68.6 bits (166),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1407  VESIAGAIFLDSGRDTSVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1464

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1465  ASRSGN-LATVEVFID-GVQIGVAQNPQKKMAQKLAA  1499


 Score = 45.4 bits (106),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1336  LTDLRAAAVNNENFARVAVKHQLHVHLRHGSSALEKQIRDFVKEVQ  1381



>ref|XP_002966292.1| hypothetical protein SELMODRAFT_86110 [Selaginella moellendorffii]
 gb|EFJ32319.1| hypothetical protein SELMODRAFT_86110 [Selaginella moellendorffii]
Length=1730

 Score = 67.4 bits (163),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (62%), Gaps = 11/97 (11%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR----KYRMK  360
             +ESIAGAI+LD+GL  D V++    +LEPMVTP++L ++PV+EL E CQ++    +YR  
Sbjct  1520  LESIAGAIFLDTGLAADEVWKVFERLLEPMVTPDTLPVHPVRELQERCQQQAEGLEYRAS  1579

Query  359   EPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAK  249
                   ++G +  T+EV  +G    C+ + + +   K
Sbjct  1580  ------REG-SIATVEVFVDGVQIGCAQNTQKKMAQK  1609


 Score = 47.0 bits (110),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  SVK   H ++ H S+AL + I DFVK+I+
Sbjct  1449  LTDLRAAAVNNENFARISVKHSFHLHLRHGSSALEAQIKDFVKDIQ  1494



>ref|XP_011071730.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Sesamum 
indicum]
Length=1572

 Score = 68.2 bits (165),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T  V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1369  VESIAGAIFLDSGCNTAAVWKVFQPLLNPMVTPETLPMHPVRELQERCQQQAEGLEYK--  1426

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               ++G    T+EV  + GV+   +    +K A++LA 
Sbjct  1427  ASRNGN-LATVEVYVD-GVQVGVAHNPQKKMAQKLAA  1461


 Score = 45.8 bits (107),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1298  LTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVQNELSKPGF  1351



>ref|XP_003626620.1| Endoribonuclease Dicer-like protein [Medicago truncatula]
Length=1965

 Score = 68.2 bits (165),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1763  LESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1813


 Score = 45.8 bits (107),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1692  LTDLRAAAVNNENFARVTVKHNLHLHLRHGSSALEKQIKDFVKEVQDELSKPGF  1745



>gb|ABD32724.1| Helicase, C-terminal; Argonaute and Dicer protein, PAZ; Ribonuclease 
III, bacterial [Medicago truncatula]
Length=1939

 Score = 68.2 bits (165),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1737  LESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1787


 Score = 45.8 bits (107),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1666  LTDLRAAAVNNENFARVTVKHNLHLHLRHGSSALEKQIKDFVKEVQDELSKPGF  1719



>ref|XP_007051386.1| Dicer-like 1 isoform 1 [Theobroma cacao]
 gb|EOX95543.1| Dicer-like 1 isoform 1 [Theobroma cacao]
Length=2007

 Score = 68.6 bits (166),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1804  VESIAGAIFLDSGRDTSVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1861

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1862  ASRSGN-LATVEVFID-GVQIGVAQNPQKKMAQKLAA  1896


 Score = 45.4 bits (106),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1733  LTDLRAAAVNNENFARVAVKHQLHVHLRHGSSALEKQIRDFVKEVQ  1778



>ref|XP_011071729.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Sesamum 
indicum]
Length=1934

 Score = 67.8 bits (164),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T  V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1731  VESIAGAIFLDSGCNTAAVWKVFQPLLNPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1788

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               ++G    T+EV  + GV+   +    +K A++LA 
Sbjct  1789  ASRNGN-LATVEVYVD-GVQVGVAHNPQKKMAQKLAA  1823


 Score = 45.8 bits (107),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1660  LTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVQNELSKPGF  1713



>gb|KDP28399.1| hypothetical protein JCGZ_14170 [Jatropha curcas]
Length=1986

 Score = 68.2 bits (165),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1783  VESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1842

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + G++   +    +K A++LA 
Sbjct  1843  --RSGN-LATVEVFID-GIQIGVAQNPQKKMAQKLAA  1875


 Score = 45.8 bits (107),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1712  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEKQIRDFVKEVQDELSKPGF  1765



>ref|XP_010054145.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Eucalyptus 
grandis]
Length=1930

 Score = 68.2 bits (165),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTP+ L ++PV+EL E CQ++   ++    
Sbjct  1730  VESIAGAIFLDSGHDTAVVWKAFQPLLHPMVTPDRLPMHPVRELQERCQQQAEGLE--YK  1787

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               ++G    T+EV  + GV+   +    +K A++LA 
Sbjct  1788  ASRNGN-LATVEVFVD-GVQVGVAQNPQKKMAQKLAA  1822


 Score = 45.4 bits (106),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1659  LTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIRDFVKEVQDELSKPGF  1712



>ref|XP_010054144.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Eucalyptus 
grandis]
Length=1954

 Score = 68.2 bits (165),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTP+ L ++PV+EL E CQ++   ++    
Sbjct  1754  VESIAGAIFLDSGHDTAVVWKAFQPLLHPMVTPDRLPMHPVRELQERCQQQAEGLE--YK  1811

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               ++G    T+EV  + GV+   +    +K A++LA 
Sbjct  1812  ASRNGN-LATVEVFVD-GVQVGVAQNPQKKMAQKLAA  1846


 Score = 45.4 bits (106),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1683  LTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIRDFVKEVQDELSKPGF  1736



>gb|KHG02896.1| Endoribonuclease Dicer -like protein [Gossypium arboreum]
Length=1962

 Score = 67.8 bits (164),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1759  VESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1816

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1817  ASRSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLAA  1851


 Score = 45.4 bits (106),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1688  LTDLRAAAVNNENFARVAVKHQLHVHLRHGSSALEKQIRDFVKEVQ  1733



