BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048P17

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01724.1|  unnamed protein product                                265   1e-82   Coffea canephora [robusta coffee]
ref|XP_004234495.1|  PREDICTED: probable metal-nicotianamine tran...    263   1e-79   Solanum lycopersicum
ref|XP_009615008.1|  PREDICTED: probable metal-nicotianamine tran...    259   3e-79   Nicotiana tomentosiformis
ref|XP_009794096.1|  PREDICTED: probable metal-nicotianamine tran...    258   6e-79   Nicotiana sylvestris
ref|XP_009615007.1|  PREDICTED: probable metal-nicotianamine tran...    261   2e-78   Nicotiana tomentosiformis
ref|XP_009794095.1|  PREDICTED: probable metal-nicotianamine tran...    260   3e-78   Nicotiana sylvestris
gb|EYU25660.1|  hypothetical protein MIMGU_mgv1a003894mg                256   5e-78   Erythranthe guttata [common monkey flower]
gb|KDP22031.1|  hypothetical protein JCGZ_03001                         256   7e-78   Jatropha curcas
ref|XP_006343309.1|  PREDICTED: probable metal-nicotianamine tran...    257   3e-77   Solanum tuberosum [potatoes]
gb|EYU25678.1|  hypothetical protein MIMGU_mgv1a002252mg                257   4e-77   Erythranthe guttata [common monkey flower]
ref|NP_001232821.1|  uncharacterized protein LOC100272237               241   5e-77   
ref|XP_011097988.1|  PREDICTED: probable metal-nicotianamine tran...    256   6e-77   Sesamum indicum [beniseed]
ref|XP_009593058.1|  PREDICTED: probable metal-nicotianamine tran...    257   7e-77   Nicotiana tomentosiformis
ref|XP_006363210.1|  PREDICTED: probable metal-nicotianamine tran...    256   1e-76   Solanum tuberosum [potatoes]
ref|XP_011035386.1|  PREDICTED: probable metal-nicotianamine tran...    255   2e-76   Populus euphratica
ref|XP_009798435.1|  PREDICTED: probable metal-nicotianamine tran...    254   7e-76   Nicotiana sylvestris
ref|XP_010528609.1|  PREDICTED: probable metal-nicotianamine tran...    252   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_004233770.1|  PREDICTED: probable metal-nicotianamine tran...    252   3e-75   Solanum lycopersicum
ref|XP_006652534.1|  PREDICTED: probable metal-nicotianamine tran...    248   4e-75   Oryza brachyantha
ref|XP_006372355.1|  hypothetical protein POPTR_0017s00810g             248   5e-75   
ref|XP_006372357.1|  hypothetical protein POPTR_0017s00830g             240   6e-75   
ref|XP_011046070.1|  PREDICTED: probable metal-nicotianamine tran...    251   6e-75   Populus euphratica
gb|KDP27275.1|  hypothetical protein JCGZ_21006                         251   8e-75   Jatropha curcas
ref|XP_003575422.1|  PREDICTED: probable metal-nicotianamine tran...    251   9e-75   Brachypodium distachyon [annual false brome]
gb|EMS52213.1|  putative metal-nicotianamine transporter YSL13          249   1e-74   Triticum urartu
gb|KCW48661.1|  hypothetical protein EUGRSUZ_K02316                     247   1e-74   Eucalyptus grandis [rose gum]
gb|KDP45817.1|  hypothetical protein JCGZ_17424                         250   2e-74   Jatropha curcas
ref|XP_007029356.1|  YELLOW STRIPE like 5                               250   2e-74   
ref|XP_006384094.1|  hypothetical protein POPTR_0004s06780g             247   2e-74   
ref|XP_002446809.1|  hypothetical protein SORBIDRAFT_06g023010          250   2e-74   Sorghum bicolor [broomcorn]
ref|XP_006372353.1|  hypothetical protein POPTR_0017s00810g             249   2e-74   
emb|CBI27128.3|  unnamed protein product                                246   3e-74   Vitis vinifera
ref|XP_004976283.1|  PREDICTED: probable metal-nicotianamine tran...    250   3e-74   Setaria italica
ref|XP_008801346.1|  PREDICTED: probable metal-nicotianamine tran...    245   4e-74   Phoenix dactylifera
ref|XP_006372354.1|  hypothetical protein POPTR_0017s00810g             249   4e-74   
ref|XP_011046069.1|  PREDICTED: probable metal-nicotianamine tran...    247   6e-74   Populus euphratica
gb|EMT24510.1|  Putative metal-nicotianamine transporter YSL13          249   6e-74   
ref|XP_002520094.1|  oligopeptide transporter, putative                 248   7e-74   Ricinus communis
ref|XP_010037025.1|  PREDICTED: probable metal-nicotianamine tran...    248   9e-74   Eucalyptus grandis [rose gum]
ref|XP_010415119.1|  PREDICTED: probable metal-nicotianamine tran...    245   9e-74   
gb|EPS73705.1|  hypothetical protein M569_01043                         248   1e-73   Genlisea aurea
gb|KGN64213.1|  hypothetical protein Csa_1G043160                       248   1e-73   Cucumis sativus [cucumbers]
ref|XP_004137637.1|  PREDICTED: probable metal-nicotianamine tran...    248   2e-73   
ref|XP_004978143.1|  PREDICTED: probable metal-nicotianamine tran...    248   2e-73   Setaria italica
gb|EMS54492.1|  putative metal-nicotianamine transporter YSL14          245   2e-73   Triticum urartu
ref|XP_004165464.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    247   3e-73   
ref|XP_006372622.1|  iron transporter-related family protein            247   3e-73   Populus trichocarpa [western balsam poplar]
gb|EMT06635.1|  Putative metal-nicotianamine transporter YSL14          247   3e-73   
ref|XP_002525883.1|  oligopeptide transporter, putative                 247   4e-73   Ricinus communis
emb|CBI27129.3|  unnamed protein product                                242   4e-73   Vitis vinifera
gb|KFK41018.1|  hypothetical protein AALP_AA2G074700                    246   5e-73   Arabis alpina [alpine rockcress]
ref|XP_008436975.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    246   5e-73   
ref|XP_010112419.1|  putative metal-nicotianamine transporter YSL7      246   5e-73   Morus notabilis
dbj|BAE44205.1|  hypothetical protein                                   247   5e-73   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72423.1|  hypothetical protein VITISV_014262                     246   5e-73   Vitis vinifera
ref|XP_006372621.1|  hypothetical protein POPTR_0017s03320g             246   5e-73   
ref|XP_010943908.1|  PREDICTED: probable metal-nicotianamine tran...    247   5e-73   Elaeis guineensis
ref|XP_002279707.1|  PREDICTED: probable metal-nicotianamine tran...    246   6e-73   Vitis vinifera
gb|EEE57430.1|  hypothetical protein OsJ_07631                          246   6e-73   Oryza sativa Japonica Group [Japonica rice]
sp|Q6H7J6.1|YSL14_ORYSJ  RecName: Full=Probable metal-nicotianami...    246   7e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010551578.1|  PREDICTED: probable metal-nicotianamine tran...    246   7e-73   Tarenaya hassleriana [spider flower]
gb|EAY86805.1|  hypothetical protein OsI_08181                          247   8e-73   Oryza sativa Indica Group [Indian rice]
ref|NP_001185468.1|  yellow stripe-like transporter 12                  246   9e-73   Zea mays [maize]
ref|XP_010551587.1|  PREDICTED: probable metal-nicotianamine tran...    245   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_010511122.1|  PREDICTED: probable metal-nicotianamine tran...    245   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008801345.1|  PREDICTED: probable metal-nicotianamine tran...    246   1e-72   Phoenix dactylifera
ref|XP_010037026.1|  PREDICTED: probable metal-nicotianamine tran...    245   1e-72   Eucalyptus grandis [rose gum]
ref|XP_002452492.1|  hypothetical protein SORBIDRAFT_04g026840          246   1e-72   
ref|XP_008676713.1|  PREDICTED: uncharacterized protein LOC100272...    245   1e-72   
emb|CAN70906.1|  hypothetical protein VITISV_043868                     245   1e-72   Vitis vinifera
ref|XP_002277292.1|  PREDICTED: probable metal-nicotianamine tran...    245   2e-72   Vitis vinifera
emb|CDO98563.1|  unnamed protein product                                243   2e-72   Coffea canephora [robusta coffee]
ref|XP_002449540.1|  hypothetical protein SORBIDRAFT_05g018520          245   2e-72   Sorghum bicolor [broomcorn]
ref|XP_006391519.1|  hypothetical protein EUTSA_v10018216mg             244   2e-72   Eutrema salsugineum [saltwater cress]
ref|XP_004500424.1|  PREDICTED: probable metal-nicotianamine tran...    244   3e-72   
ref|XP_006372618.1|  hypothetical protein POPTR_0017s03290g             240   3e-72   
ref|XP_008669136.1|  PREDICTED: probable metal-nicotianamine tran...    244   4e-72   Zea mays [maize]
ref|XP_009105166.1|  PREDICTED: probable metal-nicotianamine tran...    244   4e-72   Brassica rapa
ref|XP_006441428.1|  hypothetical protein CICLE_v10019091mg             239   4e-72   
ref|XP_006372356.1|  hypothetical protein POPTR_0017s00820g             242   4e-72   
ref|NP_001053351.1|  Os04g0524600                                       241   5e-72   
gb|EEC77667.1|  hypothetical protein OsI_16700                          241   5e-72   Oryza sativa Indica Group [Indian rice]
gb|ACD77012.1|  metal transporter protein                               243   5e-72   Brassica juncea [brown mustard]
ref|XP_006648859.1|  PREDICTED: probable metal-nicotianamine tran...    243   5e-72   Oryza brachyantha
ref|XP_006300806.1|  hypothetical protein CARUB_v10019889mg             243   6e-72   Capsella rubella
ref|XP_011046075.1|  PREDICTED: probable metal-nicotianamine tran...    243   6e-72   Populus euphratica
gb|ABB76761.1|  YSL transporter 1                                       243   6e-72   Noccaea caerulescens
ref|XP_004953195.1|  PREDICTED: probable metal-nicotianamine tran...    244   7e-72   Setaria italica
ref|XP_003581442.1|  PREDICTED: probable metal-nicotianamine tran...    244   7e-72   Brachypodium distachyon [annual false brome]
emb|CAI44637.1|  OSJNBb0065J09.17                                       242   9e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011046074.1|  PREDICTED: probable metal-nicotianamine tran...    243   9e-72   Populus euphratica
ref|XP_010470452.1|  PREDICTED: probable metal-nicotianamine tran...    243   1e-71   Camelina sativa [gold-of-pleasure]
ref|NP_001152285.1|  yellow stripe-like transporter 14A                 243   1e-71   
ref|XP_010069525.1|  PREDICTED: probable metal-nicotianamine tran...    243   1e-71   Eucalyptus grandis [rose gum]
dbj|BAJ89062.1|  predicted protein                                      243   1e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011046072.1|  PREDICTED: probable metal-nicotianamine tran...    243   1e-71   Populus euphratica
dbj|BAJ92335.1|  predicted protein                                      243   1e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011046073.1|  PREDICTED: probable metal-nicotianamine tran...    243   1e-71   Populus euphratica
gb|KDO46151.1|  hypothetical protein CISIN_1g005295mg                   239   1e-71   Citrus sinensis [apfelsine]
ref|XP_010039025.1|  PREDICTED: probable metal-nicotianamine tran...    242   2e-71   Eucalyptus grandis [rose gum]
ref|XP_009413131.1|  PREDICTED: probable metal-nicotianamine tran...    241   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008645969.1|  PREDICTED: probable metal-nicotianamine tran...    242   3e-71   Zea mays [maize]
sp|Q5JQD7.2|YSL12_ORYSJ  RecName: Full=Probable metal-nicotianami...    242   3e-71   Oryza sativa Japonica Group [Japonica rice]
gb|KJB75155.1|  hypothetical protein B456_012G027400                    241   3e-71   Gossypium raimondii
ref|XP_002886962.1|  hypothetical protein ARALYDRAFT_475677             241   4e-71   
dbj|BAE91892.1|  hypothetical protein                                   241   5e-71   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053350.1|  Os04g0524500                                       239   5e-71   
ref|XP_010940334.1|  PREDICTED: probable metal-nicotianamine tran...    241   5e-71   Elaeis guineensis
gb|KCW48665.1|  hypothetical protein EUGRSUZ_K02320                     235   6e-71   Eucalyptus grandis [rose gum]
ref|XP_003580167.1|  PREDICTED: probable metal-nicotianamine tran...    241   7e-71   Brachypodium distachyon [annual false brome]
ref|XP_006441429.1|  hypothetical protein CICLE_v10019091mg             241   7e-71   Citrus clementina [clementine]
ref|XP_006493428.1|  PREDICTED: probable metal-nicotianamine tran...    241   8e-71   Citrus sinensis [apfelsine]
gb|KDO46150.1|  hypothetical protein CISIN_1g005295mg                   240   8e-71   Citrus sinensis [apfelsine]
ref|XP_011072072.1|  PREDICTED: probable metal-nicotianamine tran...    240   8e-71   Sesamum indicum [beniseed]
ref|XP_010037024.1|  PREDICTED: probable metal-nicotianamine tran...    241   9e-71   Eucalyptus grandis [rose gum]
ref|XP_004158540.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    240   9e-71   
ref|XP_004138807.1|  PREDICTED: probable metal-nicotianamine tran...    240   9e-71   Cucumis sativus [cucumbers]
emb|CDY39272.1|  BnaC06g27190D                                          240   1e-70   Brassica napus [oilseed rape]
gb|AFK38640.1|  unknown                                                 225   1e-70   Medicago truncatula
sp|Q7XKF4.2|YSL13_ORYSJ  RecName: Full=Probable metal-nicotianami...    240   1e-70   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67885.1|  OSIGBa0153E02-OSIGBa0093I20.14                         240   1e-70   Oryza sativa [red rice]
gb|AET00398.2|  OPT family oligopeptide transporter                     239   1e-70   Medicago truncatula
gb|EAZ31384.1|  hypothetical protein OsJ_15512                          240   1e-70   Oryza sativa Japonica Group [Japonica rice]
emb|CBI35268.3|  unnamed protein product                                236   2e-70   Vitis vinifera
ref|XP_006653608.1|  PREDICTED: probable metal-nicotianamine tran...    239   2e-70   
gb|KEH34582.1|  OPT family oligopeptide transporter                     239   2e-70   Medicago truncatula
ref|XP_002269277.1|  PREDICTED: probable metal-nicotianamine tran...    239   3e-70   Vitis vinifera
gb|EMT24509.1|  Putative metal-nicotianamine transporter YSL12          239   3e-70   
gb|ADE77032.1|  unknown                                                 225   5e-70   Picea sitchensis
gb|EMT14396.1|  Putative metal-nicotianamine transporter YSL13          238   6e-70   
ref|XP_009420946.1|  PREDICTED: probable metal-nicotianamine tran...    238   7e-70   
gb|KDP41617.1|  hypothetical protein JCGZ_16024                         238   7e-70   Jatropha curcas
ref|NP_176750.1|  putative metal-nicotianamine transporter YSL7         237   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KHM99726.1|  Putative metal-nicotianamine transporter YSL7           236   1e-69   Glycine soja [wild soybean]
ref|XP_009383038.1|  PREDICTED: probable metal-nicotianamine tran...    236   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003533289.1|  PREDICTED: probable metal-nicotianamine tran...    236   2e-69   Glycine max [soybeans]
ref|NP_001276131.1|  uncharacterized protein LOC100809484               236   3e-69   Glycine max [soybeans]
ref|XP_003617439.1|  Yellow stripe-like protein 2.8                     236   4e-69   
emb|CBI35280.3|  unnamed protein product                                232   5e-69   Vitis vinifera
ref|XP_002266657.1|  PREDICTED: probable metal-nicotianamine tran...    236   5e-69   Vitis vinifera
ref|XP_010112079.1|  putative metal-nicotianamine transporter YSL8      226   5e-69   
ref|XP_003548294.1|  PREDICTED: probable metal-nicotianamine tran...    235   7e-69   Glycine max [soybeans]
ref|XP_007146944.1|  hypothetical protein PHAVU_006G083800g             234   1e-68   Phaseolus vulgaris [French bean]
gb|KEH26876.1|  OPT family oligopeptide transporter                     231   1e-68   Medicago truncatula
emb|CBI35270.3|  unnamed protein product                                229   4e-68   Vitis vinifera
gb|KEH34580.1|  OPT family oligopeptide transporter                     233   4e-68   Medicago truncatula
ref|XP_010933277.1|  PREDICTED: probable metal-nicotianamine tran...    233   5e-68   
ref|XP_011035385.1|  PREDICTED: probable metal-nicotianamine tran...    233   5e-68   Populus euphratica
ref|XP_003620154.1|  Yellow stripe-like protein 2.1                     233   9e-68   Medicago truncatula
ref|XP_006372358.1|  hypothetical protein POPTR_0017s00840g             220   1e-67   
ref|XP_004515282.1|  PREDICTED: probable metal-nicotianamine tran...    232   2e-67   Cicer arietinum [garbanzo]
ref|XP_007152542.1|  hypothetical protein PHAVU_004G138900g             231   2e-67   Phaseolus vulgaris [French bean]
ref|XP_008779403.1|  PREDICTED: probable metal-nicotianamine tran...    231   2e-67   
ref|XP_002269403.1|  PREDICTED: probable metal-nicotianamine tran...    230   5e-67   Vitis vinifera
ref|XP_002305689.1|  hypothetical protein POPTR_0004s06790g             230   5e-67   
ref|XP_010086691.1|  putative metal-nicotianamine transporter YSL8      224   6e-67   
ref|XP_008240337.1|  PREDICTED: probable metal-nicotianamine tran...    230   7e-67   Prunus mume [ume]
ref|XP_007210334.1|  hypothetical protein PRUPE_ppa002002mg             230   8e-67   Prunus persica
gb|KCW83950.1|  hypothetical protein EUGRSUZ_B00835                     228   8e-67   Eucalyptus grandis [rose gum]
ref|XP_004299460.1|  PREDICTED: probable metal-nicotianamine tran...    229   1e-66   Fragaria vesca subsp. vesca
ref|XP_011072202.1|  PREDICTED: probable metal-nicotianamine tran...    229   1e-66   Sesamum indicum [beniseed]
ref|XP_010032362.1|  PREDICTED: probable metal-nicotianamine tran...    229   2e-66   
ref|XP_009384580.1|  PREDICTED: probable metal-nicotianamine tran...    229   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010248248.1|  PREDICTED: probable metal-nicotianamine tran...    213   2e-66   Nelumbo nucifera [Indian lotus]
gb|AFW58895.1|  hypothetical protein ZEAMMB73_322526                    214   3e-66   
ref|XP_007211297.1|  hypothetical protein PRUPE_ppa001999mg             228   4e-66   Prunus persica
ref|XP_002510093.1|  oligopeptide transporter, putative                 227   8e-66   Ricinus communis
ref|XP_004158539.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    226   8e-66   
gb|KEH28405.1|  metal-nicotianamine transporter YSL3-like protein       216   1e-65   Medicago truncatula
ref|XP_004138639.1|  PREDICTED: probable metal-nicotianamine tran...    226   2e-65   Cucumis sativus [cucumbers]
gb|KGN63126.1|  hypothetical protein Csa_2G404780                       226   2e-65   Cucumis sativus [cucumbers]
gb|KFK36098.1|  hypothetical protein AALP_AA4G077100                    226   2e-65   Arabis alpina [alpine rockcress]
ref|XP_006847869.1|  hypothetical protein AMTR_s00029p00088690          218   3e-65   
gb|KCW57904.1|  hypothetical protein EUGRSUZ_H00651                     224   5e-65   Eucalyptus grandis [rose gum]
ref|XP_003617442.1|  Oligopeptide transporter OPT family                215   5e-65   
ref|XP_010025985.1|  PREDICTED: probable metal-nicotianamine tran...    225   1e-64   
ref|XP_006847871.1|  hypothetical protein AMTR_s00029p00090440          216   2e-64   
ref|XP_010666835.1|  PREDICTED: probable metal-nicotianamine tran...    221   7e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010465819.1|  PREDICTED: probable metal-nicotianamine tran...    216   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010505677.1|  PREDICTED: probable metal-nicotianamine tran...    216   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010461657.1|  PREDICTED: probable metal-nicotianamine tran...    221   2e-63   Camelina sativa [gold-of-pleasure]
gb|AEQ28190.1|  yellow stripe-like protein 5                            221   2e-63   Malus baccata var. xiaojinensis
ref|XP_010479258.1|  PREDICTED: probable metal-nicotianamine tran...    220   4e-63   Camelina sativa [gold-of-pleasure]
dbj|BAJ34371.1|  unnamed protein product                                214   4e-63   Eutrema halophilum
emb|CDY64854.1|  BnaCnng45400D                                          213   4e-63   Brassica napus [oilseed rape]
ref|XP_006393421.1|  hypothetical protein EUTSA_v10011269mg             220   4e-63   Eutrema salsugineum [saltwater cress]
ref|XP_006306886.1|  hypothetical protein CARUB_v10008440mg             219   7e-63   Capsella rubella
ref|XP_010675190.1|  PREDICTED: probable metal-nicotianamine tran...    219   8e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009113870.1|  PREDICTED: probable metal-nicotianamine tran...    213   9e-63   Brassica rapa
ref|XP_010549025.1|  PREDICTED: probable metal-nicotianamine tran...    209   1e-62   Tarenaya hassleriana [spider flower]
emb|CDY66980.1|  BnaCnng53010D                                          216   1e-62   Brassica napus [oilseed rape]
gb|KHG02257.1|  putative metal-nicotianamine transporter YSL5 -li...    218   1e-62   Gossypium arboreum [tree cotton]
ref|XP_009135544.1|  PREDICTED: probable metal-nicotianamine tran...    212   3e-62   Brassica rapa
ref|XP_008393519.1|  PREDICTED: probable metal-nicotianamine tran...    218   3e-62   
ref|XP_002891428.1|  hypothetical protein ARALYDRAFT_473974             218   3e-62   Arabidopsis lyrata subsp. lyrata
gb|KCW83949.1|  hypothetical protein EUGRSUZ_B00833                     207   3e-62   Eucalyptus grandis [rose gum]
gb|EMT18807.1|  Putative metal-nicotianamine transporter YSL12          216   4e-62   
gb|AAS00697.1|  metal-nicotianamine transporter YSL8                    217   5e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31630.1|  BnaA06g20330D                                          207   5e-62   Brassica napus [oilseed rape]
ref|NP_564525.1|  metal-nicotianamine transporter YSL8                  217   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487657.1|  PREDICTED: probable metal-nicotianamine tran...    217   6e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010465820.1|  PREDICTED: probable metal-nicotianamine tran...    217   6e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010505667.1|  PREDICTED: probable metal-nicotianamine tran...    216   8e-62   Camelina sativa [gold-of-pleasure]
gb|AAD49762.2|AC007932_10  F11A17.8                                     217   9e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KJB26835.1|  hypothetical protein B456_004G262100                    216   9e-62   Gossypium raimondii
ref|NP_001185810.1|  yellow stripe-like transporter 11                  216   9e-62   Zea mays [maize]
ref|XP_009107360.1|  PREDICTED: probable metal-nicotianamine tran...    216   9e-62   Brassica rapa
gb|EMS64344.1|  putative metal-nicotianamine transporter YSL12          214   9e-62   Triticum urartu
ref|XP_004978146.1|  PREDICTED: probable metal-nicotianamine tran...    216   9e-62   
ref|XP_010240603.1|  PREDICTED: probable metal-nicotianamine tran...    212   2e-61   
ref|XP_006406708.1|  hypothetical protein EUTSA_v10020160mg             215   3e-61   Eutrema salsugineum [saltwater cress]
gb|EMS55053.1|  putative metal-nicotianamine transporter YSL10          214   3e-61   Triticum urartu
ref|XP_006297072.1|  hypothetical protein CARUB_v10013074mg             214   4e-61   Capsella rubella
sp|Q0J932.2|YSL10_ORYSJ  RecName: Full=Probable metal-nicotianami...    214   5e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653020.1|  PREDICTED: probable metal-nicotianamine tran...    214   5e-61   Oryza brachyantha
emb|CAE03239.2|  OSJNBa0018M05.14                                       214   5e-61   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054241.1|  Os04g0674600                                       214   5e-61   
emb|CAJ86097.1|  H0103C06.1                                             214   5e-61   Oryza sativa [red rice]
emb|CBG76262.1|  OO_Ba0005L10-OO_Ba0081K17.13                           214   7e-61   Oryza officinalis
emb|CDY46890.1|  BnaA01g27900D                                          214   7e-61   Brassica napus [oilseed rape]
ref|XP_009113863.1|  PREDICTED: probable metal-nicotianamine tran...    214   7e-61   Brassica rapa
gb|EMT25295.1|  Putative metal-nicotianamine transporter YSL10          215   8e-61   
gb|EEC78242.1|  hypothetical protein OsI_17899                          213   8e-61   Oryza sativa Indica Group [Indian rice]
emb|CDX82356.1|  BnaA03g34650D                                          212   1e-60   
gb|KFK39092.1|  hypothetical protein AALP_AA3G199800                    213   1e-60   Arabis alpina [alpine rockcress]
ref|XP_002883075.1|  hypothetical protein ARALYDRAFT_479246             213   1e-60   
emb|CDY46051.1|  BnaC01g34980D                                          214   2e-60   Brassica napus [oilseed rape]