>ref|XP_006491399.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Citrus sinensis]
Length=1963

 Score = 69.7 bits (169),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L+PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1760  VESIAGAIFLDSGRDTSVVWQVFQPLLDPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1817

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1818  ASRSGN-LATVEVYID-GVQVGVAQNPQKKMAQKLAA  1852


 Score = 43.9 bits (102),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK +
Sbjct  1689  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALDRQIRDFVKEV  1733



>ref|XP_006444699.1| hypothetical protein CICLE_v10018447mg [Citrus clementina]
 gb|ESR57939.1| hypothetical protein CICLE_v10018447mg [Citrus clementina]
Length=1963

 Score = 69.7 bits (169),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L+PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1760  VESIAGAIFLDSGRDTSVVWQVFQPLLDPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1817

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1818  ASRSGN-LATVEVYID-GVQVGVAQNPQKKMAQKLAA  1852


 Score = 43.9 bits (102),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK +
Sbjct  1689  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALDRQIRDFVKEV  1733



>dbj|BAD94606.1| CAF protein [Arabidopsis thaliana]
Length=690

 Score = 64.3 bits (155),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
            +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  476  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  526


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
            LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S+   F
Sbjct  405  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGF  458



>gb|KDO86652.1| hypothetical protein CISIN_1g000174mg [Citrus sinensis]
Length=1931

 Score = 69.7 bits (169),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L+PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1728  VESIAGAIFLDSGRDTSVVWQVFQPLLDPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1785

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1786  ASRSGN-LATVEVYID-GVQVGVAQNPQKKMAQKLAA  1820


 Score = 43.9 bits (102),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK +
Sbjct  1657  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALDRQIRDFVKEV  1701



>ref|XP_001757950.1| dsRNA-specific nuclease dicer and related ribonuclease [Physcomitrella 
patens]
 gb|EDQ77192.1| dsRNA-specific nuclease dicer and related ribonuclease [Physcomitrella 
patens]
Length=1662

 Score = 70.9 bits (172),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (65%), Gaps = 8/99 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGA++LD+ L TD V++   P+L+PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1457  LESIAGALFLDACLETDHVWKVFEPLLQPMVTPETLPMHPVRELQERCQQQAEALE----  1512

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
              +K   A    T+EV  + GV+  S+    +K A++LA 
Sbjct  1513  -YKASRAGNVATVEVYVD-GVQIGSAQNAQKKMAQKLAA  1549


 Score = 42.7 bits (99),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK   H ++ H S+AL + I +FV +I+
Sbjct  1386  LTDLRAAAVNNENFARVAVKHSFHLHLRHGSSALETQIRNFVNDIQ  1431



>gb|ABV31244.1| dicer-like 1 [Physcomitrella patens]
Length=1662

 Score = 70.9 bits (172),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (65%), Gaps = 8/99 (8%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGA++LD+ L TD V++   P+L+PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1457  LESIAGALFLDACLETDHVWKVFEPLLQPMVTPETLPMHPVRELQERCQQQAEALE----  1512

Query  347   VHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
              +K   A    T+EV  + GV+  S+    +K A++LA 
Sbjct  1513  -YKASRAGNVATVEVYVD-GVQIGSAQNAQKKMAQKLAA  1549


 Score = 42.7 bits (99),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK   H ++ H S+AL + I +FV +I+
Sbjct  1386  LTDLRAAAVNNENFARVAVKHSFHLHLRHGSSALETQIRNFVNDIQ  1431



>ref|XP_007220573.1| hypothetical protein PRUPE_ppa000070mg [Prunus persica]
 gb|EMJ21772.1| hypothetical protein PRUPE_ppa000070mg [Prunus persica]
Length=1971

 Score = 67.4 bits (163),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
              ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1768  FESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1818


 Score = 45.8 bits (107),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1697  LTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIHDFVKEVQNELSKPGF  1750



>ref|XP_006386668.1| Endoribonuclease Dicer family protein [Populus trichocarpa]
 gb|ERP64465.1| Endoribonuclease Dicer family protein [Populus trichocarpa]
Length=1967

 Score = 68.6 bits (166),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 4/96 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1764  VESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1823

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               + G    T+EV  + GV+   +    +K A++LA
Sbjct  1824  --RSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLA  1855


 Score = 44.7 bits (104),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV+ ++       F
Sbjct  1693  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEKQIRDFVREVQDELLKPVF  1746



>gb|AEZ02177.1| Dicer [Arabidopsis thaliana]
Length=1886

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1672  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1722


 Score = 48.5 bits (114),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S+   F
Sbjct  1601  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGF  1654



>ref|XP_009335261.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=1971

 Score = 66.6 bits (161),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
              ESIAGA++LDSG  T  V++  +P+L+PMVTPE+L ++PV+EL E CQ+    ++    
Sbjct  1769  FESIAGAVFLDSGRDTGAVWKVFQPLLQPMVTPETLPMHPVRELQERCQQLAEGLEYKAT  1828

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + G++   +    +K A++LA 
Sbjct  1829  --RSGNV-ATVEVFID-GIQMAIAQNPQKKMAQKLAA  1861


 Score = 46.6 bits (109),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH ++ H STAL   I DFVK +
Sbjct  1698  LTDLRAAAVNNENFARVAVKHNLHVHLRHGSTALEKQIHDFVKEV  1742



>gb|AAF03534.1|AF187317_1 CAF protein [Arabidopsis thaliana]
Length=1909

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1695  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1745


 Score = 48.1 bits (113),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S+   F
Sbjct  1624  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGF  1677



>ref|NP_171612.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
 sp|Q9SP32.2|DCL1_ARATH RecName: Full=Endoribonuclease Dicer homolog 1; AltName: Full=Dicer-like 
protein 1; Short=AtDCL1; AltName: Full=Protein ABNORMAL 
SUSPENSOR 1; AltName: Full=Protein CARPEL FACTORY; AltName: 
Full=Protein SHORT INTEGUMENTS 1; AltName: Full=Protein 
SUSPENSOR 1 [Arabidopsis thaliana]
 gb|AAG38019.1|AF292940_1 short integuments 1 [Arabidopsis thaliana]
 gb|AAG38020.1|AF292941_1 short integuments 1 [Arabidopsis thaliana]
 gb|AEE27220.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
Length=1909

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1695  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1745


 Score = 48.1 bits (113),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S+   F
Sbjct  1624  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGF  1677



>ref|NP_001184881.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
 gb|AEE27221.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
Length=1910

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1696  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1746


 Score = 48.1 bits (113),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S+   F
Sbjct  1625  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGF  1678



>ref|XP_008244191.1| PREDICTED: endoribonuclease Dicer homolog 1 [Prunus mume]
Length=1953

 Score = 67.0 bits (162),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
              ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1750  FESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1800


 Score = 45.8 bits (107),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1679  LTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIHDFVKEVQNELSKPGF  1732



>ref|NP_001289827.1| endoribonuclease Dicer homolog 1 [Solanum lycopersicum]
 gb|AGN12837.1| dicer-like protein 1 [Solanum lycopersicum]
Length=1914

 Score = 69.7 bits (169),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T  V+E  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1713  VESIAGAIFLDSGCNTKSVWEVFQPLLHPMVTPETLPMHPVRELQERCQQQAQGLEYKAT  1772

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1773  --RSGN-MATVEVYVD-GVQVGMAQNPQKKMAQKLAA  1805


 Score = 43.1 bits (100),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH +  H S+AL   I DFV  ++   +   F
Sbjct  1642  LTDLRAAAVNNENFARVAVKHSLHLHFRHGSSALEKQIRDFVNEVKNELSKPGF  1695



>gb|KJB09576.1| hypothetical protein B456_001G150400 [Gossypium raimondii]
Length=1950

 Score = 68.2 bits (165),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1748  VESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1805

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1806  ASRSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLAA  1840


 Score = 44.7 bits (104),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1677  LTDLRAAAVNNENFARVAVKHLLHVHLRHGSSALEKQIRDFVKEVQ  1722



>ref|XP_006604922.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Glycine 
max]
 ref|XP_006604923.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X2 [Glycine 
max]
 ref|XP_006604924.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X3 [Glycine 
max]
 ref|XP_006604925.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X4 [Glycine 
max]
Length=1945

 Score = 68.2 bits (165),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1744  LESIAGAIFLDSGRDTTVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1794


 Score = 44.7 bits (104),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++   +   F
Sbjct  1673  LTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQDELSKPGF  1726



>ref|XP_006352611.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Solanum tuberosum]
Length=1914

 Score = 68.2 bits (165),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T  V+E  +P+L PMVTPE+L ++PV+EL E CQ+    ++    
Sbjct  1713  VESIAGAIFLDSGCNTKSVWEVFQPLLHPMVTPETLPMHPVRELQERCQQEAQGLEYKAT  1772

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + G++   +    +K A++LA 
Sbjct  1773  --RSGN-MATVEVYVD-GLQVGMAQNPQKKMAQKLAA  1805


 Score = 44.7 bits (104),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H+S+AL   I DFV  ++   +   F
Sbjct  1642  LTDLRAAAVNNENFARVAVKHSLHLHLRHASSALEKQIRDFVNEVKNELSKPGF  1695



>gb|KJB09575.1| hypothetical protein B456_001G150400 [Gossypium raimondii]
Length=1892

 Score = 67.8 bits (164),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1748  VESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1805

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1806  ASRSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLAA  1840


 Score = 44.7 bits (104),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1677  LTDLRAAAVNNENFARVAVKHLLHVHLRHGSSALEKQIRDFVKEVQ  1722



>ref|XP_006418369.1| hypothetical protein EUTSA_v10006531mg [Eutrema salsugineum]
 gb|ESQ36722.1| hypothetical protein EUTSA_v10006531mg [Eutrema salsugineum]
Length=1917

 Score = 65.1 bits (157),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1703  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1753


 Score = 47.8 bits (112),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK +   S+   F
Sbjct  1632  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVLTESSKPGF  1685



>gb|AJA90756.1| Dicer-like 3 [Cycas revoluta]
Length=1876

 Score = 67.8 bits (164),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ES+AGA+ +D+    D V+E ++P+L P+V+PE+L L+P++EL ELC ++ Y +     
Sbjct  1420  VESLAGALLVDTRFDLDRVWEIMKPILSPIVSPETLNLHPLRELLELCYQKGYCISWKFT  1479

Query  347   VHKDGE-ACTTIEV-MANGGVRSCSSSARNRKTAKRLACERM  228
               K G+    ++EV + +  V   + S  N+KTAK++A E +
Sbjct  1480  --KQGKLTVASVEVQLEDSSVIVGTGSKMNKKTAKKVAAEHI  1519


 Score = 45.1 bits (105),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  575
             LT+LRS +VNN  +A  +VK  +  Y+ H S AL + I +FVK ++Q
Sbjct  1349  LTDLRSAAVNNENFARVAVKQNIQKYLRHGSGALLTQITEFVKAVDQ  1395



>gb|KHN11363.1| Endoribonuclease Dicer like 1 [Glycine soja]
Length=1946

 Score = 68.2 bits (165),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1745  LESIAGAIFLDSGRDTTVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1795


 Score = 44.7 bits (104),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++   +   F
Sbjct  1674  LTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQDELSKPGF  1727



>ref|XP_002892088.1| hypothetical protein ARALYDRAFT_333551 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68347.1| hypothetical protein ARALYDRAFT_333551 [Arabidopsis lyrata subsp. 
lyrata]
Length=1962

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1748  VESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1798


 Score = 48.1 bits (113),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S+   F
Sbjct  1677  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGF  1730