ref|XP_009135543.1|  PREDICTED: probable metal-nicotianamine tran...    213   2e-60   Brassica rapa
gb|AAL09744.1|  AT3g17650/MKP6_20                                       213   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566584.1|  putative metal-nicotianamine transporter YSL5         212   3e-60   Arabidopsis thaliana [mouse-ear cress]
gb|ABB76762.1|  YSL transporter 2                                       211   1e-59   Noccaea caerulescens
ref|XP_002446810.1|  hypothetical protein SORBIDRAFT_06g023020          209   4e-59   Sorghum bicolor [broomcorn]
ref|XP_010549024.1|  PREDICTED: probable metal-nicotianamine tran...    208   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_003581443.2|  PREDICTED: probable metal-nicotianamine tran...    206   2e-58   
ref|XP_002446812.1|  hypothetical protein SORBIDRAFT_06g023040          207   3e-58   
ref|XP_004976284.1|  PREDICTED: probable metal-nicotianamine tran...    206   4e-58   Setaria italica
ref|XP_008669135.1|  PREDICTED: probable metal-nicotianamine tran...    206   4e-58   Zea mays [maize]
ref|XP_008663393.1|  PREDICTED: probable metal-nicotianamine tran...    205   5e-58   
ref|XP_004978145.1|  PREDICTED: probable metal-nicotianamine tran...    206   8e-58   
gb|AFW58894.1|  hypothetical protein ZEAMMB73_605066                    206   9e-58   
gb|EMT17260.1|  Putative metal-nicotianamine transporter YSL11          204   1e-57   
ref|XP_008805741.1|  PREDICTED: probable metal-nicotianamine tran...    204   3e-57   Phoenix dactylifera
ref|XP_008780540.1|  PREDICTED: probable metal-nicotianamine tran...    196   3e-57   
ref|XP_006653609.1|  PREDICTED: probable metal-nicotianamine tran...    202   5e-57   
emb|CDY68937.1|  BnaCnng61140D                                          202   2e-56   Brassica napus [oilseed rape]
ref|XP_002448760.1|  hypothetical protein SORBIDRAFT_06g032720          200   6e-56   Sorghum bicolor [broomcorn]
gb|AFW59877.1|  hypothetical protein ZEAMMB73_955581                    199   1e-55   
ref|XP_008663726.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    199   1e-55   
dbj|BAE91891.1|  hypothetical protein                                   199   1e-55   Oryza sativa Japonica Group [Japonica rice]
sp|Q7X660.1|YSL11_ORYSJ  RecName: Full=Probable metal-nicotianami...    199   1e-55   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67887.1|  OSIGBa0153E02-OSIGBa0093I20.16                         199   1e-55   Oryza sativa [red rice]
gb|AFU82910.1|  yellow stripe-like transporter 6                        187   3e-55   Arachis hypogaea [goober]
gb|AFG69714.1|  hypothetical protein 2_2304_01                          185   4e-55   Pinus taeda
ref|XP_004960104.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    196   5e-55   
ref|XP_008466879.1|  PREDICTED: probable metal-nicotianamine tran...    181   2e-54   
ref|XP_002532101.1|  oligopeptide transporter, putative                 195   3e-54   Ricinus communis
ref|XP_002981992.1|  hypothetical protein SELMODRAFT_179245             195   5e-54   
ref|XP_004148573.1|  PREDICTED: probable metal-nicotianamine tran...    194   9e-54   Cucumis sativus [cucumbers]
ref|XP_004163304.1|  PREDICTED: probable metal-nicotianamine tran...    194   1e-53   
tpg|DAA38140.1|  TPA: hypothetical protein ZEAMMB73_580403              186   2e-53   
ref|XP_002986072.1|  hypothetical protein SELMODRAFT_123451             193   2e-53   
ref|XP_002512906.1|  hypothetical protein RCOM_1447130                  181   2e-53   
ref|XP_008461864.1|  PREDICTED: probable metal-nicotianamine tran...    192   4e-53   Cucumis melo [Oriental melon]
ref|NP_001052640.2|  Os04g0390500                                       183   4e-53   
ref|NP_199358.1|  oligopeptide transporter OPT superfamily protein      181   6e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215002.1|  hypothetical protein PRUPE_ppa002401mg             191   8e-53   Prunus persica
gb|KDO59687.1|  hypothetical protein CISIN_1g0442261mg                  186   9e-53   Citrus sinensis [apfelsine]
gb|KDO53476.1|  hypothetical protein CISIN_1g047730mg                   191   1e-52   Citrus sinensis [apfelsine]
ref|XP_006471126.1|  PREDICTED: metal-nicotianamine transporter Y...    191   1e-52   Citrus sinensis [apfelsine]
ref|XP_003556609.1|  PREDICTED: probable metal-nicotianamine tran...    191   1e-52   Glycine max [soybeans]
ref|XP_007031922.1|  YELLOW STRIPE like 6                               190   2e-52   
ref|XP_002877011.1|  hypothetical protein ARALYDRAFT_904909             190   2e-52   Arabidopsis lyrata subsp. lyrata
emb|CDX76329.1|  BnaA08g10710D                                          190   2e-52   
ref|XP_009137708.1|  PREDICTED: metal-nicotianamine transporter Y...    190   2e-52   Brassica rapa
emb|CDY03488.1|  BnaC01g15940D                                          190   2e-52   
ref|XP_009137713.1|  PREDICTED: metal-nicotianamine transporter Y...    190   2e-52   Brassica rapa
ref|XP_006395492.1|  hypothetical protein EUTSA_v10003758mg             190   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_009402082.1|  PREDICTED: probable metal-nicotianamine tran...    190   3e-52   
ref|XP_006431856.1|  hypothetical protein CICLE_v10003961mg             189   4e-52   
gb|ACE77055.2|  yellow stripe-like protein 6.1                          189   6e-52   
emb|CAB51655.1|  putative protein                                       188   6e-52   
ref|XP_006283265.1|  hypothetical protein CARUB_v10004301mg             189   6e-52   
ref|XP_010514385.1|  PREDICTED: probable metal-nicotianamine tran...    189   7e-52   
ref|XP_006413472.1|  hypothetical protein EUTSA_v10024600mg             188   8e-52   
ref|NP_001052641.1|  Os04g0390600                                       184   8e-52   
ref|XP_010448607.1|  PREDICTED: metal-nicotianamine transporter Y...    188   8e-52   
ref|XP_007153095.1|  hypothetical protein PHAVU_003G006500g             187   9e-52   
ref|XP_010502660.1|  PREDICTED: probable metal-nicotianamine tran...    188   9e-52   
ref|XP_010439083.1|  PREDICTED: metal-nicotianamine transporter YSL1    188   9e-52   
ref|XP_010433812.1|  PREDICTED: metal-nicotianamine transporter Y...    188   9e-52   
ref|XP_010425438.1|  PREDICTED: probable metal-nicotianamine tran...    188   1e-51   
ref|XP_009405479.1|  PREDICTED: probable metal-nicotianamine tran...    188   1e-51   
ref|XP_006290684.1|  hypothetical protein CARUB_v10016778mg             188   1e-51   
ref|XP_009111552.1|  PREDICTED: probable metal-nicotianamine tran...    188   1e-51   
gb|ACL83357.2|  yellow stripe-like protein 6.4                          188   1e-51   
gb|AAB63613.1|  unknown protein                                         188   1e-51   
emb|CDY00170.1|  BnaC09g01310D                                          188   1e-51   
ref|XP_011000961.1|  PREDICTED: probable metal-nicotianamine tran...    187   1e-51   
ref|XP_001751943.1|  predicted protein                                  187   1e-51   
ref|XP_002869737.1|  hypothetical protein ARALYDRAFT_492451             187   1e-51   
ref|NP_567694.2|  metal-nicotianamine transporter YSL1                  187   2e-51   
ref|XP_010541874.1|  PREDICTED: metal-nicotianamine transporter YSL1    187   2e-51   
gb|KJB70679.1|  hypothetical protein B456_011G086700                    187   2e-51   
ref|XP_002298639.1|  oligopeptide transporter OPT family protein        187   2e-51   
gb|KFK28976.1|  hypothetical protein AALP_AA7G072600                    187   2e-51   
gb|ACU22673.1|  unknown                                                 181   2e-51   
ref|XP_007153094.1|  hypothetical protein PHAVU_003G006500g             187   2e-51   
ref|XP_008450132.1|  PREDICTED: probable metal-nicotianamine tran...    187   2e-51   
ref|XP_004148009.1|  PREDICTED: probable metal-nicotianamine tran...    187   2e-51   
ref|XP_009415880.1|  PREDICTED: probable metal-nicotianamine tran...    187   2e-51   
ref|XP_006845869.1|  hypothetical protein AMTR_s00154p00062710          178   3e-51   
ref|XP_009415879.1|  PREDICTED: probable metal-nicotianamine tran...    187   3e-51   
ref|XP_006491954.1|  PREDICTED: metal-nicotianamine transporter Y...    187   3e-51   
gb|AAM64930.1|  unknown                                                 187   3e-51   
gb|AAS00695.1|  metal-nicotianamine transporter YSL6                    187   3e-51   
ref|XP_008381368.1|  PREDICTED: metal-nicotianamine transporter Y...    187   3e-51   
ref|XP_006441189.1|  hypothetical protein CICLE_v10019170mg             187   3e-51   
ref|NP_566806.1|  putative metal-nicotianamine transporter YSL6         187   3e-51   
emb|CDY35455.1|  BnaC03g62050D                                          187   3e-51   
gb|AAM53283.1|  unknown protein                                         187   3e-51   
gb|AAK62460.1|AF387015_1  putative protein                              187   3e-51   
ref|XP_006491948.1|  PREDICTED: metal-nicotianamine transporter Y...    187   4e-51   
ref|XP_008456007.1|  PREDICTED: metal-nicotianamine transporter Y...    185   4e-51   
emb|CDY20064.1|  BnaA09g01870D                                          189   4e-51   
gb|AFU82909.1|  yellow stripe-like transporter 3.2                      178   4e-51   
ref|XP_006441190.1|  hypothetical protein CICLE_v10019170mg             186   4e-51   
ref|XP_009346778.1|  PREDICTED: probable metal-nicotianamine tran...    186   4e-51   
ref|XP_008456005.1|  PREDICTED: metal-nicotianamine transporter Y...    186   4e-51   
ref|XP_009346777.1|  PREDICTED: probable metal-nicotianamine tran...    186   4e-51   
ref|XP_002446309.1|  hypothetical protein SORBIDRAFT_06g013960          186   5e-51   
ref|XP_004306307.1|  PREDICTED: probable metal-nicotianamine tran...    186   5e-51   
ref|NP_001131175.1|  hypothetical protein                               186   6e-51   
ref|XP_011468195.1|  PREDICTED: probable metal-nicotianamine tran...    186   6e-51   
ref|XP_010556294.1|  PREDICTED: probable metal-nicotianamine tran...    186   6e-51   
gb|KFK33040.1|  hypothetical protein AALP_AA6G322700                    184   6e-51   
gb|KFK33623.1|  hypothetical protein AALP_AA5G037700                    186   7e-51   
ref|XP_009392235.1|  PREDICTED: probable metal-nicotianamine tran...    186   8e-51   
ref|XP_008231092.1|  PREDICTED: probable metal-nicotianamine tran...    186   8e-51   
ref|XP_010028979.1|  PREDICTED: probable metal-nicotianamine tran...    186   9e-51   
ref|XP_009344229.1|  PREDICTED: probable metal-nicotianamine tran...    186   9e-51   
gb|KDO63889.1|  hypothetical protein CISIN_1g005868mg                   183   9e-51   
ref|XP_009344228.1|  PREDICTED: probable metal-nicotianamine tran...    185   1e-50   
ref|XP_010940749.1|  PREDICTED: probable metal-nicotianamine tran...    186   1e-50   
ref|XP_002515673.1|  oligopeptide transporter, putative                 185   1e-50   
ref|XP_008362099.1|  PREDICTED: probable metal-nicotianamine tran...    185   1e-50   
gb|EYU31834.1|  hypothetical protein MIMGU_mgv1a002047mg                186   1e-50   
gb|AEQ28191.1|  yellow stripe-like protein 6                            185   1e-50   
ref|XP_010445924.1|  PREDICTED: metal-nicotianamine transporter Y...    181   1e-50   
ref|XP_009119903.1|  PREDICTED: metal-nicotianamine transporter YSL3    185   2e-50   
emb|CDY20248.1|  BnaC09g29910D                                          185   2e-50   
emb|CDY14371.1|  BnaA10g06840D                                          185   2e-50   
ref|XP_008780049.1|  PREDICTED: probable metal-nicotianamine tran...    178   2e-50   
gb|KHG22766.1|  putative metal-nicotianamine transporter YSL6 -li...    184   2e-50   
ref|XP_010249085.1|  PREDICTED: probable metal-nicotianamine tran...    185   2e-50   
emb|CAE02279.2|  OSJNBa0055C08.2                                        185   2e-50   
gb|ADE76428.1|  unknown                                                 184   2e-50   
gb|AEQ28192.1|  yellow stripe-like protein 3                            184   2e-50   
gb|AAS00691.1|  metal-nicotianamine transporter YSL1                    184   2e-50   
sp|Q7XRV1.3|YSL5_ORYSJ  RecName: Full=Probable metal-nicotianamin...    184   3e-50   
gb|KDO63888.1|  hypothetical protein CISIN_1g005868mg                   184   3e-50   
ref|XP_009613490.1|  PREDICTED: probable metal-nicotianamine tran...    184   3e-50   
ref|XP_009757311.1|  PREDICTED: probable metal-nicotianamine tran...    184   3e-50   
ref|XP_004975420.1|  PREDICTED: probable metal-nicotianamine tran...    184   3e-50   
emb|CDX92615.1|  BnaC07g38730D                                          184   3e-50   
gb|EYU27872.1|  hypothetical protein MIMGU_mgv1a019282mg                184   3e-50   
ref|XP_006653335.1|  PREDICTED: probable metal-nicotianamine tran...    187   3e-50   
ref|XP_008379097.1|  PREDICTED: probable metal-nicotianamine tran...    184   3e-50   
ref|XP_006338712.1|  PREDICTED: probable metal-nicotianamine tran...    184   3e-50   
ref|XP_010112394.1|  putative metal-nicotianamine transporter YSL6      184   4e-50   
ref|XP_009109308.1|  PREDICTED: metal-nicotianamine transporter Y...    184   4e-50   
ref|XP_010482756.1|  PREDICTED: metal-nicotianamine transporter Y...    179   4e-50   
gb|AFU82907.1|  yellow stripe-like transporter 1                        184   4e-50   
emb|CDY24797.1|  BnaA08g15130D                                          183   4e-50   
ref|XP_004231762.1|  PREDICTED: probable metal-nicotianamine tran...    184   4e-50   
ref|XP_003556608.1|  PREDICTED: probable metal-nicotianamine tran...    184   4e-50   
gb|EEC77183.1|  hypothetical protein OsI_15675                          183   5e-50   
ref|XP_011098915.1|  PREDICTED: probable metal-nicotianamine tran...    183   5e-50   
ref|XP_011098916.1|  PREDICTED: probable metal-nicotianamine tran...    183   6e-50   
sp|Q7XRV2.1|YSL6_ORYSJ  RecName: Full=Probable metal-nicotianamin...    183   6e-50   
gb|EAZ30539.1|  hypothetical protein OsJ_14587                          183   6e-50   
gb|KGN57644.1|  hypothetical protein Csa_3G238100                       183   6e-50   
ref|XP_004146239.1|  PREDICTED: metal-nicotianamine transporter Y...    183   7e-50   
ref|XP_004165023.1|  PREDICTED: metal-nicotianamine transporter Y...    183   7e-50   
ref|XP_009137417.1|  PREDICTED: metal-nicotianamine transporter Y...    183   7e-50   
gb|KDP43290.1|  hypothetical protein JCGZ_24211                         183   8e-50   
dbj|BAE91885.1|  hypothetical protein                                   183   9e-50   
gb|KHN13497.1|  Putative metal-nicotianamine transporter YSL6           182   9e-50   
ref|XP_006447028.1|  hypothetical protein CICLE_v10014497mg             182   9e-50   
gb|ABD04075.1|  YSL transporter 3                                       182   9e-50   
ref|XP_006405407.1|  hypothetical protein EUTSA_v10027673mg             182   1e-49   
gb|ABB76763.1|  YSL transporter 3                                       182   1e-49   
gb|EYU39420.1|  hypothetical protein MIMGU_mgv1a002450mg                182   1e-49   
ref|XP_006604157.1|  PREDICTED: probable metal-nicotianamine tran...    182   1e-49   
emb|CAH66436.1|  OSIGBa0132D06.2                                        182   1e-49   
dbj|BAE91886.1|  hypothetical protein                                   182   1e-49   
ref|XP_006447029.1|  hypothetical protein CICLE_v10014497mg             182   1e-49   
ref|XP_003553947.1|  PREDICTED: probable metal-nicotianamine tran...    182   1e-49   
gb|ADN33766.1|  YSL transporter                                         181   1e-49   
emb|CAH66437.1|  OSIGBa0132D06.3                                        182   1e-49   
ref|XP_008367110.1|  PREDICTED: metal-nicotianamine transporter Y...    174   2e-49   
gb|EMT26359.1|  Putative metal-nicotianamine transporter YSL6           182   2e-49   
ref|XP_009351940.1|  PREDICTED: metal-nicotianamine transporter Y...    182   2e-49   
ref|XP_009361313.1|  PREDICTED: metal-nicotianamine transporter YSL2    182   2e-49   
ref|XP_004514626.1|  PREDICTED: probable metal-nicotianamine tran...    182   2e-49   
gb|AEX10894.1|  hypothetical protein 0_1078_01                          169   3e-49   
ref|XP_002274559.2|  PREDICTED: probable metal-nicotianamine tran...    181   3e-49   
emb|CDP18194.1|  unnamed protein product                                181   3e-49   
gb|KDP41791.1|  hypothetical protein JCGZ_26809                         181   3e-49   
ref|XP_006487169.1|  PREDICTED: probable metal-nicotianamine tran...    180   3e-49   
ref|XP_002864249.1|  predicted protein                                  181   3e-49   
gb|KHN28282.1|  Putative metal-nicotianamine transporter YSL6           180   4e-49   
ref|XP_006487168.1|  PREDICTED: probable metal-nicotianamine tran...    181   4e-49   
ref|XP_006423237.1|  hypothetical protein CICLE_v10027961mg             181   4e-49   
ref|XP_001759545.1|  predicted protein                                  181   5e-49   
ref|XP_008798980.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    179   5e-49   
gb|AEX10893.1|  hypothetical protein 0_1078_01                          168   5e-49   
ref|XP_010252366.1|  PREDICTED: metal-nicotianamine transporter YSL2    181   5e-49   
ref|XP_011075924.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    181   5e-49   
ref|XP_010442924.1|  PREDICTED: metal-nicotianamine transporter Y...    176   5e-49   
ref|XP_006844631.1|  hypothetical protein AMTR_s00016p00228960          181   5e-49   
gb|KDP30688.1|  hypothetical protein JCGZ_16395                         180   6e-49   
ref|XP_010445905.1|  PREDICTED: metal-nicotianamine transporter Y...    181   6e-49   
gb|KJB18947.1|  hypothetical protein B456_003G076700                    180   6e-49   
dbj|BAE98794.1|  EspB-like protein                                      178   6e-49   
ref|XP_003549112.1|  PREDICTED: probable metal-nicotianamine tran...    180   7e-49   
ref|XP_006653337.1|  PREDICTED: probable metal-nicotianamine tran...    174   7e-49   
ref|XP_008376798.1|  PREDICTED: metal-nicotianamine transporter YSL3    180   8e-49   
ref|XP_006401691.1|  hypothetical protein EUTSA_v10012886mg             180   8e-49   
ref|XP_010671369.1|  PREDICTED: metal-nicotianamine transporter Y...    180   8e-49   
emb|CDX96232.1|  BnaC02g14190D                                          180   9e-49   
ref|XP_009763791.1|  PREDICTED: metal-nicotianamine transporter Y...    179   9e-49   
gb|KHN44642.1|  Metal-nicotianamine transporter YSL1                    179   9e-49   
ref|XP_010913001.1|  PREDICTED: probable metal-nicotianamine tran...    180   9e-49   
ref|XP_009763790.1|  PREDICTED: metal-nicotianamine transporter Y...    180   9e-49   
gb|EMS52485.1|  putative metal-nicotianamine transporter YSL6           179   1e-48   
ref|XP_011470188.1|  PREDICTED: metal-nicotianamine transporter Y...    180   1e-48   
ref|XP_006593833.1|  PREDICTED: metal-nicotianamine transporter Y...    180   1e-48   
ref|XP_010671364.1|  PREDICTED: metal-nicotianamine transporter Y...    179   1e-48   
ref|XP_003622146.1|  Yellow stripe-like protein 1.1                     180   1e-48   
ref|XP_009763789.1|  PREDICTED: metal-nicotianamine transporter Y...    179   1e-48   
ref|XP_006593836.1|  PREDICTED: metal-nicotianamine transporter Y...    179   1e-48   
ref|XP_002872112.1|  hypothetical protein ARALYDRAFT_489303             179   1e-48   
gb|KGN65329.1|  hypothetical protein Csa_1G329900                       179   1e-48   
ref|XP_006593837.1|  PREDICTED: metal-nicotianamine transporter Y...    179   1e-48   
ref|XP_010679992.1|  PREDICTED: probable metal-nicotianamine tran...    179   1e-48   
ref|XP_004172903.1|  PREDICTED: metal-nicotianamine transporter Y...    179   1e-48   
ref|XP_004150025.1|  PREDICTED: metal-nicotianamine transporter Y...    179   1e-48   
emb|CDY70890.1|  BnaCnng70180D                                          175   2e-48   
ref|XP_010482755.1|  PREDICTED: metal-nicotianamine transporter Y...    179   2e-48   
gb|AEX10900.1|  hypothetical protein 0_1078_01                          167   2e-48   
ref|NP_200167.2|  metal-nicotianamine transporter YSL3                  179   2e-48   
ref|XP_009398090.1|  PREDICTED: probable metal-nicotianamine tran...    179   2e-48   
dbj|BAB09731.1|  EspB-like protein                                      179   2e-48   
ref|XP_006281523.1|  hypothetical protein CARUB_v10027623mg             179   2e-48   
ref|XP_003579626.1|  PREDICTED: probable metal-nicotianamine tran...    179   2e-48   
ref|XP_008444004.1|  PREDICTED: metal-nicotianamine transporter Y...    179   3e-48   
ref|XP_002318472.2|  hypothetical protein POPTR_0012s03180g             178   3e-48   
ref|XP_008234683.1|  PREDICTED: metal-nicotianamine transporter YSL3    178   3e-48   
ref|XP_007136481.1|  hypothetical protein PHAVU_009G048800g             178   4e-48   
ref|XP_003556427.1|  PREDICTED: metal-nicotianamine transporter Y...    178   4e-48   
ref|XP_008653898.1|  PREDICTED: probable metal-nicotianamine tran...    166   4e-48   
ref|XP_007161672.1|  hypothetical protein PHAVU_001G088900g             178   4e-48   
ref|XP_007220212.1|  hypothetical protein PRUPE_ppa002475mg             178   4e-48   
ref|XP_006606419.1|  PREDICTED: metal-nicotianamine transporter Y...    178   4e-48   
gb|KHN04996.1|  Metal-nicotianamine transporter YSL1                    178   4e-48   
gb|KHN46380.1|  Metal-nicotianamine transporter YSL1                    177   4e-48   
gb|AHA84244.1|  putative metal-nicotianamine transporter YSL6           178   4e-48   
gb|KCW65044.1|  hypothetical protein EUGRSUZ_G02568                     177   5e-48   
ref|XP_010068802.1|  PREDICTED: probable metal-nicotianamine tran...    177   6e-48   
ref|XP_006287225.1|  hypothetical protein CARUB_v10000403mg             177   6e-48   
ref|XP_003581149.1|  PREDICTED: probable metal-nicotianamine tran...    177   6e-48   
gb|AAM98073.1|  AT5g24380/K16H17_9                                      174   7e-48   
ref|XP_002274166.1|  PREDICTED: metal-nicotianamine transporter YSL3    177   7e-48   
ref|NP_001141294.1|  uncharacterized protein LOC100273385               171   8e-48   
ref|XP_006578879.1|  PREDICTED: metal-nicotianamine transporter Y...    177   8e-48   
ref|XP_010100194.1|  Metal-nicotianamine transporter YSL1               177   8e-48   
gb|AFU82908.1|  yellow stripe-like transporter 3.1                      177   8e-48   
emb|CBI23058.3|  unnamed protein product                                177   9e-48   
ref|XP_003523338.2|  PREDICTED: metal-nicotianamine transporter Y...    177   9e-48   
ref|XP_003556858.1|  PREDICTED: metal-nicotianamine transporter Y...    177   9e-48   
dbj|BAH57276.1|  AT5G24380                                              174   9e-48   
gb|KHN19530.1|  Metal-nicotianamine transporter YSL3                    177   9e-48   
ref|XP_011043727.1|  PREDICTED: metal-nicotianamine transporter Y...    177   1e-47   
gb|EMT09335.1|  Putative metal-nicotianamine transporter YSL6           177   1e-47   
ref|XP_011043724.1|  PREDICTED: metal-nicotianamine transporter Y...    177   1e-47   
emb|CDP05015.1|  unnamed protein product                                177   1e-47   
ref|XP_008437732.1|  PREDICTED: metal-nicotianamine transporter YSL1    174   1e-47   
ref|XP_009140243.1|  PREDICTED: probable metal-nicotianamine tran...    176   1e-47   
ref|XP_007039405.1|  YELLOW STRIPE like 1 isoform 3                     176   1e-47   
ref|XP_006581667.1|  PREDICTED: metal-nicotianamine transporter Y...    176   2e-47   
ref|XP_010035301.1|  PREDICTED: metal-nicotianamine transporter Y...    176   2e-47   
ref|XP_006845873.1|  hypothetical protein AMTR_s00154p00064710          167   2e-47   
emb|CAN77891.1|  hypothetical protein VITISV_016271                     176   2e-47   
ref|XP_011084545.1|  PREDICTED: LOW QUALITY PROTEIN: metal-nicoti...    176   2e-47   
ref|XP_010436040.1|  PREDICTED: probable metal-nicotianamine tran...    176   2e-47   
ref|XP_004143842.1|  PREDICTED: metal-nicotianamine transporter Y...    176   2e-47   
ref|XP_003536174.2|  PREDICTED: metal-nicotianamine transporter Y...    176   2e-47   
gb|KHN14758.1|  Metal-nicotianamine transporter YSL1                    176   2e-47   
ref|XP_010537056.1|  PREDICTED: metal-nicotianamine transporter Y...    176   2e-47   
ref|XP_010441262.1|  PREDICTED: probable metal-nicotianamine tran...    176   2e-47   



>emb|CDP01724.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GSEYPAP A ++RNMAILGVEGF ALPKNCLTLCY+FF GA+VING+RD +GKKWARF
Sbjct  300  EQGSEYPAPYALIYRNMAILGVEGFGALPKNCLTLCYVFFAGAVVINGIRDLLGKKWARF  359

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFY+GSYFAIDM VG++ILFVW+K+N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  360  IPLPMAMAIPFYLGSYFAIDMCVGSLILFVWEKLNKAKADAFGPAVASGLICGDGIWTLP  419

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             +ILALAGV PPICMKFLSRK N++VDTFL
Sbjct  420  SAILALAGVNPPICMKFLSRKVNSKVDTFL  449



>ref|XP_004234495.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=696

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A V+RNM+ILGVEGFSALPKNCLTLCYIFF+GAI IN +RD +GK  A++IP
Sbjct  544  GSEYPAPYALVYRNMSILGVEGFSALPKNCLTLCYIFFIGAIAINALRDALGKNKAKYIP  603

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM +G++ILF+W KIN+AKADAFGPAVASGLICGDGIWTLP S
Sbjct  604  LPMAMAIPFYLGSYFAIDMCIGSLILFIWTKINKAKADAFGPAVASGLICGDGIWTLPSS  663

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
            ILAL+GV PPICMKFLSRKDN RVD F+HP
Sbjct  664  ILALSGVNPPICMKFLSRKDNIRVDKFMHP  693



>ref|XP_009615008.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Nicotiana tomentosiformis]
Length=555

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A VFR+M+I+GVEGFSALPK+CLTLCYIFFVGAIVING+RD VGK  A++IP
Sbjct  406  GSAYPAPYALVFRSMSIIGVEGFSALPKHCLTLCYIFFVGAIVINGIRDLVGKNKAKYIP  465

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYF IDM +G++ILFVW KIN+AKADAFGPAVASGLICGDG+WTLP S
Sbjct  466  LPMAMAIPFYLGSYFTIDMCLGSLILFVWSKINKAKADAFGPAVASGLICGDGVWTLPSS  525

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILALAGVKPPICMKFLSRKDNTRVD+FL+
Sbjct  526  ILALAGVKPPICMKFLSRKDNTRVDSFLN  554



>ref|XP_009794096.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Nicotiana sylvestris]
Length=555

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A VFR+M+I+GVEGFSALPK+CLTLCYIFFVGAIVING+RD VGK  A++IP
Sbjct  406  GSAYPAPYALVFRSMSIIGVEGFSALPKHCLTLCYIFFVGAIVINGIRDLVGKNKAKYIP  465

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM +G++ILFVW KIN+AKADAFGPAVASGLICGDG+WTLP S
Sbjct  466  LPMAMAIPFYLGSYFAIDMCLGSLILFVWSKINKAKADAFGPAVASGLICGDGVWTLPSS  525

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILAL+GVKPPICMKFLS+KDNTRVD+FL+
Sbjct  526  ILALSGVKPPICMKFLSKKDNTRVDSFLN  554



>ref|XP_009615007.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Nicotiana tomentosiformis]
Length=689

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A VFR+M+I+GVEGFSALPK+CLTLCYIFFVGAIVING+RD VGK  A++IP
Sbjct  540  GSAYPAPYALVFRSMSIIGVEGFSALPKHCLTLCYIFFVGAIVINGIRDLVGKNKAKYIP  599

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYF IDM +G++ILFVW KIN+AKADAFGPAVASGLICGDG+WTLP S
Sbjct  600  LPMAMAIPFYLGSYFTIDMCLGSLILFVWSKINKAKADAFGPAVASGLICGDGVWTLPSS  659

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILALAGVKPPICMKFLSRKDNTRVD+FL+
Sbjct  660  ILALAGVKPPICMKFLSRKDNTRVDSFLN  688



>ref|XP_009794095.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Nicotiana sylvestris]
Length=686

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A VFR+M+I+GVEGFSALPK+CLTLCYIFFVGAIVING+RD VGK  A++IP
Sbjct  537  GSAYPAPYALVFRSMSIIGVEGFSALPKHCLTLCYIFFVGAIVINGIRDLVGKNKAKYIP  596

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM +G++ILFVW KIN+AKADAFGPAVASGLICGDG+WTLP S
Sbjct  597  LPMAMAIPFYLGSYFAIDMCLGSLILFVWSKINKAKADAFGPAVASGLICGDGVWTLPSS  656

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILAL+GVKPPICMKFLS+KDNTRVD+FL+
Sbjct  657  ILALSGVKPPICMKFLSKKDNTRVDSFLN  685