>ref|XP_011025346.1| PREDICTED: endoribonuclease Dicer homolog 1 [Populus euphratica]
Length=1970

 Score = 68.2 bits (165),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T  V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1767  VESIAGAIFLDSGRDTAFVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1826

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1827  --RSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLAA  1859


 Score = 44.7 bits (104),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV+ ++
Sbjct  1696  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEKQIRDFVREVQ  1741



>ref|XP_004494885.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X2 [Cicer 
arietinum]
Length=1892

 Score = 67.8 bits (164),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1691  VESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1741


 Score = 44.7 bits (104),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++   +   F
Sbjct  1620  LTDLRAAAVNNENFARVAVKHNLHMHLRHGSSALEKQIKEFVKEVQNELSKPGF  1673



>ref|XP_004155270.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
1-like [Cucumis sativus]
Length=1987

 Score = 66.6 bits (161),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1784  VESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1834


 Score = 45.8 bits (107),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1713  LTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQ  1758



>ref|XP_004134274.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Cucumis sativus]
Length=1986

 Score = 66.6 bits (161),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1783  VESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1833


 Score = 45.8 bits (107),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1712  LTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQ  1757



>gb|KGN56328.1| hypothetical protein Csa_3G116650 [Cucumis sativus]
Length=1989

 Score = 66.6 bits (161),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1786  VESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1845

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
                +     T+EV  + GV+   +    +K A++LA 
Sbjct  1846  RIGN---LATVEVFID-GVQIGIAQNPQKKMAQKLAA  1878


 Score = 45.8 bits (107),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1715  LTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQ  1760



>ref|XP_008437750.1| PREDICTED: endoribonuclease Dicer homolog 1 [Cucumis melo]
Length=1990

 Score = 66.6 bits (161),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1787  VESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1846

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1847  --RIGN-LATVEVFID-GVQIGVAQNPQKKMAQKLAA  1879


 Score = 45.4 bits (106),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++
Sbjct  1716  LTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQ  1761



>ref|XP_004494884.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Cicer 
arietinum]
Length=1895

 Score = 67.8 bits (164),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1694  VESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1744


 Score = 44.7 bits (104),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++   +   F
Sbjct  1623  LTDLRAAAVNNENFARVAVKHNLHMHLRHGSSALEKQIKEFVKEVQNELSKPGF  1676



>ref|XP_002515097.1| dicer-1, putative [Ricinus communis]
 gb|EEF47081.1| dicer-1, putative [Ricinus communis]
Length=1543

 Score = 69.3 bits (168),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1340  VESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1399

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1400  --RSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLAA  1432


 Score = 43.1 bits (100),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +V   LH ++ H S+AL   I DFV+ ++   +   F
Sbjct  1269  LTDLRAAAVNNENFARVAVNHKLHVHLRHGSSALEKQIRDFVREVQDELSKPGF  1322



>ref|XP_007139041.1| hypothetical protein PHAVU_009G260000g [Phaseolus vulgaris]
 gb|ESW11035.1| hypothetical protein PHAVU_009G260000g [Phaseolus vulgaris]
Length=1950

 Score = 67.8 bits (164),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1749  VESIAGAIFLDSGRDTSVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1799


 Score = 44.3 bits (103),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++
Sbjct  1678  LTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQ  1723



>ref|XP_008358840.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Malus domestica]
Length=1969

 Score = 66.6 bits (161),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
              ESIAGA++LDSG  T  V++  +P+L+PMVTPE+L ++PV+EL E CQ+    ++    
Sbjct  1767  FESIAGAVFLDSGRDTGAVWKVFQPLLQPMVTPETLPMHPVRELQERCQQLAEGLEYKAT  1826

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + G++   +    +K A++LA 
Sbjct  1827  --RSGNVA-TVEVFID-GIQMAIAQNPQKKMAQKLAA  1859


 Score = 45.4 bits (106),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH ++ H STAL   I DFVK +
Sbjct  1696  LTDLRAAAVNNENFARVAVKHYLHVHLRHGSTALEKQIHDFVKEV  1740



>ref|XP_010241057.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nelumbo nucifera]
Length=2035

 Score = 67.4 bits (163),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 4/96 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1832  VESIAGAIFLDSGGDTSVVWRVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1891

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               + G    T+EV  + GV+   +    +K A++LA
Sbjct  1892  --RSGN-LATVEVYID-GVQVGIAQNPQKKMAQKLA  1923


 Score = 44.7 bits (104),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV +++
Sbjct  1761  LTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEAQIRDFVNDVQ  1806



>ref|XP_009411416.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1558

 Score = 62.8 bits (151),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LD+     IV++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1352  VESIAGAIFLDNEHDASIVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1411

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               + G    T+EV  + GV+   +    +K A++LA
Sbjct  1412  --RTGN-IATVEVFID-GVQIGIAQNPQKKMAQKLA  1443


 Score = 48.9 bits (115),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW  548
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK+++   + + F +
Sbjct  1281  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVQDELSRTGFNY  1336



>ref|XP_011083615.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X4 [Sesamum 
indicum]
Length=1616

 Score = 64.3 bits (155),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +DS L  D V++  +P+L P+VTP+ L L P +EL ELC    Y +KE   
Sbjct  1336  VESIAGAILIDSSLNLDKVWKVFKPLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFA  1395

Query  347   VHKDGEAC-TTIEVMANGGVRSCSSSARNRKTAKRLA  240
                DG+     +++     +     S  NRK +K +A
Sbjct  1396  A--DGDIVRAELKLQLEDVLLEAQGSGPNRKASKGMA  1430


 Score = 47.4 bits (111),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  563
             LT+LRS SVNN  +A+++VK  LH+++ H S  L S I++FVK++   S +
Sbjct  1270  LTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFYLESQISEFVKHVADMSTT  1320



>ref|XP_010686530.1| PREDICTED: endoribonuclease Dicer homolog 1 [Beta vulgaris subsp. 
vulgaris]
Length=1972

 Score = 66.6 bits (161),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V+    P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1769  VESIAGAIFLDSGHDTAVVWRVFEPLLQPMVTPETLPMHPVRELQERCQQQ  1819


 Score = 45.1 bits (105),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H STAL   I DFVK  +
Sbjct  1698  LTDLRAAAVNNENFARVAVKHRLHVHLRHGSTALEKQIRDFVKEAQ  1743



>ref|XP_009366581.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Pyrus x bretschneideri]
Length=1974

 Score = 67.0 bits (162),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
              ESIAGAI+LDSG  T  V++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1773  FESIAGAIFLDSGRNTTAVWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1823


 Score = 45.1 bits (105),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK +
Sbjct  1702  LTDLRAAAVNNENFAHVAVKHNLHVHLRHGSSALEKQINDFVKEV  1746



>ref|XP_006577359.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Glycine max]
Length=1947

 Score = 67.4 bits (163),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1746  VESIAGAIFLDSGRDTTVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1796


 Score = 44.7 bits (104),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++
Sbjct  1675  LTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQ  1720



>ref|XP_011083472.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X2 [Sesamum 
indicum]
Length=1651

 Score = 64.3 bits (155),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +DS L  D V++  +P+L P+VTP+ L L P +EL ELC    Y +KE   
Sbjct  1371  VESIAGAILIDSSLNLDKVWKVFKPLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFA  1430

Query  347   VHKDGEAC-TTIEVMANGGVRSCSSSARNRKTAKRLA  240
                DG+     +++     +     S  NRK +K +A
Sbjct  1431  A--DGDIVRAELKLQLEDVLLEAQGSGPNRKASKGMA  1465


 Score = 47.4 bits (111),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  563
             LT+LRS SVNN  +A+++VK  LH+++ H S  L S I++FVK++   S +
Sbjct  1305  LTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFYLESQISEFVKHVADMSTT  1355



>ref|XP_011083691.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X5 [Sesamum 
indicum]
Length=1586

 Score = 64.3 bits (155),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +DS L  D V++  +P+L P+VTP+ L L P +EL ELC    Y +KE   
Sbjct  1373  VESIAGAILIDSSLNLDKVWKVFKPLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFA  1432

Query  347   VHKDGEAC-TTIEVMANGGVRSCSSSARNRKTAKRLA  240
                DG+     +++     +     S  NRK +K +A
Sbjct  1433  A--DGDIVRAELKLQLEDVLLEAQGSGPNRKASKGMA  1467


 Score = 47.4 bits (111),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  563
             LT+LRS SVNN  +A+++VK  LH+++ H S  L S I++FVK++   S +
Sbjct  1307  LTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFYLESQISEFVKHVADMSTT  1357



>ref|XP_011083398.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X1 [Sesamum 
indicum]
Length=1653

 Score = 64.3 bits (155),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +DS L  D V++  +P+L P+VTP+ L L P +EL ELC    Y +KE   
Sbjct  1373  VESIAGAILIDSSLNLDKVWKVFKPLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFA  1432

Query  347   VHKDGEAC-TTIEVMANGGVRSCSSSARNRKTAKRLA  240
                DG+     +++     +     S  NRK +K +A
Sbjct  1433  A--DGDIVRAELKLQLEDVLLEAQGSGPNRKASKGMA  1467


 Score = 47.4 bits (111),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  563
             LT+LRS SVNN  +A+++VK  LH+++ H S  L S I++FVK++   S +
Sbjct  1307  LTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFYLESQISEFVKHVADMSTT  1357



>ref|XP_009411415.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1926

 Score = 62.8 bits (151),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LD+     IV++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1720  VESIAGAIFLDNEHDASIVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAEGLEYKAT  1779

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
               + G    T+EV  + GV+   +    +K A++LA
Sbjct  1780  --RTGN-IATVEVFID-GVQIGIAQNPQKKMAQKLA  1811


 Score = 48.9 bits (115),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW  548
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK+++   + + F +
Sbjct  1649  LTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVQDELSRTGFNY  1704



>gb|KHN16394.1| Endoribonuclease Dicer like 1 [Glycine soja]
Length=1948

 Score = 67.4 bits (163),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++PV+EL E CQ++
Sbjct  1747  VESIAGAIFLDSGRDTTVVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQ  1797


 Score = 44.3 bits (103),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  578
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++
Sbjct  1676  LTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQ  1721



>ref|XP_011083770.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X6 [Sesamum 
indicum]
Length=1572

 Score = 64.3 bits (155),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +DS L  D V++  +P+L P+VTP+ L L P +EL ELC    Y +KE   
Sbjct  1373  VESIAGAILIDSSLNLDKVWKVFKPLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFA  1432

Query  347   VHKDGEAC-TTIEVMANGGVRSCSSSARNRKTAKRLA  240
                DG+     +++     +     S  NRK +K +A
Sbjct  1433  A--DGDIVRAELKLQLEDVLLEAQGSGPNRKASKGMA  1467


 Score = 47.4 bits (111),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  563
             LT+LRS SVNN  +A+++VK  LH+++ H S  L S I++FVK++   S +
Sbjct  1307  LTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFYLESQISEFVKHVADMSTT  1357



>ref|XP_011083544.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X3 [Sesamum 
indicum]
Length=1641

 Score = 64.3 bits (155),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +DS L  D V++  +P+L P+VTP+ L L P +EL ELC    Y +KE   
Sbjct  1361  VESIAGAILIDSSLNLDKVWKVFKPLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFA  1420

Query  347   VHKDGEAC-TTIEVMANGGVRSCSSSARNRKTAKRLA  240
                DG+     +++     +     S  NRK +K +A
Sbjct  1421  A--DGDIVRAELKLQLEDVLLEAQGSGPNRKASKGMA  1455