>gb|EYU25660.1| hypothetical protein MIMGU_mgv1a003894mg [Erythranthe guttata]
Length=557

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A+V+RNMAILGVEG SALPKNCLTLCY+FF+GA+ ING+RD VGKKW+RFIP
Sbjct  408  GSKYPAPYASVYRNMAILGVEGVSALPKNCLTLCYVFFIGAVAINGIRDAVGKKWSRFIP  467

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG YF IDM VG++ILFVW+KI++AKADAFGPAVASGLICGDGIWTLP S
Sbjct  468  LPMAMAIPFYIGGYFTIDMCVGSLILFVWEKIDKAKADAFGPAVASGLICGDGIWTLPSS  527

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILAL GV PPICMKFLS K N RVD FL
Sbjct  528  ILALLGVNPPICMKFLSGKANARVDAFL  555



>gb|KDP22031.1| hypothetical protein JCGZ_03001 [Jatropha curcas]
Length=550

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+RNM+ILGVEGFSALPK+CLTLCYIFF  AIVING+RD VGKK ARFIPL
Sbjct  402  SEYPAPYALVYRNMSILGVEGFSALPKHCLTLCYIFFAAAIVINGIRDAVGKKRARFIPL  461

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W+K+N+ KADAFGPAVASGLICGDGIWTLP SI
Sbjct  462  PMAMAIPFYLGGYFAIDMCVGSLILFIWRKVNKGKADAFGPAVASGLICGDGIWTLPSSI  521

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGV PPICMKFLSR  NT+VD+FL
Sbjct  522  LALAGVNPPICMKFLSRSQNTKVDSFL  548



>ref|XP_006343309.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=699

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A V+RNMAILGVEGFSALPKNCLTLCYIFF+GAI IN +RD +GK  A++IP
Sbjct  550  GSEYPAPYAIVYRNMAILGVEGFSALPKNCLTLCYIFFIGAIAINALRDALGKNKAKYIP  609

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFY+GSYF IDM +G++ILF+W KIN+AKADAFGPAVASGLICGDGIWTLP S
Sbjct  610  IPMAMAIPFYLGSYFTIDMCLGSLILFIWTKINKAKADAFGPAVASGLICGDGIWTLPSS  669

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
            ILAL+GV PPICMKFLSRKDN RVD F+ P
Sbjct  670  ILALSGVNPPICMKFLSRKDNIRVDKFMKP  699



>gb|EYU25678.1| hypothetical protein MIMGU_mgv1a002252mg [Erythranthe guttata]
Length=695

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+Y AP A V+RNMAILGVEGFSALP +CLTLCY+FF+ A+VINGVRD VG KWARFI
Sbjct  545  SGSQYKAPYALVYRNMAILGVEGFSALPDHCLTLCYVFFIAAVVINGVRDAVGVKWARFI  604

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFY+G YF IDM VG++ILFVW+KI++AKADAFGPAVASGLICGDGIW LP+
Sbjct  605  PLPMAMAIPFYLGGYFTIDMCVGSLILFVWEKIDKAKADAFGPAVASGLICGDGIWALPN  664

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALAGVK PICMKFLSRKDN RVD FL
Sbjct  665  SVLALAGVKAPICMKFLSRKDNARVDAFL  693



>ref|NP_001232821.1| uncharacterized protein LOC100272237 [Zea mays]
 gb|ACF83075.1| unknown [Zea mays]
Length=174

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++G+EYPAP A V+RNMAILGV+GF +LPKNCLTLCYIFF  AI IN VRD    K +RF
Sbjct  22   ESGTEYPAPYAIVYRNMAILGVDGFGSLPKNCLTLCYIFFAAAITINLVRDLTPYKVSRF  81

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIGSYFAIDMF+G+ ILFVW+++N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  82   IPLPMAMAIPFYIGSYFAIDMFLGSAILFVWERLNKAKADAFGPAVASGLICGDGIWTLP  141

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALA V+PPICMKFLSR  N +VD+FL
Sbjct  142  QSILALAKVQPPICMKFLSRSTNAKVDSFL  171



>ref|XP_011097988.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=693

 Score =   256 bits (655),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+Y AP A V+RNMAILGVEGFSALPK+CLTLCYIFFV A VING+RD VG KWA+FIP
Sbjct  544  GSQYSAPYALVYRNMAILGVEGFSALPKHCLTLCYIFFVAAAVINGIRDAVGPKWAKFIP  603

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM VG++ILF+W+KI++ KADAFGPAVASGLICGDGIWTLP S
Sbjct  604  LPMAMAIPFYLGGYFTIDMCVGSLILFIWEKIDKVKADAFGPAVASGLICGDGIWTLPSS  663

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGVKPPICMKFLSRK N RVDTFL
Sbjct  664  VLALAGVKPPICMKFLSRKANARVDTFL  691



>ref|XP_009593058.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
tomentosiformis]
Length=713

 Score =   257 bits (656),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A V+RNM+ILGVEGFSALPKNCLTLCY+FF+GAI IN +RD VGK  A++IP
Sbjct  564  GSEYPAPYALVYRNMSILGVEGFSALPKNCLTLCYVFFLGAIAINALRDAVGKNKAKYIP  623

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM +G++ILFVW KI++ KADAFGPAVASGLICGDGIWTLP S
Sbjct  624  LPMAMAIPFYLGSYFAIDMCLGSLILFVWTKIDKVKADAFGPAVASGLICGDGIWTLPSS  683

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
            ILALAGV PPICMKFLSRKDN RVD F++P
Sbjct  684  ILALAGVNPPICMKFLSRKDNIRVDGFINP  713



>ref|XP_006363210.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Solanum tuberosum]
Length=692

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A V+RNM+I+GVEGFSALPKNCLTLCY+FF+GAIVING+RD VGK  A++IP
Sbjct  543  GSAYPAPYALVYRNMSIIGVEGFSALPKNCLTLCYVFFIGAIVINGIRDLVGKNKAKYIP  602

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM +G++ILFVW KIN+AKADAFGPAVASGLICGDGIWTLP S
Sbjct  603  LPMAMAIPFYLGSYFAIDMCLGSLILFVWTKINKAKADAFGPAVASGLICGDGIWTLPSS  662

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILAL GVKPPICMKFLSR  NTRVD FL+
Sbjct  663  ILALVGVKPPICMKFLSRNANTRVDGFLN  691



>ref|XP_011035386.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Populus 
euphratica]
Length=684

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            TGS+YPAP A V+RNMAILGVEGFSALPKNCL LCY FFV AI+IN ++D +GKKWARFI
Sbjct  534  TGSQYPAPYATVYRNMAILGVEGFSALPKNCLYLCYGFFVAAILINLIKDALGKKWARFI  593

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P PMAMAIPFYIGSYFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP 
Sbjct  594  PNPMAMAIPFYIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPS  653

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SIL LAGVKPPICMKFLSR  N++VD FL
Sbjct  654  SILVLAGVKPPICMKFLSRGTNSKVDAFL  682



>ref|XP_009798435.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Nicotiana 
sylvestris]
Length=712

 Score =   254 bits (649),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A V+RNM+ILGVEGFSALPKNCLTLCY+FF+GAI IN +RD VGK  A++IP
Sbjct  563  GSEYPAPYALVYRNMSILGVEGFSALPKNCLTLCYVFFLGAIAINALRDAVGKNKAKYIP  622

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM +G++ILFVW KI++ KADAFGPAVASGLICGDGIWTLP S
Sbjct  623  LPMAMAIPFYLGSYFAIDMCLGSLILFVWTKIDKVKADAFGPAVASGLICGDGIWTLPSS  682

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGV PPICMKFLSRKDN RVD F+
Sbjct  683  ILALAGVNPPICMKFLSRKDNIRVDGFI  710



>ref|XP_010528609.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Tarenaya 
hassleriana]
Length=689

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++GS YPAP A V+RNM+ILGVEGFSALPK+CL LCY+FF  A+++NGVRD VG KWARF
Sbjct  538  QSGSSYPAPYALVYRNMSILGVEGFSALPKHCLMLCYVFFAAAVIVNGVRDAVGPKWARF  597

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILFVW+K+N+ KADAFGPAVASGLICG+GIWTLP
Sbjct  598  IPLPMAMAIPFYIGGYFTIDMCVGSLILFVWRKLNKPKADAFGPAVASGLICGEGIWTLP  657

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             S+LALAGVKPPICMKFLS   NT+VD+FL
Sbjct  658  SSVLALAGVKPPICMKFLSSSTNTKVDSFL  687



>ref|XP_004233770.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Solanum 
lycopersicum]
Length=694

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A V+RNM+I+GVEGFSALPKNCL LC IFF+GAIVING+RD VGK  A++IP
Sbjct  545  GSAYPAPYALVYRNMSIIGVEGFSALPKNCLILCCIFFIGAIVINGIRDLVGKNKAKYIP  604

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM +G++ILFVW KIN+AKADAFGPAVASGLICGDGIWTLP S
Sbjct  605  LPMAMAIPFYLGSYFAIDMCLGSLILFVWTKINKAKADAFGPAVASGLICGDGIWTLPSS  664

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILAL GVKPPICMKFLSR  NTRVD+FL+
Sbjct  665  ILALVGVKPPICMKFLSRNANTRVDSFLN  693



>ref|XP_006652534.1| PREDICTED: probable metal-nicotianamine transporter YSL13-like 
[Oryza brachyantha]
Length=510

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+YPAPNAA+FR++AILGV+GFS+LPKNCL LCY FF GA+V+N +RD V KK +RFI
Sbjct  358  SGSDYPAPNAAIFRSIAILGVDGFSSLPKNCLNLCYAFFAGAVVVNLIRDLVPKKVSRFI  417

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFYIGSYFAIDMF+GTVILFVWQ+++RAKAD FGPAVASGLICGDG W LP 
Sbjct  418  PIPMAMAIPFYIGSYFAIDMFIGTVILFVWQRLDRAKADTFGPAVASGLICGDGTWVLPQ  477

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            S+LALA VKPPICMKFLSR+ N +VD FL+
Sbjct  478  SVLALAKVKPPICMKFLSRRTNDKVDVFLN  507



>ref|XP_006372355.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50152.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=553

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAPNA VFRNMAILGV+GFS+LPKNCL LCY FF  AI+IN ++D +GKKWARFIP
Sbjct  404  GSQYPAPNATVFRNMAILGVDGFSSLPKNCLYLCYGFFSAAILINLMKDALGKKWARFIP  463

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP +
Sbjct  464  NPMAMAIPFYIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSA  523

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILAL GVKPPICMKFLSR  N +VD FL
Sbjct  524  ILALVGVKPPICMKFLSRGTNAKVDAFL  551



>ref|XP_006372357.1| hypothetical protein POPTR_0017s00830g [Populus trichocarpa]
 gb|ERP50154.1| hypothetical protein POPTR_0017s00830g [Populus trichocarpa]
Length=289

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A V+RNMAILGV+GFS+LPKNCL LCY FF  AI+IN ++D +GKKWARFIP
Sbjct  140  GSQYPAPYATVYRNMAILGVDGFSSLPKNCLYLCYGFFGAAILINLIKDALGKKWARFIP  199

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIG YFAIDM VG++ILF+W+KI +AKADAFGPAVASGLICGDGIWTLP +
Sbjct  200  NPMAMAIPFYIGPYFAIDMCVGSLILFIWEKIYKAKADAFGPAVASGLICGDGIWTLPSA  259

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILAL GVKPPICMKFLSR  N +VD FL
Sbjct  260  ILALVGVKPPICMKFLSRGTNAKVDAFL  287



>ref|XP_011046070.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Populus euphratica]
Length=704

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAPNA VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +GKKWARFIP
Sbjct  555  GSQYPAPNATVFRNMAILGVEGFSSLPKNCLYLCYGFFGAAILINLIKDALGKKWARFIP  614

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP +
Sbjct  615  NPMAMAIPFYIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPRA  674

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVKPPICMKFLSR  N +VD FL
Sbjct  675  ILALAGVKPPICMKFLSRGTNAKVDAFL  702



>gb|KDP27275.1| hypothetical protein JCGZ_21006 [Jatropha curcas]
Length=690

 Score =   251 bits (640),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+RNM+ILGVEGFSALPK+CLTLCYIFF  AIVIN +RD VGKK ARFIPL
Sbjct  542  SEYPAPYALVYRNMSILGVEGFSALPKHCLTLCYIFFAAAIVINAIRDAVGKKRARFIPL  601

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G  FAIDM VG++ILF+W+K+N+ KADAFGPAVASGLICGDGIWTLP SI
Sbjct  602  PMAMAIPFYLGGDFAIDMCVGSLILFIWRKVNKGKADAFGPAVASGLICGDGIWTLPSSI  661

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGV PPICMKFLSR  NT+VD+FL
Sbjct  662  LALAGVNPPICMKFLSRSQNTKVDSFL  688



>ref|XP_003575422.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Brachypodium 
distachyon]
Length=715

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            K+G+EYPAP A V+RNMAILGV+GFS+LP+NCLTLCYIFF  AI IN +RD    K +RF
Sbjct  564  KSGTEYPAPYAIVYRNMAILGVDGFSSLPENCLTLCYIFFAAAIAINLIRDLTPHKVSRF  623

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIGSYFAIDMF+G+ ILFVW+++N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  624  IPLPMAMAIPFYIGSYFAIDMFLGSFILFVWERVNKAKADAFGPAVASGLICGDGIWTLP  683

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALA VKPPICMKFL+R DN RVD FL
Sbjct  684  QSILALAKVKPPICMKFLTRADNVRVDNFL  713



>gb|EMS52213.1| putative metal-nicotianamine transporter YSL13 [Triticum urartu]
Length=620

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAPNAA+FR+MAILGV+GFS+LPKNCLTLCYIFFVGAIV+N +RD V KK + FI
Sbjct  468  SGSEYPAPNAAIFRSMAILGVDGFSSLPKNCLTLCYIFFVGAIVVNLIRDLVPKKVSNFI  527

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFYIGSYFAIDMF+GTVILFVWQK++RAK++ F PAVASGLICGDG+W LP 
Sbjct  528  PIPMAMAIPFYIGSYFAIDMFIGTVILFVWQKLDRAKSETFAPAVASGLICGDGLWVLPQ  587

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALA VKPPICMKFLSR  N +VD F+
Sbjct  588  SVLALAKVKPPICMKFLSRGVNDKVDAFI  616



>gb|KCW48661.1| hypothetical protein EUGRSUZ_K02316 [Eucalyptus grandis]
Length=555

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP PN  VFR+MA LGVEG S+LPK+CLTLCY FF  A++ING RD VGKKWARFIP
Sbjct  406  GSEYPVPNGIVFRSMAELGVEGVSSLPKHCLTLCYGFFAAAMIINGFRDLVGKKWARFIP  465

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG YFAIDM VG++ILF+W+KI++ KADAFGPAVASGLICGDGIWTLP+S
Sbjct  466  LPMAMAIPFYIGPYFAIDMCVGSLILFIWEKIDKTKADAFGPAVASGLICGDGIWTLPNS  525

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGV PPICMKFLSR  N RVD FL
Sbjct  526  ILALAGVNPPICMKFLSRATNKRVDAFL  553



>gb|KDP45817.1| hypothetical protein JCGZ_17424 [Jatropha curcas]
Length=698

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YP+PNA ++RNMA+LGV+GFSALPK+CL LCY+FF  AI+IN  +D +GKKWAR+IP
Sbjct  549  GSQYPSPNAVIYRNMAMLGVQGFSALPKDCLLLCYVFFGSAILINFTKDTLGKKWARYIP  608

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YFAIDM VG++ILFVW+KIN+AKADAFGPAVASGLICGDGIWTLP S
Sbjct  609  LPMAMAIPFYLGPYFAIDMCVGSLILFVWEKINKAKADAFGPAVASGLICGDGIWTLPSS  668

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAG+KPPICMKFLSR  N++VD FL
Sbjct  669  ILALAGIKPPICMKFLSRGTNSKVDAFL  696



>ref|XP_007029356.1| YELLOW STRIPE like 5 [Theobroma cacao]
 gb|EOY09858.1| YELLOW STRIPE like 5 [Theobroma cacao]
Length=689

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNM++LGV+GFSALPKNCL LCY+FF  AI+IN V+D VGKKW  +IPL
Sbjct  541  SQYPAPFAVVYRNMSLLGVQGFSALPKNCLVLCYVFFGAAILINLVKDRVGKKWGSYIPL  600

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIGSYFAIDM VG++ILFVW+KIN+AKADAFGPAVASGLICGDGIWTLP SI
Sbjct  601  PMAMAIPFYIGSYFAIDMCVGSLILFVWEKINKAKADAFGPAVASGLICGDGIWTLPSSI  660

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICMKFLSR  N RVD FL
Sbjct  661  LALAGVKPPICMKFLSRATNARVDKFL  687



>ref|XP_006384094.1| hypothetical protein POPTR_0004s06780g [Populus trichocarpa]
 gb|ERP61891.1| hypothetical protein POPTR_0004s06780g [Populus trichocarpa]
Length=582

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            TGS+YPAP A V+RNMAILGVEGFSALPKNCL LCY FF  AI+IN ++D + KKWARFI
Sbjct  432  TGSQYPAPYATVYRNMAILGVEGFSALPKNCLYLCYGFFGAAILINLIKDALCKKWARFI  491

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P PMAMAIPFYIGSYFAIDM +G++ILF+W+KI++ KADAFGPAVASGLICGDGIWTLP 
Sbjct  492  PNPMAMAIPFYIGSYFAIDMCLGSLILFIWEKIDKVKADAFGPAVASGLICGDGIWTLPS  551

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALAGVKPPICMKFLSR  N++VD FL
Sbjct  552  SILALAGVKPPICMKFLSRGTNSKVDAFL  580



>ref|XP_002446809.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor]
 gb|EES11137.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor]
Length=722

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAP A V+RNMAILGV+GFS+LPKNCLTLCYIFF  AIV+N +RD V KK A FI
Sbjct  572  SGSEYPAPYAIVYRNMAILGVDGFSSLPKNCLTLCYIFFAAAIVVNLIRDLVPKKVAGFI  631

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFY+GSYFAIDMF+GTVILF WQ INRAKADAFGPAVASGLICGDGIWTLP 
Sbjct  632  PLPMAMAIPFYLGSYFAIDMFIGTVILFAWQMINRAKADAFGPAVASGLICGDGIWTLPQ  691

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD FL
Sbjct  692  SILALAKVKPPICMKFLSRSVNAQVDGFL  720



>ref|XP_006372353.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50150.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=680

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAPNA VFRNMAILGV+GFS+LPKNCL LCY FF  AI+IN ++D +GKKWARFIP
Sbjct  531  GSQYPAPNATVFRNMAILGVDGFSSLPKNCLYLCYGFFSAAILINLMKDALGKKWARFIP  590

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP +
Sbjct  591  NPMAMAIPFYIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSA  650

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILAL GVKPPICMKFLSR  N +VD FL
Sbjct  651  ILALVGVKPPICMKFLSRGTNAKVDAFL  678



>emb|CBI27128.3| unnamed protein product [Vitis vinifera]
Length=532

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP AAV+R+M+ILGVEGF ALP +CLTLCY+FF GAI+IN +RD + KKWA++IPL
Sbjct  384  SQYPAPYAAVYRSMSILGVEGFGALPDHCLTLCYVFFFGAIIINLIRDTIAKKWAKYIPL  443

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM VG++ILF+W K+N+AKADAFGPAVASGLICGDGIWTLP SI
Sbjct  444  PMAMAIPFYLGSYFAIDMCVGSLILFIWGKLNKAKADAFGPAVASGLICGDGIWTLPSSI  503

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGV+PPICMKFLSR  N+ VD FL
Sbjct  504  LALAGVQPPICMKFLSRGTNSMVDKFL  530



>ref|XP_004976283.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Setaria italica]
Length=718

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAP A V+RNMAILGV+GFS+LPKNCLTLCY+FF  AI +N VRD V KK ARFI
Sbjct  568  SGSEYPAPYAIVYRNMAILGVDGFSSLPKNCLTLCYVFFAAAIAVNLVRDLVPKKVARFI  627

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+GTVILF W+ +N+AKADAF PAVASGLICGDGIWTLP 
Sbjct  628  PLPMAMAIPFYIGSYFAIDMFIGTVILFAWEVMNKAKADAFAPAVASGLICGDGIWTLPQ  687

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALA VKPPICMKFLSR  N +VDTFL
Sbjct  688  SVLALAKVKPPICMKFLSRSVNAQVDTFL  716



>ref|XP_008801346.1| PREDICTED: probable metal-nicotianamine transporter YSL14 isoform 
X2 [Phoenix dactylifera]
Length=512

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+RNMAILGVEGFS+LPK+CLTLCYIFF  AIVIN +RD  GKK ARFIPL
Sbjct  362  SEYPAPYALVYRNMAILGVEGFSSLPKHCLTLCYIFFAAAIVINLLRDFSGKKIARFIPL  421

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIGSYFAIDM VG++ILFVW+ +N+AKADAF PAVASGLICGDGIWTLP SI
Sbjct  422  PMAMAIPFYIGSYFAIDMCVGSLILFVWETVNKAKADAFAPAVASGLICGDGIWTLPQSI  481

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALA VKPPICMKFLSRK N +VD F+
Sbjct  482  LALAKVKPPICMKFLSRKVNVKVDEFI  508



>ref|XP_006372354.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
 gb|ERP50151.1| hypothetical protein POPTR_0017s00810g [Populus trichocarpa]
Length=698

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAPNA VFRNMAILGV+GFS+LPKNCL LCY FF  AI+IN ++D +GKKWARFIP
Sbjct  549  GSQYPAPNATVFRNMAILGVDGFSSLPKNCLYLCYGFFSAAILINLMKDALGKKWARFIP  608

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP +
Sbjct  609  NPMAMAIPFYIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSA  668

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILAL GVKPPICMKFLSR  N +VD FL
Sbjct  669  ILALVGVKPPICMKFLSRGTNAKVDAFL  696



>ref|XP_011046069.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Populus 
euphratica]
Length=630

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +GKKWARFIP
Sbjct  481  GSQYPAPYATVFRNMAILGVEGFSSLPKNCLYLCYGFFGAAILINLIKDALGKKWARFIP  540

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP +
Sbjct  541  NPMAMAIPFYIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSA  600

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILAL GVKPPICMKFLSR  N +VD FL
Sbjct  601  ILALVGVKPPICMKFLSRGTNAKVDAFL  628



>gb|EMT24510.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii]
Length=727

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAPNAA+FR+MAILGV+GFS+LPKNCLTLCYIFFVGAIV+N +RD V KK + FI
Sbjct  575  SGSEYPAPNAAIFRSMAILGVDGFSSLPKNCLTLCYIFFVGAIVVNLIRDLVPKKVSNFI  634

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFYIGSYFAIDMF+GTVILFVWQK++RAK++ F PAVASGLICGDG+W LP 
Sbjct  635  PIPMAMAIPFYIGSYFAIDMFIGTVILFVWQKLDRAKSETFAPAVASGLICGDGLWVLPQ  694

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALA VKPPICMKFLSR  N +VD F+
Sbjct  695  SVLALAKVKPPICMKFLSRGMNDKVDAFI  723



>ref|XP_002520094.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF42283.1| oligopeptide transporter, putative [Ricinus communis]
Length=694

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GSEYP+PNA ++RNMAILGV+GFSALPK+CL LCY+FF  AI+I+ ++D +GK+WARF
Sbjct  543  QPGSEYPSPNAVIYRNMAILGVQGFSALPKDCLLLCYVFFGAAILIDVIKDTLGKRWARF  602

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFY+G YFAIDM VG+ ILFVW+KIN+ KADAFGPAVASGLICGDGIWTLP
Sbjct  603  IPLPMAMAIPFYLGPYFAIDMCVGSFILFVWEKINKTKADAFGPAVASGLICGDGIWTLP  662

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALAGVKPPICMKFLS   N+RVD FL
Sbjct  663  SSILALAGVKPPICMKFLSEGANSRVDKFL  692



>ref|XP_010037025.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48660.1| hypothetical protein EUGRSUZ_K02316 [Eucalyptus grandis]
Length=702

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP PN  VFR+MA LGVEG S+LPK+CLTLCY FF  A++ING RD VGKKWARFIP
Sbjct  553  GSEYPVPNGIVFRSMAELGVEGVSSLPKHCLTLCYGFFAAAMIINGFRDLVGKKWARFIP  612

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG YFAIDM VG++ILF+W+KI++ KADAFGPAVASGLICGDGIWTLP+S
Sbjct  613  LPMAMAIPFYIGPYFAIDMCVGSLILFIWEKIDKTKADAFGPAVASGLICGDGIWTLPNS  672

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGV PPICMKFLSR  N RVD FL
Sbjct  673  ILALAGVNPPICMKFLSRATNKRVDAFL  700



>ref|XP_010415119.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Camelina sativa]
 ref|XP_010415120.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Camelina sativa]
Length=553

 Score =   245 bits (625),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + G+ YPAP A V+RNM+ILGVEGFSALPK+CL LCYIFF  A+++NGVRD VG KWARF
Sbjct  401  QVGTAYPAPYALVYRNMSILGVEGFSALPKHCLMLCYIFFAAAVIVNGVRDAVGPKWARF  460

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILF+W+K+N+ KADA+  AVASGLICG+GIWTLP
Sbjct  461  IPLPMAMAIPFYIGGYFTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLP  520

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             SILALAGVKPPICMKFLS   N +VD+FL+P
Sbjct  521  SSILALAGVKPPICMKFLSSSTNMKVDSFLNP  552



>gb|EPS73705.1| hypothetical protein M569_01043 [Genlisea aurea]
Length=695

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNMAILGVEGF ALPK+CLTLCYIFF GAI INGVRD  G K ARFIPL
Sbjct  547  SQYPAPYALVYRNMAILGVEGFGALPKHCLTLCYIFFAGAIAINGVRDIAGPKRARFIPL  606

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G+YFAIDM +G++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP SI
Sbjct  607  PMAMAIPFYLGAYFAIDMCLGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSSI  666

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LAL GV PPICMKFLSR+ N +VDTFL
Sbjct  667  LALVGVNPPICMKFLSRRTNAKVDTFL  693



>gb|KGN64213.1| hypothetical protein Csa_1G043160 [Cucumis sativus]
Length=693

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  682  EYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLP  503
            EYPAPNA +FRNM++LGVEG S+LPKNCLTLCYIFF  +I+IN ++D + KKWARFIPLP
Sbjct  546  EYPAPNAVLFRNMSVLGVEGASSLPKNCLTLCYIFFATSILINLIKDLIPKKWARFIPLP  605

Query  502  MAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSIL  323
            MAMAIPFYIG YFAIDM +G++ILFVWQK+N+ KA+AFGPAVASGLICGDGIWTLP+SIL
Sbjct  606  MAMAIPFYIGPYFAIDMSLGSLILFVWQKLNKTKAEAFGPAVASGLICGDGIWTLPNSIL  665

Query  322  ALAGVKPPICMKFLSRKDNTRVDTFL  245
            AL GVKPPICMKFLSR  NTRVD FL
Sbjct  666  ALVGVKPPICMKFLSRSANTRVDKFL  691



>ref|XP_004137637.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=723

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  682  EYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLP  503
            EYPAPNA +FRNM++LGVEG S+LPKNCLTLCYIFF  +I+IN ++D + KKWARFIPLP
Sbjct  576  EYPAPNAVLFRNMSVLGVEGASSLPKNCLTLCYIFFATSILINLIKDLIPKKWARFIPLP  635

Query  502  MAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSIL  323
            MAMAIPFYIG YFAIDM +G++ILFVWQK+N+ KA+AFGPAVASGLICGDGIWTLP+SIL
Sbjct  636  MAMAIPFYIGPYFAIDMSLGSLILFVWQKLNKTKAEAFGPAVASGLICGDGIWTLPNSIL  695

Query  322  ALAGVKPPICMKFLSRKDNTRVDTFL  245
            AL GVKPPICMKFLSR  NTRVD FL
Sbjct  696  ALVGVKPPICMKFLSRSANTRVDKFL  721



>ref|XP_004978143.1| PREDICTED: probable metal-nicotianamine transporter YSL13-like 
[Setaria italica]
Length=733

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAPNAAVFR+MAILGV+GFS+LPKNCLTLCY+FF  AIVIN +RD V KK +RFIP+
Sbjct  583  SEYPAPNAAVFRSMAILGVDGFSSLPKNCLTLCYVFFAAAIVINLIRDLVPKKVSRFIPI  642

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG+YFA+DMFVGTVILFVWQ+++RAKADAF PAVASG+ICGDGIW LP S+
Sbjct  643  PMAMAIPFYIGAYFAVDMFVGTVILFVWQRLDRAKADAFAPAVASGMICGDGIWVLPQSL  702

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALA VKPPICMKFLSR  N +VD FL
Sbjct  703  LALAKVKPPICMKFLSRTMNDKVDAFL  729



>gb|EMS54492.1| putative metal-nicotianamine transporter YSL14 [Triticum urartu]
Length=592

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAP A V+RNMAILGV+GF+ LP+NCLTLCYIFF  AIVIN +RD    K++RFI
Sbjct  442  SGSEYPAPYAIVYRNMAILGVDGFNTLPENCLTLCYIFFAAAIVINLIRDLTPHKFSRFI  501

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G+ ILFVW+K+N+AKADA+GPAVASGLICGDGIWTLP 
Sbjct  502  PLPMAMAIPFYIGSYFAIDMFLGSFILFVWEKMNKAKADAYGPAVASGLICGDGIWTLPQ  561

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA V PPICMKFL+R DN +VD FL
Sbjct  562  SILALAKVNPPICMKFLTRGDNVKVDKFL  590



>ref|XP_004165464.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=698

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  682  EYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLP  503
            EYPAPNA +FRNM++LGVEG S+LPKNCLTLCYIFF  +I+IN ++D + KKWARFIPLP
Sbjct  551  EYPAPNAVLFRNMSVLGVEGASSLPKNCLTLCYIFFATSILINLIKDLIPKKWARFIPLP  610

Query  502  MAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSIL  323
            MAMAIPFYIG YFAIDM +G++ILFVWQK+N  KA+AFGPAVASGLICGDGIWTLP+SIL
Sbjct  611  MAMAIPFYIGPYFAIDMSLGSLILFVWQKLNXTKAEAFGPAVASGLICGDGIWTLPNSIL  670

Query  322  ALAGVKPPICMKFLSRKDNTRVDTFL  245
            AL GVKPPICMKFLSR  NTRVD FL
Sbjct  671  ALVGVKPPICMKFLSRSANTRVDKFL  696



>ref|XP_006372622.1| iron transporter-related family protein [Populus trichocarpa]
 gb|ERP50419.1| iron transporter-related family protein [Populus trichocarpa]
Length=698

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A V+RNMAILGV+GFS+LPKNCL LCY FF  AI+IN ++D +GKKWARFIP
Sbjct  549  GSQYPAPYATVYRNMAILGVDGFSSLPKNCLYLCYGFFGAAILINLIKDALGKKWARFIP  608

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP +
Sbjct  609  NPMAMAIPFYIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSA  668

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILAL GVKPPICMKFLSR+ N +VD FL
Sbjct  669  ILALVGVKPPICMKFLSRRTNAKVDAFL  696



>gb|EMT06635.1| Putative metal-nicotianamine transporter YSL14 [Aegilops tauschii]
Length=711

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAP A V+RNMAILGV+GF+ LPKNCLTLCYIFF  AI IN +RD    K++RFI
Sbjct  561  SGSEYPAPYAIVYRNMAILGVDGFNTLPKNCLTLCYIFFAAAIAINLIRDLTPHKFSRFI  620

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G+ ILFVW+K+N+AKADAFGPAVASGLICGDGIWTLP 
Sbjct  621  PLPMAMAIPFYIGSYFAIDMFLGSFILFVWEKVNKAKADAFGPAVASGLICGDGIWTLPQ  680

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA V PPICMKFL+R DN +VD FL
Sbjct  681  SILALAKVNPPICMKFLTRGDNVKVDKFL  709



>ref|XP_002525883.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF36487.1| oligopeptide transporter, putative [Ricinus communis]
Length=717

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            G+EYPAP A V+RNM+ILGVEGFSALPK+CLTLCY+FF+ AIVIN +RD VGK+ A++IP
Sbjct  568  GTEYPAPYALVYRNMSILGVEGFSALPKHCLTLCYVFFIAAIVINVIRDIVGKRGAQYIP  627

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFY+G YFAIDM VG++ILF+W+KIN+AKADA+GPAVASGLICGDGIWTLP S
Sbjct  628  IPMAMAIPFYLGGYFAIDMCVGSLILFMWRKINKAKADAYGPAVASGLICGDGIWTLPSS  687

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILAL GV+PPICMKFLS K N RVD FL+
Sbjct  688  ILALVGVRPPICMKFLSSKQNGRVDNFLN  716



>emb|CBI27129.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  679  YPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLPM  500
            YPAPNA V+RNM++LGVEGF +LP +CLTLCYI F G+IVIN +RD V KKWA++IPLPM
Sbjct  360  YPAPNALVYRNMSVLGVEGFGSLPDHCLTLCYILFAGSIVINLIRDTVAKKWAKYIPLPM  419

Query  499  AMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSILA  320
            AMAIPFY+G YFAIDM VG++ILF+W K+++AKADAFGPAVASGLICGDGIW+LP SILA
Sbjct  420  AMAIPFYLGPYFAIDMCVGSLILFIWGKLDKAKADAFGPAVASGLICGDGIWSLPSSILA  479

Query  319  LAGVKPPICMKFLSRKDNTRVDTFLHP  239
            LAGV+PPICMKFLSR  N RVD FL P
Sbjct  480  LAGVQPPICMKFLSRGTNARVDQFLSP  506



>gb|KFK41018.1| hypothetical protein AALP_AA2G074700 [Arabis alpina]
Length=690

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +TG+ YPAP A V+RNM+ILGVEGFSALPK+CL LCYIFF  A+ +NGVRD VG KWAR+
Sbjct  538  QTGTAYPAPYALVYRNMSILGVEGFSALPKHCLMLCYIFFAAAVFVNGVRDLVGPKWARY  597

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILF+W+K+NR KADA+  AVASGLICG+GIWTLP
Sbjct  598  IPLPMAMAIPFYIGGYFTIDMCVGSLILFIWRKLNRPKADAYSSAVASGLICGEGIWTLP  657

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLH  242
             SILALAGVKPPICMKFLS   N +VD+FLH
Sbjct  658  SSILALAGVKPPICMKFLSSSTNVKVDSFLH  688



>ref|XP_008436975.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL5 [Cucumis melo]
Length=693

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  682  EYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLP  503
            EYPAPNA +FRNM++LGVEG S+LPKNCLTLCYIFF  +I+IN ++D + KKWARFIPLP
Sbjct  546  EYPAPNAVLFRNMSVLGVEGASSLPKNCLTLCYIFFATSILINLIKDLIPKKWARFIPLP  605

Query  502  MAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSIL  323
            MAMAIPFYIG YFAIDM +G++ILFVWQK+NR KA+AFGPAVASGLICGDGIWTLP+SIL
Sbjct  606  MAMAIPFYIGPYFAIDMSLGSLILFVWQKLNRTKAEAFGPAVASGLICGDGIWTLPNSIL  665

Query  322  ALAGVKPPICMKFLSRKDNTRVDTFL  245
            ALAGVK PICMKFLSR  N RVD FL
Sbjct  666  ALAGVKAPICMKFLSRSTNARVDKFL  691



>ref|XP_010112419.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
 gb|EXC33540.1| putative metal-nicotianamine transporter YSL7 [Morus notabilis]
Length=692

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNMAILGVEGFS+LP+ CLTLCYIFF  A +IN V+D + KKWARFIP+
Sbjct  544  SQYPAPYAVVYRNMAILGVEGFSSLPRYCLTLCYIFFGAAFLINLVKDCINKKWARFIPI  603

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIGSYFAIDM VG++ILFVW K+N+AKADAF PAVASGLICGDGIWTLP SI
Sbjct  604  PMAMAIPFYIGSYFAIDMCVGSLILFVWTKVNKAKADAFVPAVASGLICGDGIWTLPASI  663

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICMKFLSR  N RVDTFL
Sbjct  664  LALAGVKPPICMKFLSRATNDRVDTFL  690



>dbj|BAE44205.1| hypothetical protein [Oryza sativa Japonica Group]
Length=727

 Score =   247 bits (630),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GF++LP+NCLTLCYIFF  AI IN +RD    K +RFI
Sbjct  577  SGTEYPAPYAIVYRNMAILGVDGFNSLPENCLTLCYIFFAAAIAINLIRDLAPHKVSRFI  636

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G+VILFVW+K+N+AKADAFGPAVASGLICGDGIWTLP 
Sbjct  637  PLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKAKADAFGPAVASGLICGDGIWTLPQ  696

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD+FL
Sbjct  697  SILALAKVKPPICMKFLSRAANAKVDSFL  725



>emb|CAN72423.1| hypothetical protein VITISV_014262 [Vitis vinifera]
Length=684

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP AAV+R+M+ILGVEGF ALP +CLTLCY+FF GAI+IN +RD + KKWA++IPL
Sbjct  536  SQYPAPYAAVYRSMSILGVEGFGALPDHCLTLCYVFFFGAIIINLIRDTIAKKWAKYIPL  595

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM VG++ILF+W K+N+AKADAFGPAVASGLICGDGIWTLP SI
Sbjct  596  PMAMAIPFYLGSYFAIDMCVGSLILFIWGKLNKAKADAFGPAVASGLICGDGIWTLPSSI  655

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGV+PPICMKFLSR  N+ VD FL
Sbjct  656  LALAGVQPPICMKFLSRGTNSMVDKFL  682