 Score = 47.4 bits (111),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  563
             LT+LRS SVNN  +A+++VK  LH+++ H S  L S I++FVK++   S +
Sbjct  1295  LTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFYLESQISEFVKHVADMSTT  1345



>ref|XP_010107130.1| Endoribonuclease Dicer-1-like protein [Morus notabilis]
 gb|EXC13651.1| Endoribonuclease Dicer-1-like protein [Morus notabilis]
Length=1941

 Score = 65.9 bits (159),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDSG  + +V++   P+L+PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1739  VESIAGAIFLDSGRDSAVVWKVFEPLLQPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1796

Query  347   VHKDGEACTTIEVMANG  297
               ++G    T+EV  +G
Sbjct  1797  ASRNGNVA-TVEVFIDG  1812


 Score = 45.4 bits (106),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +V+  LH ++ H S+AL   I DFVK ++   +   F
Sbjct  1668  LTDLRAAAVNNENFARVAVRHNLHVHLRHGSSALEKQIRDFVKEVQSELSKPGF  1721



>ref|XP_011468880.1| PREDICTED: endoribonuclease Dicer homolog 1 [Fragaria vesca subsp. 
vesca]
Length=1932

 Score = 67.8 bits (164),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T +V++   P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1728  IESIAGAIFLDSGRNTAVVWKVFEPLLQPMVTPETLPMHPVRELQERCQQQ  1778


 Score = 43.5 bits (101),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  587
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK
Sbjct  1657  LTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALERQIHDFVK  1699



>ref|XP_009119662.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
1 [Brassica rapa]
Length=1866

 Score = 65.5 bits (158),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1656  VESIAGAIFLDSGRDTSAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1706


 Score = 45.8 bits (107),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK +   S+   F
Sbjct  1585  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVLTESSKPGF  1638



>emb|CDY15207.1| BnaC05g00860D [Brassica napus]
Length=1809

 Score = 65.1 bits (157),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1599  VESIAGAIFLDSGRDTSAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1649


 Score = 45.8 bits (107),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK +   S+   F
Sbjct  1528  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVLTESSKPGF  1581



>ref|XP_009606996.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nicotiana tomentosiformis]
Length=1907

 Score = 67.4 bits (163),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
              ESIAGAI+LDSG  T  V++  +P+L PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1706  FESIAGAIFLDSGCDTAAVWKVFQPLLHPMVTPETLPMHPVRELQERCQQQAQGLE--YK  1763

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + G++   +    +K A++LA 
Sbjct  1764  ASRSGN-IATVEVYVD-GIQVGMAQNPQKKMAQKLAA  1798


 Score = 43.9 bits (102),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV  ++   +   F
Sbjct  1635  LTDLRAAAVNNENFARVAVKHSLHLHLRHGSSALEKQIRDFVSEVKNELSKPGF  1688



>emb|CDX90002.1| BnaA10g00800D [Brassica napus]
Length=1812

 Score = 65.1 bits (157),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
             +ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1602  VESIAGAIFLDSGRDTSAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1652


 Score = 45.8 bits (107),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
             LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK +   S+   F
Sbjct  1531  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVLTESSKPGF  1584



>ref|XP_002464289.1| hypothetical protein SORBIDRAFT_01g015666 [Sorghum bicolor]
 gb|EER91287.1| hypothetical protein SORBIDRAFT_01g015666 [Sorghum bicolor]
Length=462

 Score = 59.7 bits (143),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKY  369
             E+IAGAIY+DSG   + V+  +R +L P+ TPE++ L+PV EL ELC+ + Y
Sbjct  351  FEAIAGAIYVDSGNDKEAVWRAMRRLLVPLATPETILLDPVSELKELCEHKNY  403


 Score = 51.6 bits (122),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 8/68 (12%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASS--TFGWVL  542
            LT LR  SVNN CYA ++VKAGLH +ILHSS+         +K++E S   S  + GW  
Sbjct  286  LTNLRKASVNNWCYAHAAVKAGLHKHILHSSS------KQMIKDLESSGPFSGPSHGWEP  339

Query  541  KTSFPWNL  518
                P +L
Sbjct  340  GIGLPEDL  347



>ref|XP_008376239.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
1-like [Malus domestica]
Length=1970

 Score = 67.0 bits (162),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
              ESIAGAI+LDSG  T  V++  +P+L+PMVTPE+L ++PV+EL E CQ++
Sbjct  1769  FESIAGAIFLDSGHNTAAVWKVFQPLLQPMVTPETLPMHPVRELQERCQQQ  1819


 Score = 43.5 bits (101),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH ++ H  +AL   I DFVK +
Sbjct  1698  LTDLRAAAVNNENFARVAVKHNLHVHLRHGXSALEKQINDFVKEV  1742



>gb|EPS58332.1| hypothetical protein M569_16483, partial [Genlisea aurea]
Length=554

 Score = 62.8 bits (151),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR  375
            +ES+AGAI+LD G  T  V++  +P+L+PMVTPE+L ++PV+EL E CQ +
Sbjct  404  VESVAGAIFLDGGCNTRDVWKVFQPLLDPMVTPETLPMHPVRELQERCQHQ  454


 Score = 47.8 bits (112),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTF  554
            LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK +++  +   F
Sbjct  333  LTDLRAAAVNNENFARVAVKHNLHAHLRHGSSALDKQIRDFVKEVQKELSEPGF  386



>ref|XP_001772316.1| predicted protein [Physcomitrella patens]
 gb|EDQ62787.1| predicted protein [Physcomitrella patens]
Length=1275

 Score = 67.0 bits (162),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKY  369
            +ES+AGA++LDSG + D V+   + +L+P+VTP +LRL P++EL ELCQ  K+
Sbjct  832  VESLAGAVFLDSGYKLDTVWNVFKQLLKPLVTPATLRLEPIRELWELCQTEKF  884