>ref|XP_006372621.1| hypothetical protein POPTR_0017s03320g [Populus trichocarpa]
 gb|ERP50418.1| hypothetical protein POPTR_0017s03320g [Populus trichocarpa]
Length=698

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +GKK ARFIP
Sbjct  549  GSQYPAPYATVFRNMAILGVEGFSSLPKNCLYLCYWFFGAAILINLIKDVLGKKRARFIP  608

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP S
Sbjct  609  NPMAMAIPFYIGSYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSS  668

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVKPPICMKFLSR+ N +VD FL
Sbjct  669  ILALAGVKPPICMKFLSRRTNAKVDAFL  696



>ref|XP_010943908.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=731

 Score =   247 bits (630),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+RNMAILGVEGFS+LPK+CLTLCYIFF GAIVIN +RD  GKK ARFIPL
Sbjct  581  SEYPAPYALVYRNMAILGVEGFSSLPKHCLTLCYIFFAGAIVINLLRDFSGKKVARFIPL  640

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIGSYFAIDM VG++ILFVW+ +N+A+ADAFGPAVASGLICGDGIWTLP SI
Sbjct  641  PMAMAIPFYIGSYFAIDMCVGSLILFVWEMVNKAQADAFGPAVASGLICGDGIWTLPQSI  700

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALA V PPICMKFLSRK N +VD F+
Sbjct  701  LALAKVNPPICMKFLSRKVNAKVDGFI  727



>ref|XP_002279707.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=713

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP AAV+R+M+ILGVEGF ALP +CLTLCY+FF GAI+IN +RD + KKWA++IPL
Sbjct  565  SQYPAPYAAVYRSMSILGVEGFGALPDHCLTLCYVFFFGAIIINLIRDTIAKKWAKYIPL  624

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM VG++ILF+W K+N+AKADAFGPAVASGLICGDGIWTLP SI
Sbjct  625  PMAMAIPFYLGSYFAIDMCVGSLILFIWGKLNKAKADAFGPAVASGLICGDGIWTLPSSI  684

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGV+PPICMKFLSR  N+ VD FL
Sbjct  685  LALAGVQPPICMKFLSRGTNSMVDKFL  711



>gb|EEE57430.1| hypothetical protein OsJ_07631 [Oryza sativa Japonica Group]
Length=697

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GF++LP+NCLTLCYIFF  AI IN +RD    K +RFI
Sbjct  547  SGTEYPAPYAIVYRNMAILGVDGFNSLPENCLTLCYIFFAAAIAINLIRDLAPHKVSRFI  606

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G+VILFVW+K+N+AKADAFGPAVASGLICGDGIWTLP 
Sbjct  607  PLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKAKADAFGPAVASGLICGDGIWTLPQ  666

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD+FL
Sbjct  667  SILALAKVKPPICMKFLSRAANAKVDSFL  695



>sp|Q6H7J6.1|YSL14_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL14; 
AltName: Full=Protein YELLOW STRIPE LIKE 14; Short=OsYSL14 
[Oryza sativa Japonica Group]
 dbj|BAD25303.1| oligopeptide transporter OPT-like [Oryza sativa Japonica Group]
Length=727

 Score =   246 bits (629),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GF++LP+NCLTLCYIFF  AI IN +RD    K +RFI
Sbjct  577  SGTEYPAPYAIVYRNMAILGVDGFNSLPENCLTLCYIFFAAAIAINLIRDLAPHKVSRFI  636

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G+VILFVW+K+N+AKADAFGPAVASGLICGDGIWTLP 
Sbjct  637  PLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKAKADAFGPAVASGLICGDGIWTLPQ  696

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD+FL
Sbjct  697  SILALAKVKPPICMKFLSRAANAKVDSFL  725



>ref|XP_010551578.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X1 [Tarenaya hassleriana]
Length=686

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++GS YPAP A V+RNM+ILGVEGFS LPK+CL LCYIFF G+  +NG+RD VG KW+RF
Sbjct  534  QSGSAYPAPFALVYRNMSILGVEGFSTLPKHCLMLCYIFFGGSFAVNGLRDAVGPKWSRF  593

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFY+G YFA+DM VG++ILF+W+K+N+  ADAF PAVASGLICGDGIWTLP
Sbjct  594  IPLPMAMAIPFYLGGYFAVDMCVGSLILFIWRKVNKPNADAFSPAVASGLICGDGIWTLP  653

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            +SILALAGVKPPICMKFLS  DN RVD FL+
Sbjct  654  NSILALAGVKPPICMKFLSSSDNVRVDDFLN  684



>gb|EAY86805.1| hypothetical protein OsI_08181 [Oryza sativa Indica Group]
Length=771

 Score =   247 bits (630),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GF++LP+NCLTLCYIFF  AI IN +RD    K +RFI
Sbjct  621  SGTEYPAPYAIVYRNMAILGVDGFNSLPENCLTLCYIFFAAAIAINLIRDLAPHKVSRFI  680

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G+VILFVW+K+N+AKADAFGPAVASGLICGDGIWTLP 
Sbjct  681  PLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKAKADAFGPAVASGLICGDGIWTLPQ  740

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD+FL
Sbjct  741  SILALAKVKPPICMKFLSRAANAKVDSFL  769



>ref|NP_001185468.1| yellow stripe-like transporter 12 [Zea mays]
 gb|ADO20999.1| yellow stripe-like transporter 12 [Zea mays]
 gb|AFW58896.1| hypothetical protein ZEAMMB73_279911 [Zea mays]
Length=718

 Score =   246 bits (628),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAP A V+RNMAILGV+GFS+LPKNCLTLCYIFF  AIV+N VRD V KK ARFI
Sbjct  568  SGSEYPAPYAIVYRNMAILGVDGFSSLPKNCLTLCYIFFAAAIVVNLVRDLVPKKVARFI  627

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFY+GS+FAIDMF+GTVILF W+ IN+AKA+AF PAVASGLICGDGIWTLP 
Sbjct  628  PLPMAMAIPFYLGSFFAIDMFIGTVILFAWETINKAKANAFAPAVASGLICGDGIWTLPQ  687

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD FL
Sbjct  688  SILALAKVKPPICMKFLSRSVNAQVDGFL  716



>ref|XP_010551587.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Tarenaya hassleriana]
Length=694

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++GS YPAP A V+RNM+ILGVEGFS LPK+CL LCYIFF G+  +NG+RD VG KW+RF
Sbjct  542  QSGSAYPAPFALVYRNMSILGVEGFSTLPKHCLMLCYIFFGGSFAVNGLRDAVGPKWSRF  601

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFY+G YFA+DM VG++ILF+W+K+N+  ADAF PAVASGLICGDGIWTLP
Sbjct  602  IPLPMAMAIPFYLGGYFAVDMCVGSLILFIWRKVNKPNADAFSPAVASGLICGDGIWTLP  661

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            +SILALAGVKPPICMKFLS  DN RVD FL+
Sbjct  662  NSILALAGVKPPICMKFLSSSDNVRVDDFLN  692



>ref|XP_010511122.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Camelina 
sativa]
Length=691

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + G+ YPAP A V+RNM+ILGVEGFSALPK+CL LCYIFF  A+++NGVRD VG KWARF
Sbjct  539  QVGTAYPAPYALVYRNMSILGVEGFSALPKHCLMLCYIFFAAAVIVNGVRDAVGPKWARF  598

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILF+W+K+N+ KADA+  AVASGLICG+GIWTLP
Sbjct  599  IPLPMAMAIPFYIGGYFTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLP  658

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             SILALAGVKPPICMKFLS   N +VD+FL P
Sbjct  659  SSILALAGVKPPICMKFLSSSTNMKVDSFLSP  690



>ref|XP_008801345.1| PREDICTED: probable metal-nicotianamine transporter YSL12 isoform 
X1 [Phoenix dactylifera]
Length=729

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+RNMAILGVEGFS+LPK+CLTLCYIFF  AIVIN +RD  GKK ARFIPL
Sbjct  579  SEYPAPYALVYRNMAILGVEGFSSLPKHCLTLCYIFFAAAIVINLLRDFSGKKIARFIPL  638

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIGSYFAIDM VG++ILFVW+ +N+AKADAF PAVASGLICGDGIWTLP SI
Sbjct  639  PMAMAIPFYIGSYFAIDMCVGSLILFVWETVNKAKADAFAPAVASGLICGDGIWTLPQSI  698

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALA VKPPICMKFLSRK N +VD F+
Sbjct  699  LALAKVKPPICMKFLSRKVNVKVDEFI  725



>ref|XP_010037026.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48663.1| hypothetical protein EUGRSUZ_K02319 [Eucalyptus grandis]
Length=714

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP P   V+R+MA LGVEGFS+LPK+CL LCY FF  A++ING RD VGKKWARFIP
Sbjct  565  GSEYPVPFGTVYRSMAELGVEGFSSLPKHCLMLCYGFFAAAMIINGFRDLVGKKWARFIP  624

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG YFAIDM VG++ILF+W+KIN+ KADAFGPAVASGLICGDGIWTLP S
Sbjct  625  LPMAMAIPFYIGPYFAIDMCVGSLILFIWEKINKTKADAFGPAVASGLICGDGIWTLPSS  684

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGV PPICMKFLSR  N RVD FL
Sbjct  685  ILALAGVNPPICMKFLSRAANKRVDAFL  712



>ref|XP_002452492.1| hypothetical protein SORBIDRAFT_04g026840 [Sorghum bicolor]
 gb|EES05468.1| hypothetical protein SORBIDRAFT_04g026840 [Sorghum bicolor]
Length=728

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++G+EYPAP A V+RNMAILGV+GF +LP+NCLTLCYIFF  AIVIN VRD   ++ +RF
Sbjct  576  ESGTEYPAPYAIVYRNMAILGVDGFRSLPENCLTLCYIFFAAAIVINLVRDLTPQRVSRF  635

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIGSYFAIDMF+G VILFVW+++N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  636  IPLPMAMAIPFYIGSYFAIDMFLGCVILFVWEQLNKAKADAFGPAVASGLICGDGIWTLP  695

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALA V+PPICMKFLSR  N +VD+FL
Sbjct  696  QSILALAKVQPPICMKFLSRSTNAKVDSFL  725



>ref|XP_008676713.1| PREDICTED: uncharacterized protein LOC100272237 isoform X1 [Zea 
mays]
 gb|ACN34648.1| unknown [Zea mays]
 gb|ADG21035.1| oligopeptide transporter [Zea mays]
 gb|ADO21000.1| yellow stripe-like transporter 14A [Zea mays]
 gb|AFW63091.1| transposon protein [Zea mays]
Length=716

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++G+EYPAP A V+RNMAILGV+GF +LPKNCLTLCYIFF  AI IN VRD    K +RF
Sbjct  564  ESGTEYPAPYAIVYRNMAILGVDGFGSLPKNCLTLCYIFFAAAITINLVRDLTPYKVSRF  623

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIGSYFAIDMF+G+ ILFVW+++N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  624  IPLPMAMAIPFYIGSYFAIDMFLGSAILFVWERLNKAKADAFGPAVASGLICGDGIWTLP  683

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALA V+PPICMKFLSR  N +VD+FL
Sbjct  684  QSILALAKVQPPICMKFLSRSTNAKVDSFL  713



>emb|CAN70906.1| hypothetical protein VITISV_043868 [Vitis vinifera]
Length=697

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAPNA V+RNM++LGVEGF +LP +CLTLCYI F G+IVIN +RD V KKWA++IPL
Sbjct  549  SDYPAPNALVYRNMSVLGVEGFGSLPDHCLTLCYILFAGSIVINLIRDTVAKKWAKYIPL  608

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W K+++AKADAFGPAVASGLICGDGIW+LP SI
Sbjct  609  PMAMAIPFYLGPYFAIDMCVGSLILFIWGKLDKAKADAFGPAVASGLICGDGIWSLPSSI  668

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLHP  239
            LALAGV+PPICMKFLSR  N RVD FL P
Sbjct  669  LALAGVQPPICMKFLSRGTNARVDQFLSP  697



>ref|XP_002277292.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=713

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAPNA V+RNM++LGVEGF +LP +CLTLCYI F G+IVIN +RD V KKWA++IPL
Sbjct  565  SDYPAPNALVYRNMSVLGVEGFGSLPDHCLTLCYILFAGSIVINLIRDTVAKKWAKYIPL  624

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W K+++AKADAFGPAVASGLICGDGIW+LP SI
Sbjct  625  PMAMAIPFYLGPYFAIDMCVGSLILFIWGKLDKAKADAFGPAVASGLICGDGIWSLPSSI  684

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLHP  239
            LALAGV+PPICMKFLSR  N RVD FL P
Sbjct  685  LALAGVQPPICMKFLSRGTNARVDQFLSP  713



>emb|CDO98563.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            G+ YPAP A V+ NMA LGVEGFSALPKNCL LCY FF  +I+IN +RD VGKK  R+IP
Sbjct  478  GTTYPAPFATVYYNMAKLGVEGFSALPKNCLKLCYAFFCASILINMIRDAVGKKRGRYIP  537

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM VG++IL++WQ+INRAKADAF PAVASGLICGDGIWTLP+S
Sbjct  538  LPMAMAIPFYLGSYFAIDMCVGSLILYIWQRINRAKADAFAPAVASGLICGDGIWTLPNS  597

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
            ILALAGVKPPICMKFLS+  N+RVD FL P
Sbjct  598  ILALAGVKPPICMKFLSKGTNSRVDKFLAP  627



>ref|XP_002449540.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor]
 gb|EES08528.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor]
Length=722

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAPNA VFR+MA+LGV+GFS+LPK+CLTLCY+FF  AIVIN +RD V KK +RFIP
Sbjct  573  GSEYPAPNAVVFRSMAVLGVDGFSSLPKHCLTLCYVFFAAAIVINLIRDLVPKKVSRFIP  632

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFYIG+YFA+DMFVGTVILFVWQ+++RAKADAF PAVASG+ICGDGIW LP S
Sbjct  633  IPMAMAIPFYIGAYFAVDMFVGTVILFVWQRLDRAKADAFAPAVASGMICGDGIWVLPQS  692

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALA VKPPICM+FLSR  N +VD FL
Sbjct  693  VLALAKVKPPICMRFLSRAMNDKVDAFL  720



>ref|XP_006391519.1| hypothetical protein EUTSA_v10018216mg [Eutrema salsugineum]
 gb|ESQ28805.1| hypothetical protein EUTSA_v10018216mg [Eutrema salsugineum]
Length=691

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +TG+ YPAP A V+RNM+ILGVEGFSALPK+CL LCYIFF  A+++NGVRD VG +WARF
Sbjct  539  QTGTAYPAPYALVYRNMSILGVEGFSALPKHCLMLCYIFFAAAVIVNGVRDLVGPRWARF  598

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILF+W+K+N+ KADA+  AVASGLICG+GIWTLP
Sbjct  599  IPLPMAMAIPFYIGGYFTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLP  658

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             SILALAGVKPPICMKFLS   N +VD+FL+P
Sbjct  659  SSILALAGVKPPICMKFLSGSTNLKVDSFLNP  690



>ref|XP_004500424.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cicer arietinum]
Length=670

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A V+RNMAILGV+GFSALPKNCL LC +FFVGA++IN VRD  GKKWA+FIP
Sbjct  521  GSAYPAPYALVYRNMAILGVDGFSALPKNCLVLCCVFFVGAMIINLVRDLAGKKWAKFIP  580

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFYIGSYFAIDM VG++ILF+WQ++++AKADAFG AVASGLICGDGIW+LP S
Sbjct  581  VPMAMAIPFYIGSYFAIDMCVGSLILFIWQRVDKAKADAFGSAVASGLICGDGIWSLPSS  640

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
             LALAGV+PPICMKFLSR  N +VD FL
Sbjct  641  FLALAGVQPPICMKFLSRAANAKVDAFL  668



>ref|XP_006372618.1| hypothetical protein POPTR_0017s03290g [Populus trichocarpa]
 gb|ERP50415.1| hypothetical protein POPTR_0017s03290g [Populus trichocarpa]
Length=509

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A V+RNMAILGV+GFS+LPKNCL LCY FF  AI+ N ++D  GKKWARFIP
Sbjct  360  GSQYPAPYATVYRNMAILGVDGFSSLPKNCLYLCYGFFGAAILKNLIKDAGGKKWARFIP  419

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIG+YFAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWTLP +
Sbjct  420  NPMAMAIPFYIGAYFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSA  479

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILAL GVKPPICMKFLSR  N +VD FL
Sbjct  480  ILALVGVKPPICMKFLSRGTNAKVDAFL  507



>ref|XP_008669136.1| PREDICTED: probable metal-nicotianamine transporter YSL13 [Zea 
mays]
 tpg|DAA36870.1| TPA: hypothetical protein ZEAMMB73_694828 [Zea mays]
Length=725

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAPNA VFR+MA+LGV+GFS+LP+NCLTLCY+FF  AIVIN +RD V KK +RFIP
Sbjct  576  GSEYPAPNAVVFRSMAVLGVDGFSSLPENCLTLCYVFFAAAIVINLIRDLVPKKVSRFIP  635

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFYIG+YFA+DMFVGTVILFVWQ+++RAKAD F PA+ASG+ICGDGIW LP S
Sbjct  636  IPMAMAIPFYIGAYFAVDMFVGTVILFVWQRLDRAKADTFAPAIASGMICGDGIWVLPQS  695

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALA VKPPICMKFLSR  N +VD FL
Sbjct  696  VLALAKVKPPICMKFLSRAMNDKVDVFL  723



>ref|XP_009105166.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Brassica 
rapa]
 emb|CDY07462.1| BnaA07g25410D [Brassica napus]
Length=690

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +TG+ YPAP A V+RNM+ILGVEGFSALP++CL +CYIFF  A+ +NGVRD VG KW+RF
Sbjct  538  QTGTAYPAPYALVYRNMSILGVEGFSALPQHCLMICYIFFAAAVFVNGVRDAVGPKWSRF  597

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILFVW+K+NR KADA+  AVASGLICG+GIWTLP
Sbjct  598  IPLPMAMAIPFYIGGYFTIDMCVGSLILFVWRKLNRPKADAYSSAVASGLICGEGIWTLP  657

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             S+LALAGVKPPICMKFLS   N +VD+FL+P
Sbjct  658  SSVLALAGVKPPICMKFLSGATNVKVDSFLNP  689



>ref|XP_006441428.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
 gb|ESR54668.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
Length=508

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEY AP A V+R+MA LGVEGFSALPKNCL LCY+ F  AIVIN +RD + K+WARFIP
Sbjct  359  GSEYAAPFAMVYRSMAKLGVEGFSALPKNCLLLCYVHFGAAIVINLIRDSIRKEWARFIP  418

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YFAIDM VG+++LF+W+KI++AKADAFGPAVASGLICGDGIWTLP S
Sbjct  419  LPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSS  478

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALA V+PPICMKFLSR+ N RVD FL
Sbjct  479  ILALAKVQPPICMKFLSRRTNARVDKFL  506



>ref|XP_006372356.1| hypothetical protein POPTR_0017s00820g [Populus trichocarpa]
 gb|ERP50153.1| hypothetical protein POPTR_0017s00820g [Populus trichocarpa]
Length=619

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +GKK ARFIP
Sbjct  470  GSQYPAPYATVFRNMAILGVEGFSSLPKNCLYLCYWFFAAAILINLIKDVLGKKRARFIP  529

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIG+YFAIDM VG++ILF+W  I++AKADAFGPAVASGLICGDGIWTLP S
Sbjct  530  NPMAMAIPFYIGTYFAIDMCVGSLILFIWGNIDKAKADAFGPAVASGLICGDGIWTLPSS  589

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVKPPICMKFLSR+ N +VD FL
Sbjct  590  ILALAGVKPPICMKFLSRRTNAKVDAFL  617



>ref|NP_001053351.1| Os04g0524600 [Oryza sativa Japonica Group]
 dbj|BAF15265.1| Os04g0524600 [Oryza sativa Japonica Group]
 gb|EEE61366.1| hypothetical protein OsJ_15514 [Oryza sativa Japonica Group]
Length=576

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GFS+LPK+CLTLCYIFF  AI IN  RD    K ARFI
Sbjct  426  SGTEYPAPYAIVYRNMAILGVDGFSSLPKHCLTLCYIFFAAAIAINLARDLAPSKVARFI  485

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+GTVILFVW+ +N+AKA+AF PAVASGLICGDGIWTLP 
Sbjct  486  PLPMAMAIPFYIGSYFAIDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLPQ  545

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD FL
Sbjct  546  SILALAKVKPPICMKFLSRSVNAQVDGFL  574



>gb|EEC77667.1| hypothetical protein OsI_16700 [Oryza sativa Indica Group]
Length=576

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GFS+LPK+CLTLCYIFF  AI IN  RD    K ARFI
Sbjct  426  SGTEYPAPYAIVYRNMAILGVDGFSSLPKHCLTLCYIFFAAAIAINLARDLAPSKVARFI  485

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+GTVILFVW+ +N+AKA+AF PAVASGLICGDGIWTLP 
Sbjct  486  PLPMAMAIPFYIGSYFAIDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLPQ  545

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD FL
Sbjct  546  SILALAKVKPPICMKFLSRSVNAQVDGFL  574



>gb|ACD77012.1| metal transporter protein [Brassica juncea]
Length=689

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +TG+ YPAP A V+RNM+ILGVEGFSALP++CL +CYIFF  A+ +NGVRD VG KW+RF
Sbjct  537  QTGTAYPAPYALVYRNMSILGVEGFSALPQHCLMICYIFFAAAVFVNGVRDAVGPKWSRF  596

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILFVW+K+NR KADA+  AVASGLICG+GIWTLP
Sbjct  597  IPLPMAMAIPFYIGGYFTIDMCVGSLILFVWRKLNRPKADAYSSAVASGLICGEGIWTLP  656

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             S+LALAGVKPPICMKFLS   N +VD+FL+P
Sbjct  657  SSVLALAGVKPPICMKFLSGATNVKVDSFLNP  688



>ref|XP_006648859.1| PREDICTED: probable metal-nicotianamine transporter YSL14-like, 
partial [Oryza brachyantha]
Length=694

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GF +LP+NCLTLCYIFF  AI IN +RD    K +RFI
Sbjct  544  SGTEYPAPYAIVYRNMAILGVDGFDSLPENCLTLCYIFFAAAIAINLIRDLAPHKVSRFI  603

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G++ILFVW+K+N+ KADAFGPAVASGLICGDGIWTLP 
Sbjct  604  PLPMAMAIPFYIGSYFAIDMFLGSLILFVWEKLNKTKADAFGPAVASGLICGDGIWTLPQ  663

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD+FL
Sbjct  664  SILALAKVKPPICMKFLSRAANAKVDSFL  692



>ref|XP_006300806.1| hypothetical protein CARUB_v10019889mg [Capsella rubella]
 gb|EOA33704.1| hypothetical protein CARUB_v10019889mg [Capsella rubella]
Length=694

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +  S YPAP AAV+RNM+ILGVEGFSALPK+CL LCYIFF  A+++NGVRD VG KWARF
Sbjct  543  QQESAYPAPYAAVYRNMSILGVEGFSALPKHCLVLCYIFFAAAVIVNGVRDAVGSKWARF  602

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILF+W+K+N+ KADA+  AVASGLICG+GIWTLP
Sbjct  603  IPLPMAMAIPFYIGGYFTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLP  662

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLH  242
             S+LALAGVKPPICMKFLS   N +VD+FL 
Sbjct  663  SSVLALAGVKPPICMKFLSSSANKKVDSFLR  693



>ref|XP_011046075.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X5 [Populus euphratica]
Length=699

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +G+KWARFIP
Sbjct  550  GSQYPAPYATVFRNMAILGVEGFSSLPKNCLYLCYGFFGAAILINLIKDALGRKWARFIP  609

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAI FY+GSYFAID  VG++ILF+W+KI++AKADAFGP VASGLICGDGIWTLP S
Sbjct  610  YPMAMAISFYVGSYFAIDACVGSLILFIWEKIDKAKADAFGPVVASGLICGDGIWTLPSS  669

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAG+KPPICMKFLSR  NT+VD FL
Sbjct  670  MLALAGIKPPICMKFLSRGTNTKVDAFL  697



>gb|ABB76761.1| YSL transporter 1 [Noccaea caerulescens]
 gb|ABD04076.1| YSL transporter 1 [Noccaea caerulescens]
Length=693

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +TG+ YPAP A V+RNM+ILGVEGFSALPK+CL LCY+FF  A+ +NGVRD VG KWARF
Sbjct  541  QTGTAYPAPYALVYRNMSILGVEGFSALPKHCLMLCYVFFAAAVFVNGVRDLVGPKWARF  600

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILF+W+K+N+ KADA+  AVASGLICG+GIWTLP
Sbjct  601  IPLPMAMAIPFYIGGYFTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLP  660

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             SILALAGVKPPICMKFLS   N +VD+FL+P
Sbjct  661  SSILALAGVKPPICMKFLSGATNVKVDSFLNP  692



>ref|XP_004953195.1| PREDICTED: probable metal-nicotianamine transporter YSL14-like 
[Setaria italica]
Length=724

 Score =   244 bits (622),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++G+EYPAP A V+RNMAILGV+GF +LPKNCLTLCYIFF  AI IN VRD    + +RF
Sbjct  572  ESGTEYPAPYAIVYRNMAILGVDGFGSLPKNCLTLCYIFFAAAIAINLVRDLTPNRVSRF  631

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIGSYFAIDMF+G  ILFVW+++N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  632  IPLPMAMAIPFYIGSYFAIDMFLGCAILFVWERLNKAKADAFGPAVASGLICGDGIWTLP  691

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALA VKPPICMKFLSR  N +VD+FL
Sbjct  692  QSILALAKVKPPICMKFLSRATNAKVDSFL  721



>ref|XP_003581442.1| PREDICTED: probable metal-nicotianamine transporter YSL13 [Brachypodium 
distachyon]
Length=724

 Score =   244 bits (622),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAPNAA+FR+MAILGV+GFS+LPKNCLTLCYIFF  A+ IN +RD V KK +RFI
Sbjct  572  SGSEYPAPNAAIFRSMAILGVDGFSSLPKNCLTLCYIFFAAAVAINLIRDLVPKKVSRFI  631

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFY+GSYFAIDMF+GTVILFVWQ+++RAK++ F PAVASGLICGDG+W LP 
Sbjct  632  PIPMAMAIPFYLGSYFAIDMFLGTVILFVWQRLDRAKSETFAPAVASGLICGDGLWVLPQ  691

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            S+LALA VKPPICMKFL+R  N +VD F+ 
Sbjct  692  SVLALAKVKPPICMKFLARGMNEKVDAFIQ  721



>emb|CAI44637.1| OSJNBb0065J09.17 [Oryza sativa Japonica Group]
Length=672

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GFS+LPK+CLTLCYIFF  AI IN  RD    K ARFI
Sbjct  522  SGTEYPAPYAIVYRNMAILGVDGFSSLPKHCLTLCYIFFAAAIAINLARDLAPSKVARFI  581

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+GTVILFVW+ +N+AKA+AF PAVASGLICGDGIWTLP 
Sbjct  582  PLPMAMAIPFYIGSYFAIDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLPQ  641

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD FL
Sbjct  642  SILALAKVKPPICMKFLSRSVNAQVDGFL  670



>ref|XP_011046074.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X4 [Populus euphratica]
Length=700

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +GKK AR IP
Sbjct  549  GSEYPAPYATVFRNMAILGVEGFSSLPKNCLYLCYWFFGAAILINLIKDVLGKKRARLIP  608

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM +G++ILF+W+ I++AKADAFGPAVASGLICGDGIWTLP S
Sbjct  609  NPMAMAIPFYIGSYFAIDMCIGSLILFIWENIDKAKADAFGPAVASGLICGDGIWTLPSS  668

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVKPPICMKFLSR+ N +VD FL
Sbjct  669  ILALAGVKPPICMKFLSRRTNAKVDAFL  696



>ref|XP_010470452.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Camelina 
sativa]
Length=692

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + G+ YPAP A V+RNM+ILGV GFSALPK+CL LCYIFF  A+++NGVRD VG KWARF
Sbjct  540  QNGTAYPAPYALVYRNMSILGVAGFSALPKHCLMLCYIFFAAAVIVNGVRDAVGPKWARF  599

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILF+W+K+N+ KADA+  AVASGLICG+GIWTLP
Sbjct  600  IPLPMAMAIPFYIGGYFTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLP  659

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             S+LALAGVKPPICMKFLS   N +VD+FL+P
Sbjct  660  SSVLALAGVKPPICMKFLSSSTNMKVDSFLNP  691



>ref|NP_001152285.1| yellow stripe-like transporter 14A [Zea mays]
 gb|ACG46801.1| transposon protein [Zea mays]
Length=716

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++G+EYPAP A V+RNMAILGV+GF +LPKNCL LCYIFF  AI IN VRD    K +RF
Sbjct  564  ESGTEYPAPYAIVYRNMAILGVDGFGSLPKNCLILCYIFFAAAITINLVRDLTPYKVSRF  623

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIGSYFAIDMF+G+ ILFVW+++N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  624  IPLPMAMAIPFYIGSYFAIDMFLGSAILFVWERLNKAKADAFGPAVASGLICGDGIWTLP  683

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALA V+PPICMKFLSR  N +VD+FL
Sbjct  684  QSILALAKVQPPICMKFLSRSTNAKVDSFL  713



>ref|XP_010069525.1| PREDICTED: probable metal-nicotianamine transporter YSL5 [Eucalyptus 
grandis]
 gb|KCW57905.1| hypothetical protein EUGRSUZ_H00652 [Eucalyptus grandis]
Length=698

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A ++R+MAILGVEGFS+LPK+CL+LCY FF  +IVIN +RD V KK++RFIPL
Sbjct  550  SAYPAPYANIYRSMAILGVEGFSSLPKHCLSLCYGFFAASIVINAIRDAVPKKYSRFIPL  609

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM VG++IL+VW++IN+AKADAFGPAVASGLICGDGIWTLP SI
Sbjct  610  PMAMAIPFYLGSYFAIDMCVGSLILYVWERINKAKADAFGPAVASGLICGDGIWTLPSSI  669

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LAL GVKPPICMKFLSR  N RVD FL
Sbjct  670  LALVGVKPPICMKFLSRAANARVDNFL  696



>dbj|BAJ89062.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GF+ LP NC+TLCYIFF  AI IN +RD    K++RFI
Sbjct  561  SGTEYPAPYAIVYRNMAILGVDGFNTLPANCMTLCYIFFAAAIAINLIRDLTPHKFSRFI  620

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G+ ILFVW+K+N+AKADAFGPAVASGLICGDGIWTLP 
Sbjct  621  PLPMAMAIPFYIGSYFAIDMFLGSFILFVWEKVNKAKADAFGPAVASGLICGDGIWTLPQ  680

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA V PPICMKFL+R DN +VD FL
Sbjct  681  SILALAKVNPPICMKFLTRGDNVKVDKFL  709



>ref|XP_011046072.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X2 [Populus euphratica]
Length=701

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +GKK AR IP
Sbjct  550  GSEYPAPYATVFRNMAILGVEGFSSLPKNCLYLCYWFFGAAILINLIKDVLGKKRARLIP  609

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM +G++ILF+W+ I++AKADAFGPAVASGLICGDGIWTLP S
Sbjct  610  NPMAMAIPFYIGSYFAIDMCIGSLILFIWENIDKAKADAFGPAVASGLICGDGIWTLPSS  669

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVKPPICMKFLSR+ N +VD FL
Sbjct  670  ILALAGVKPPICMKFLSRRTNAKVDAFL  697



>dbj|BAJ92335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GF+ LP NC+TLCYIFF  AI IN +RD    K++RFI
Sbjct  561  SGTEYPAPYAIVYRNMAILGVDGFNTLPANCMTLCYIFFAAAIAINLIRDLTPHKFSRFI  620

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+G+ ILFVW+K+N+AKADAFGPAVASGLICGDGIWTLP 
Sbjct  621  PLPMAMAIPFYIGSYFAIDMFLGSFILFVWEKVNKAKADAFGPAVASGLICGDGIWTLPQ  680

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA V PPICMKFL+R DN +VD FL
Sbjct  681  SILALAKVNPPICMKFLTRGDNVKVDKFL  709



>ref|XP_011046073.1| PREDICTED: probable metal-nicotianamine transporter YSL7 isoform 
X3 [Populus euphratica]
Length=700

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +GKK AR IP
Sbjct  549  GSEYPAPYATVFRNMAILGVEGFSSLPKNCLYLCYWFFGAAILINLIKDVLGKKRARLIP  608

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PMAMAIPFYIGSYFAIDM +G++ILF+W+ I++AKADAFGPAVASGLICGDGIWTLP S
Sbjct  609  NPMAMAIPFYIGSYFAIDMCIGSLILFIWENIDKAKADAFGPAVASGLICGDGIWTLPSS  668

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVKPPICMKFLSR+ N +VD FL
Sbjct  669  ILALAGVKPPICMKFLSRRTNAKVDAFL  696



>gb|KDO46151.1| hypothetical protein CISIN_1g005295mg [Citrus sinensis]
Length=553

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEY AP A V+RNMA LGVEGFSALPKNCL LCY+ F  AIVIN +RD + K+WARFIP
Sbjct  404  GSEYAAPFAMVYRNMAKLGVEGFSALPKNCLLLCYVLFGAAIVINLIRDSIRKEWARFIP  463

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YFAIDM VG+++LF+W+KI++AKADAFGPAVASGLICGDGIW+LP S
Sbjct  464  LPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSS  523

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALA V+PP+CMKFLSR+ N RVD FL
Sbjct  524  ILALAKVQPPMCMKFLSRRTNARVDKFL  551



>ref|XP_010039025.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48662.1| hypothetical protein EUGRSUZ_K02318 [Eucalyptus grandis]
Length=707

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP PN  V+R++A LGVEGFS+LPK+CLTLCY FF  A++ING RD +GKKWARFIP
Sbjct  558  GSEYPVPNGIVYRSIAELGVEGFSSLPKHCLTLCYCFFAAAVIINGFRDLLGKKWARFIP  617

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPF+IG +FAIDM VG++ILF+W+KI++AKADAFGPAVASGLICGDGIWT+  S
Sbjct  618  LPMAMAIPFFIGPFFAIDMCVGSLILFIWEKIDKAKADAFGPAVASGLICGDGIWTMASS  677

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILALAG+ PPICMKFLSR  N RVDTFL 
Sbjct  678  ILALAGINPPICMKFLSRAMNKRVDTFLR  706



>ref|XP_009413131.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=688

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A ++RNMAILGV+GFS+LPK+CLTLCYIFF  AI IN  RD   KK ARFIP
Sbjct  537  GSEYPAPYAIIYRNMAILGVDGFSSLPKHCLTLCYIFFALAIAINLARDLSPKKVARFIP  596

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFYIGSYFAIDMFVG+VILFVW+++N+AKADAFGPAVASGLICGDGIWTLP +
Sbjct  597  IPMAMAIPFYIGSYFAIDMFVGSVILFVWEQLNKAKADAFGPAVASGLICGDGIWTLPQA  656

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALA VKPPICMKFLSRK N +VD ++
Sbjct  657  VLALAQVKPPICMKFLSRKMNDKVDVYI  684



>ref|XP_008645969.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Zea 
mays]
 gb|AFW72448.1| hypothetical protein ZEAMMB73_917654 [Zea mays]
Length=721

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++G+EYPAP A V+RNMAILGV+GF +LP+NCLTLCYIFF  AI IN  RD    + +RF
Sbjct  569  ESGTEYPAPYAIVYRNMAILGVDGFGSLPENCLTLCYIFFAAAIAINLARDLTPHRVSRF  628

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIGSYFAIDMF+G++ILFVW+++N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  629  IPLPMAMAIPFYIGSYFAIDMFLGSMILFVWERLNKAKADAFGPAVASGLICGDGIWTLP  688

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALA V+PPICMKFLSR  N +VD+FL
Sbjct  689  QSILALAKVQPPICMKFLSRSTNAKVDSFL  718



>sp|Q5JQD7.2|YSL12_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL12; 
AltName: Full=Protein YELLOW STRIPE LIKE 12; Short=OsYSL12 
[Oryza sativa Japonica Group]
 emb|CAH67886.1| OSIGBa0153E02-OSIGBa0093I20.15 [Oryza sativa Indica Group]
Length=717

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GFS+LPK+CLTLCYIFF  AI IN  RD    K ARFI
Sbjct  567  SGTEYPAPYAIVYRNMAILGVDGFSSLPKHCLTLCYIFFAAAIAINLARDLAPSKVARFI  626

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+GTVILFVW+ +N+AKA+AF PAVASGLICGDGIWTLP 
Sbjct  627  PLPMAMAIPFYIGSYFAIDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLPQ  686

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD FL
Sbjct  687  SILALAKVKPPICMKFLSRSVNAQVDGFL  715



>gb|KJB75155.1| hypothetical protein B456_012G027400 [Gossypium raimondii]
Length=690

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNMAILGV+GFSALPKNCL LCY FF  AI+IN ++D +GKKW  FIPL
Sbjct  542  SQYPAPFAIVYRNMAILGVQGFSALPKNCLLLCYGFFGAAILINLMKDMMGKKWGSFIPL  601

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YFAIDM +G++ILFVW+K+N+AKADAF PAVASGLICGDGIWTLP SI
Sbjct  602  PMAMAIPFYIGPYFAIDMCIGSLILFVWEKLNKAKADAFAPAVASGLICGDGIWTLPSSI  661

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICMKFLSR  N +VDTFL
Sbjct  662  LALAGVKPPICMKFLSRATNAKVDTFL  688



>ref|XP_002886962.1| hypothetical protein ARALYDRAFT_475677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63221.1| hypothetical protein ARALYDRAFT_475677 [Arabidopsis lyrata subsp. 
lyrata]
Length=693