 Score = 43.1 bits (100),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW  548
            LT+LRS +VNN C+A  +V+  LH Y+LH+S+ L + +  +V     ++ +   GW
Sbjct  766  LTDLRSAAVNNECFARVAVRHNLHLYLLHNSSDLAARVDKYVHG--STTDAQCHGW  819



>ref|XP_008364841.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
1-like [Malus domestica]
Length=1911

 Score = 66.6 bits (161),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQK  378
              ESIAGAI+LDSG  T  V++  +P+L+PMVTPE+L ++PV+EL E CQ+
Sbjct  1710  FESIAGAIFLDSGHNTAAVWKVFQPLLQPMVTPETLPMHPVRELQERCQQ  1759


 Score = 43.5 bits (101),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH ++ H  +AL   I DFVK +
Sbjct  1639  LTDLRAAAVNNENFARVAVKHNLHVHLRHGXSALEKQINDFVKEV  1683



>ref|XP_002458957.1| hypothetical protein SORBIDRAFT_03g043355 [Sorghum bicolor]
 gb|EES04077.1| hypothetical protein SORBIDRAFT_03g043355 [Sorghum bicolor]
Length=1651

 Score = 62.4 bits (150),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKY  369
             +ESIAGAI +DS L  D+V+   +P+L P+VTPE+L L P +EL E C K  Y
Sbjct  1378  VESIAGAILIDSKLDLDLVWRVFKPLLSPIVTPENLELPPFRELNEWCDKNGY  1430


 Score = 47.0 bits (110),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST  557
             LT+LRS SVNN  +A  +VK  LH ++ HSS  L+  I ++V ++E SS   T
Sbjct  1308  LTDLRSASVNNENFAQVAVKHNLHQFLQHSSGFLQDQITEYVNSLEGSSMDRT  1360



>gb|ABV31246.1| dicer-like 4 [Physcomitrella patens]
Length=1445

 Score = 67.0 bits (162),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKY  369
             +ES+AGA++LDSG + D V+   + +L+P+VTP +LRL P++EL ELCQ  K+
Sbjct  1314  VESLAGAVFLDSGYKLDTVWNVFKQLLKPLVTPATLRLEPIRELWELCQTEKF  1366


 Score = 42.0 bits (97),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  590
             LT+LRS +VNN C+A  +V+  LH Y+LH+S+ L + +  +V
Sbjct  1241  LTDLRSAAVNNECFARVAVRHNLHLYLLHNSSDLAARVDKYV  1282



>ref|XP_010556636.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556637.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556638.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
Length=1946

 Score = 63.5 bits (153),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDS   T +V+    P+++PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1739  VESIAGAIFLDSQKDTTVVWGVFEPLMQPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1796

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1797  ASRSGN-MATVEVFID-GVQVGMAHNPQKKMAQKLAA  1831


 Score = 45.1 bits (105),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH Y+ H STAL   I DF K +
Sbjct  1668  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSTALERQIRDFEKEV  1712



>ref|XP_010556639.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Tarenaya 
hassleriana]
Length=1945

 Score = 63.5 bits (153),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI+LDS   T +V+    P+++PMVTPE+L ++PV+EL E CQ++   ++    
Sbjct  1738  VESIAGAIFLDSQKDTTVVWGVFEPLMQPMVTPETLPMHPVRELQERCQQQAEGLE--YK  1795

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1796  ASRSGN-MATVEVFID-GVQVGMAHNPQKKMAQKLAA  1830


 Score = 45.1 bits (105),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK  LH Y+ H STAL   I DF K +
Sbjct  1667  LTDLRAAAVNNENFARVAVKHKLHLYLRHGSTALERQIRDFEKEV  1711



>gb|ABG74922.1| Dicer-like 1b protein [Physcomitrella patens]
Length=1695

 Score = 66.2 bits (160),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
              ESIAGA++LD+ L T  V++   P+L+PMV+PE+L ++PV+ L E CQ+    ++  V 
Sbjct  1480  FESIAGALFLDARLDTHQVWKVFEPLLQPMVSPETLPIHPVRGLQERCQQEAEGLEYKV-  1538

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
                  E+  T+EV  + GV+  S+ +  +K A++L  
Sbjct  1539  --SRAESVATVEVYVD-GVQIGSTQSAQKKMAQKLGA  1572


 Score = 42.4 bits (98),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  581
             LT+LR+ +VNN  +A  +VK   H ++ H STAL + I +FV +I
Sbjct  1409  LTDLRAAAVNNENFARVAVKHSYHLHLRHGSTALETQIRNFVNDI  1453



>gb|AJA90772.1| Dicer-like 3 [Ginkgo biloba]
Length=1815

 Score = 63.9 bits (154),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +DS    + V+E ++P+L P+VTPE+L L+P++E+ ELC    Y +     
Sbjct  1434  IESIAGAILVDSRFDLEQVWEIMKPILSPIVTPETLDLHPLREVCELCHLNGYSIIWNKS  1493

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               +      T+EV              N+KTAK+ A +++
Sbjct  1494  TQQGKLTVVTVEVKLEDCTIYGKGCKLNKKTAKKEAAQQI  1533


 Score = 43.9 bits (102),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ----SSASSTFGW  548
             LT+LRS +VNN  +A  +VK  L  Y+ H S AL   I  F+K ++Q     S  ++FG 
Sbjct  1363  LTDLRSAAVNNENFAQVAVKHNLQQYLRHGSGALLGQITAFIKAVQQCKENKSHCTSFGG  1422

Query  547   VLK  539
              +K
Sbjct  1423  GIK  1425



>gb|EYU29223.1| hypothetical protein MIMGU_mgv1a0001672mg, partial [Erythranthe 
guttata]
Length=818

 Score = 59.3 bits (142),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
 Frame = -1

Query  527  MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
            +ESI GA+++DS L  + V++ ++P+L P+VTP+ L L P +EL ELC    Y +KE   
Sbjct  553  VESITGAVFIDSKLDLEQVWKVMKPILSPIVTPDKLELQPSRELIELCDYLGYFIKENFN  612

Query  347  VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
               D      +++     + +   S   RK A+ +A  R+
Sbjct  613  AKGD-LVQVELKLQLEDALLNGQGSGPTRKAARGMAALRI  651


 Score = 45.8 bits (107),  Expect(2) = 5e-14, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  715  LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  587
            LT+LRS SVNN  +AL++V+  LH ++LH S  L + I+ FVK
Sbjct  504  LTDLRSASVNNDSFALAAVRWNLHPHLLHGSLHLDNQISAFVK  546



>gb|AJA90765.1| Dicer-like 3 [Ephedra trifurca]
Length=1678

 Score = 60.8 bits (146),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 38/113 (34%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -1

Query  548   GAQDKFP------MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTEL  387
             GAQ + P      +ESIAGAI +D+G   + V+  ++P+L P+VT  S  L+P++E+ E+
Sbjct  1381  GAQVEAPKVLGDILESIAGAILVDNGFNLEQVWNVMKPLLSPIVTCSSRYLHPIREVNEI  1440

Query  386   CQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
             C    +  K   V+  D  A T +EV     V    S+  + K AK+ A  ++
Sbjct  1441  CDSNGFVSKWSKVLKGDRAAITRMEVTLKDCVIVGESTKVSVKNAKKEAASKI  1493


 Score = 43.9 bits (102),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI---ADFVKNIEQSSASSTFG  551
             LT+LR+ +VNN  +A ++VK GL  +  HSS  L + I   AD+   I Q+     FG
Sbjct  1324  LTDLRAAAVNNQTFAFAAVKHGLQKHFRHSSGLLFTQITDFADYASKINQTEYCDAFG  1381



>gb|AJA90780.1| Dicer-like 3 [Pinus canariensis]
Length=1803

 Score = 62.4 bits (150),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +DS      V+E +RP+L P+VTPE+L L+P++E++ELC  + Y    P+V
Sbjct  1447  VESIAGAILIDSKFDIKQVWEIMRPLLSPIVTPETLDLHPLREVSELCHLKGY----PIV  1502

Query  347   VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACER  231
               K  +    +       V   +   +  KT+K+ A E+
Sbjct  1503  WKKSIQEGKLVIATMEVAVEDNTLIGKGCKTSKKSAKEK  1541


 Score = 41.6 bits (96),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASS  560
             LT+LRS +VNN  +A  +V+  LH Y+ H S  L   I  FVK +++  + +
Sbjct  1377  LTDLRSAAVNNKKFAHVAVQHNLHQYLRHGSGILLGQITRFVKAVQEQESKN  1428



>ref|XP_009588920.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X1 [Nicotiana 
tomentosiformis]
Length=1657

 Score = 62.8 bits (151),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +D+ L  D V++ ++P+L P+VTP+ L L P++EL ELC    Y +K+  +
Sbjct  1378  VESIAGAILIDTKLNLDEVWKIVKPLLSPIVTPDKLELPPLRELIELCDSLGYFLKDHCM  1437

Query  347   VHKD  336
             V  D
Sbjct  1438  VKGD  1441


 Score = 41.6 bits (96),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS  572
             LT+LR+ SVNN  +A ++VK  LH ++ H S  L S I+ FVK++  S
Sbjct  1315  LTDLRAASVNNDNFAYAAVKRELHVHLQHHSGYLESEISAFVKSVSDS  1362



>ref|XP_009588925.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X2 [Nicotiana 
tomentosiformis]
Length=1651

 Score = 62.4 bits (150),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVV  348
             +ESIAGAI +D+ L  D V++ ++P+L P+VTP+ L L P++EL ELC    Y +K+  +
Sbjct  1372  VESIAGAILIDTKLNLDEVWKIVKPLLSPIVTPDKLELPPLRELIELCDSLGYFLKDHCM  1431

Query  347   VHKD  336
             V  D
Sbjct  1432  VKGD  1435


 Score = 41.6 bits (96),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS  572
             LT+LR+ SVNN  +A ++VK  LH ++ H S  L S I+ FVK++  S
Sbjct  1309  LTDLRAASVNNDNFAYAAVKRELHVHLQHHSGYLESEISAFVKSVSDS  1356



>ref|XP_004970995.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
3a-like [Setaria italica]
Length=1662

 Score = 57.4 bits (137),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKY  369
             +ESIAGA+ +D+ L  D+V+   +P+L P+VTPE+L L P +EL E C K  Y
Sbjct  1396  VESIAGAVLIDTKLDLDLVWGVFKPLLSPIVTPENLELPPFRELHEWCDKSGY  1448


 Score = 46.6 bits (109),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST  557
             LT+LRS SVNN  +A  +VK  LH+++ HSS  L+  I ++V  +E SS   T
Sbjct  1326  LTDLRSASVNNENFAQVAVKYNLHHFLQHSSGLLQDQINEYVNGLEGSSMDRT  1378



>ref|XP_006474519.1| PREDICTED: endoribonuclease Dicer homolog 3-like isoform X1 [Citrus 
sinensis]
Length=1653

 Score = 58.2 bits (139),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  527   MESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKE  357
             +ESI GA+ +D+ L  D V+   +P+L P+VTP+ L L P++EL ELC    Y +KE
Sbjct  1385  LESIVGAVLIDTKLNLDEVWRIFKPILSPIVTPDKLELPPLRELIELCDSLGYFVKE  1441


 Score = 45.8 bits (107),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  715   LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK  539
             LT+LRS SVNN  +A ++VK  L+ ++ H ST L S I ++VK+  +   ++  G  +K
Sbjct  1318  LTDLRSASVNNENFAQATVKKNLYKHLQHCSTLLLSQITEYVKSFPKPGETTDSGPSMK  1376



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410