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +TG+ YPAP A V+RNM+ILGVEGFSALPK+CL LCYIFF  A+++NGVRD VG +WARF
Sbjct  541  QTGTAYPAPYALVYRNMSILGVEGFSALPKHCLMLCYIFFAAAVIVNGVRDAVGPRWARF  600

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILF+W+K+N+ KADA+  AVASGLICG+GIWTLP
Sbjct  601  IPLPMAMAIPFYIGGYFTIDMCVGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLP  660

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLH  242
             SILALAGVKPPICMKFLS   N +VD+ L+
Sbjct  661  SSILALAGVKPPICMKFLSTAANLKVDSLLN  691



>dbj|BAE91892.1| hypothetical protein [Oryza sativa Japonica Group]
Length=716

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GFS+LPK+CLTLCYIFF  AI IN  RD    K ARFI
Sbjct  566  SGTEYPAPYAIVYRNMAILGVDGFSSLPKHCLTLCYIFFAAAIAINLARDLAPSKVARFI  625

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+GTVILFVW+ +N+AKA+AF PAVASGLICGDGIWTLP 
Sbjct  626  PLPMAMAIPFYIGSYFAIDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLPQ  685

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD FL
Sbjct  686  SILALAKVKPPICMKFLSRSVNAQVDGFL  714



>ref|NP_001053350.1| Os04g0524500 [Oryza sativa Japonica Group]
 dbj|BAF15264.1| Os04g0524500, partial [Oryza sativa Japonica Group]
Length=629

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+YPAPNAAVFR++AILGV+GFS+LPKNCL LCY FF  AIV+N +RD V K  +RFI
Sbjct  477  SGSDYPAPNAAVFRSIAILGVDGFSSLPKNCLNLCYAFFAAAIVVNLIRDLVPKV-SRFI  535

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFYIGSYFAIDMF+GTVILFVWQ+++RAKAD +GPAVASG+ICGDGIW LP 
Sbjct  536  PIPMAMAIPFYIGSYFAIDMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGIWVLPQ  595

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALA VKPPICMKFLSR+ N +VD FL
Sbjct  596  SVLALAKVKPPICMKFLSRRTNDKVDAFL  624



>ref|XP_010940334.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=709

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+GFS+LPK+CLTLCYIFF  AI+IN +RD VGKK ARFIP
Sbjct  558  GSEYPSPNALVYRNMAILGVDGFSSLPKHCLTLCYIFFGAAILINLLRDVVGKKVARFIP  617

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM VG++ILFVW+ I++AKA  FGPAVASGLICGDGIWTLP S
Sbjct  618  LPMAMAIPFYLGSYFAIDMCVGSLILFVWELIDKAKAATFGPAVASGLICGDGIWTLPQS  677

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LAL  VKPPICMKFLSR  N +VDT++
Sbjct  678  VLALVQVKPPICMKFLSRSMNAKVDTYI  705



>gb|KCW48665.1| hypothetical protein EUGRSUZ_K02320 [Eucalyptus grandis]
Length=456

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP P   V+R+MA LGVEGFS+LPK+CLTLCY FF  A++ING RD VGKKWA FIP
Sbjct  307  GSEYPVPYGTVYRSMAELGVEGFSSLPKHCLTLCYGFFAAAMIINGFRDLVGKKWACFIP  366

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG YFAIDM VG++ILF+W+K N+AKADAFGPAVASGLICGDGIWTL  S
Sbjct  367  LPMAMAIPFYIGPYFAIDMCVGSLILFIWEKTNKAKADAFGPAVASGLICGDGIWTLASS  426

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILA+ GV PPICMKFLSR  N  VD FL
Sbjct  427  ILAVVGVNPPICMKFLSRATNKTVDAFL  454



>ref|XP_003580167.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Brachypodium 
distachyon]
Length=717

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAP A V+RNMAILGV+GFS+LPKNCLTLC+IFF  AIVIN  RD    K A+FI
Sbjct  568  SGSEYPAPYAIVYRNMAILGVDGFSSLPKNCLTLCFIFFAAAIVINLARDLAPSKVAKFI  627

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMFVG+VILFVW  +N+AKADAF PAVASGLICGDGIWTLP 
Sbjct  628  PLPMAMAIPFYIGSYFAIDMFVGSVILFVWGIVNKAKADAFAPAVASGLICGDGIWTLPQ  687

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +VD FL
Sbjct  688  SILALAKVKPPICMKFLSRSVNAKVDDFL  716



>ref|XP_006441429.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
 gb|ESR54669.1| hypothetical protein CICLE_v10019091mg [Citrus clementina]
Length=703

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEY AP A V+R+MA LGVEGFSALPKNCL LCY+ F  AIVIN +RD + K+WARFIP
Sbjct  554  GSEYAAPFAMVYRSMAKLGVEGFSALPKNCLLLCYVHFGAAIVINLIRDSIRKEWARFIP  613

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YFAIDM VG+++LF+W+KI++AKADAFGPAVASGLICGDGIWTLP S
Sbjct  614  LPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWTLPSS  673

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALA V+PPICMKFLSR+ N RVD FL
Sbjct  674  ILALAKVQPPICMKFLSRRTNARVDKFL  701



>ref|XP_006493428.1| PREDICTED: probable metal-nicotianamine transporter YSL5-like 
[Citrus sinensis]
Length=703

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEY AP A V+RNMA LGVEGFSALPKNCL LCY+ F  AIVIN +RD + K+WARFIP
Sbjct  554  GSEYAAPFAMVYRNMAKLGVEGFSALPKNCLLLCYVLFGAAIVINLIRDSIRKEWARFIP  613

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YFAIDM VG+++LF+W+KI++AKADAFGPAVASGLICGDGIW+LP S
Sbjct  614  LPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSS  673

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALA V+PP+CMKFLSR+ N RVD FL
Sbjct  674  ILALAKVQPPMCMKFLSRRTNARVDKFL  701



>gb|KDO46150.1| hypothetical protein CISIN_1g005295mg [Citrus sinensis]
Length=703

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEY AP A V+RNMA LGVEGFSALPKNCL LCY+ F  AIVIN +RD + K+WARFIP
Sbjct  554  GSEYAAPFAMVYRNMAKLGVEGFSALPKNCLLLCYVLFGAAIVINLIRDSIRKEWARFIP  613

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YFAIDM VG+++LF+W+KI++AKADAFGPAVASGLICGDGIW+LP S
Sbjct  614  LPMAMAIPFYLGPYFAIDMCVGSLLLFIWEKIDKAKADAFGPAVASGLICGDGIWSLPSS  673

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALA V+PP+CMKFLSR+ N RVD FL
Sbjct  674  ILALAKVQPPMCMKFLSRRTNARVDKFL  701



>ref|XP_011072072.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=697

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+ NMA LGVEGFSALPKNCL LCY+FF  AI+IN +RD +GKK + FIPL
Sbjct  549  SAYPAPFATVYYNMAKLGVEGFSALPKNCLKLCYVFFAAAILINMIRDSLGKKRSWFIPL  608

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM VG++IL++WQK+N+AKADAFGPAVASGLICGDG+WTLP S+
Sbjct  609  PMAMAIPFYLGSYFAIDMCVGSLILYIWQKMNKAKADAFGPAVASGLICGDGMWTLPSSV  668

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICMKF+SR  N+RVD FL
Sbjct  669  LALAGVKPPICMKFISRATNSRVDKFL  695



>ref|XP_010037024.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
 gb|KCW48658.1| hypothetical protein EUGRSUZ_K02315 [Eucalyptus grandis]
Length=713

 Score =   241 bits (614),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YP P   VFR+MA LGVEG S+LPK+CLTLCY FF  A++ING RD VGKKW RFIP
Sbjct  564  GSAYPVPYGIVFRSMAELGVEGVSSLPKHCLTLCYGFFSAAMIINGFRDLVGKKWVRFIP  623

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG YFAIDM VG++ILF+W+KIN+ KADAFGPAVASGLICGDGIWTLP S
Sbjct  624  LPMAMAIPFYIGPYFAIDMCVGSLILFIWEKINKTKADAFGPAVASGLICGDGIWTLPSS  683

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGV PPICMKFLSR  N RVD FL
Sbjct  684  ILALAGVNPPICMKFLSRATNKRVDGFL  711



>ref|XP_004158540.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=706

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GS YPAP A V+RNMA+L VEGFS+LPKNCL+LCY FF  AIVIN +RD  GKK +++
Sbjct  555  QLGSAYPAPYATVYRNMALLAVEGFSSLPKNCLSLCYGFFAAAIVINLIRDLSGKKVSQY  614

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFYIGSYFAIDM +G++ILFVW+KIN+AKADAF PAVASGLICGDGIWTLP
Sbjct  615  IPIPMAMAIPFYIGSYFAIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLP  674

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             SILAL GVKPPICMKFLSR  N +VD FL P
Sbjct  675  SSILALFGVKPPICMKFLSRTTNVKVDKFLTP  706



>ref|XP_004138807.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
 gb|KGN63124.1| hypothetical protein Csa_2G404760 [Cucumis sativus]
Length=706

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GS YPAP A V+RNMA+L VEGFS+LPKNCL+LCY FF  AIVIN +RD  GKK +++
Sbjct  555  QLGSAYPAPYATVYRNMALLAVEGFSSLPKNCLSLCYGFFAAAIVINLIRDLSGKKVSQY  614

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFYIGSYFAIDM +G++ILFVW+KIN+AKADAF PAVASGLICGDGIWTLP
Sbjct  615  IPIPMAMAIPFYIGSYFAIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLP  674

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             SILAL GVKPPICMKFLSR  N +VD FL P
Sbjct  675  SSILALFGVKPPICMKFLSRTTNVKVDKFLTP  706



>emb|CDY39272.1| BnaC06g27190D [Brassica napus]
Length=689

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +TG+ YPAP A V+RNM+ILGVEGFSALP++CL +CYIFF  A+ +NG RD VG  W+RF
Sbjct  537  QTGTAYPAPYALVYRNMSILGVEGFSALPQHCLMICYIFFAAAVFVNGARDAVGPNWSRF  596

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YF IDM VG++ILFVW+K+NR KADA+  AVASGLICG+GIWTLP
Sbjct  597  IPLPMAMAIPFYIGGYFTIDMCVGSLILFVWRKLNRPKADAYSSAVASGLICGEGIWTLP  656

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             S+LALAGVKPPICMKFLS   N +VD+FL+P
Sbjct  657  SSVLALAGVKPPICMKFLSGATNVKVDSFLNP  688



>gb|AFK38640.1| unknown [Medicago truncatula]
Length=172

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNMAILGV+GFS+LP NCL LCYIFF  AIV+N ++D VGK   RFIPL
Sbjct  25   SQYPAPYAIVYRNMAILGVQGFSSLPDNCLLLCYIFFGAAIVVNLIKDLVGKV-GRFIPL  83

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W+K+++AKADAF PAVA GLICGDGIWTLP SI
Sbjct  84   PMAMAIPFYLGPYFAIDMCVGSLILFIWEKVDKAKADAFAPAVAFGLICGDGIWTLPASI  143

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LAL GVKPPICMKFLSR  N RVDTFL
Sbjct  144  LALFGVKPPICMKFLSRSTNDRVDTFL  170



>sp|Q7XKF4.2|YSL13_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL13; 
AltName: Full=Protein YELLOW STRIPE LIKE 13; Short=OsYSL13 
[Oryza sativa Japonica Group]
 emb|CAE05719.2| OSJNBb0065J09.15 [Oryza sativa Japonica Group]
 dbj|BAE44204.1| hypothetical protein [Oryza sativa Japonica Group]
Length=724

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+YPAPNAAVFR++AILGV+GFS+LPKNCL LCY FF  AIV+N +RD V  K +RFI
Sbjct  572  SGSDYPAPNAAVFRSIAILGVDGFSSLPKNCLNLCYAFFAAAIVVNLIRDLV-PKVSRFI  630

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFYIGSYFAIDMF+GTVILFVWQ+++RAKAD +GPAVASG+ICGDGIW LP 
Sbjct  631  PIPMAMAIPFYIGSYFAIDMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGIWVLPQ  690

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALA VKPPICMKFLSR+ N +VD FL
Sbjct  691  SVLALAKVKPPICMKFLSRRTNDKVDAFL  719



>emb|CAH67885.1| OSIGBa0153E02-OSIGBa0093I20.14 [Oryza sativa Indica Group]
 gb|EAY94898.1| hypothetical protein OsI_16698 [Oryza sativa Indica Group]
Length=724

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+YPAPNAAVFR++AILGV+GFS+LPKNCL LCY FF  AIV+N +RD V  K +RFI
Sbjct  572  SGSDYPAPNAAVFRSIAILGVDGFSSLPKNCLNLCYAFFAAAIVVNLIRDLV-PKVSRFI  630

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFYIGSYFAIDMF+GTVILFVWQ+++RAKAD +GPAVASG+ICGDGIW LP 
Sbjct  631  PIPMAMAIPFYIGSYFAIDMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGIWVLPQ  690

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALA VKPPICMKFLSR+ N +VD FL
Sbjct  691  SVLALAKVKPPICMKFLSRRTNDKVDAFL  719



>gb|AET00398.2| OPT family oligopeptide transporter [Medicago truncatula]
Length=682

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GS YPAP A V+RN+AILGV+GFSALPKNCL LC IFF GAI+IN VRD VGKK+A++
Sbjct  531  QPGSAYPAPYALVYRNIAILGVDGFSALPKNCLVLCIIFFTGAIIINFVRDLVGKKYAKY  590

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFYIGSYFAIDM VG++ILF+WQK++RAKADAF  AVASGLICGDGIW+LP
Sbjct  591  IPVPMAMAIPFYIGSYFAIDMCVGSLILFIWQKLDRAKADAFASAVASGLICGDGIWSLP  650

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLH  242
             S LALAGV+PPICMKFLSR  N +VD FL 
Sbjct  651  SSFLALAGVQPPICMKFLSRAANAKVDGFLE  681



>gb|EAZ31384.1| hypothetical protein OsJ_15512 [Oryza sativa Japonica Group]
Length=724

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+YPAPNAAVFR++AILGV+GFS+LPKNCL LCY FF  AIV+N +RD V  K +RFI
Sbjct  572  SGSDYPAPNAAVFRSIAILGVDGFSSLPKNCLNLCYAFFAAAIVVNLIRDLV-PKVSRFI  630

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFYIGSYFAIDMF+GTVILFVWQ+++RAKAD +GPAVASG+ICGDGIW LP 
Sbjct  631  PIPMAMAIPFYIGSYFAIDMFIGTVILFVWQRVDRAKADTYGPAVASGMICGDGIWVLPQ  690

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALA VKPPICMKFLSR+ N +VD FL
Sbjct  691  SVLALAKVKPPICMKFLSRRTNDKVDAFL  719



>emb|CBI35268.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A VFRNMA+LGVEG S LPKNC TLC +FF  AI++N VRD VG+K A+FIP
Sbjct  378  GSEYPAPYALVFRNMAVLGVEGISNLPKNCFTLCCVFFGAAILVNLVRDTVGRKRAQFIP  437

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFY+G YFAIDM VG++ILF+WQ+IN+AKA+AFGPAVASGLICGDG+WTLP S
Sbjct  438  IPMAMAIPFYLGPYFAIDMCVGSLILFIWQRINKAKAEAFGPAVASGLICGDGLWTLPSS  497

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAG+K PICMKFLSR  N RVD FL
Sbjct  498  ILALAGIKQPICMKFLSRATNARVDKFL  525



>ref|XP_006653608.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Oryza brachyantha]
Length=693

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G+EYPAP A V+RNMAILGV+GFS+LPK+CLTLCYIFF  AI IN  RD    K ARFI
Sbjct  543  SGTEYPAPYAIVYRNMAILGVDGFSSLPKHCLTLCYIFFAAAIAINLARDLAPPKVARFI  602

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMF+GTVI+FVW  +NRAKADAF PAVASGLICGDGIWTLP 
Sbjct  603  PLPMAMAIPFYIGSYFAIDMFIGTVIVFVWGMVNRAKADAFAPAVASGLICGDGIWTLPQ  662

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N +V+ FL
Sbjct  663  SILALAKVKPPICMKFLSRSVNAKVNDFL  691



>gb|KEH34582.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=690

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + G+ YPAP A VFRN+AILGV+GFSALPKNCL LC +FF GAI+IN VRD VGKK+++F
Sbjct  539  QPGTAYPAPYALVFRNIAILGVDGFSALPKNCLVLCIVFFFGAIIINFVRDLVGKKYSKF  598

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFYIGSYFAIDM VG++ILF+WQK++RAKADA G AVASGLICGDGIW+LP
Sbjct  599  IPVPMAMAIPFYIGSYFAIDMCVGSLILFIWQKVDRAKADALGSAVASGLICGDGIWSLP  658

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             S LALAGV+PPICMKFLSR  N +VD FL
Sbjct  659  SSFLALAGVQPPICMKFLSRAANAKVDNFL  688



>ref|XP_002269277.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=704

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++GSEYPAP A VFRNMA+LGVEG S LPKNC TLC +FF  AI++N VRD VG+K A+F
Sbjct  553  QSGSEYPAPYALVFRNMAVLGVEGISNLPKNCFTLCCVFFGAAILVNLVRDTVGRKRAQF  612

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFY+G YFAIDM VG++ILF+WQ+IN+AKA+AFGPAVASGLICGDG+WTLP
Sbjct  613  IPIPMAMAIPFYLGPYFAIDMCVGSLILFIWQRINKAKAEAFGPAVASGLICGDGLWTLP  672

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALAG+K PICMKFLSR  N RVD FL
Sbjct  673  SSILALAGIKQPICMKFLSRATNARVDKFL  702



>gb|EMT24509.1| Putative metal-nicotianamine transporter YSL12 [Aegilops tauschii]
Length=723

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAP A V+RNMAILGV+GFS+LPK+CLTLCY+FF GAI+IN VRD V  K A+FI
Sbjct  573  SGSEYPAPYAIVYRNMAILGVDGFSSLPKHCLTLCYVFFAGAILINLVRDLVPAKVAKFI  632

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIGSYFAIDMFVGTVI+FVW  +N+AKADAF P VASGLICGDGIWTLP 
Sbjct  633  PLPMAMAIPFYIGSYFAIDMFVGTVIVFVWGIMNKAKADAFAPGVASGLICGDGIWTLPQ  692

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            SILALA VKPPICMKFLSR  N  VD +L
Sbjct  693  SILALAKVKPPICMKFLSRPVNANVDAYL  721



>gb|ADE77032.1| unknown [Picea sitchensis]
Length=210

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  682  EYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLP  503
            EYPAP A +FRNMAILGVEGF ALPK+CLT+CY FF  AIVIN +RD V KK +++IPLP
Sbjct  62   EYPAPYALIFRNMAILGVEGFGALPKHCLTICYCFFAAAIVINLIRDRVPKKVSQYIPLP  121

Query  502  MAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSIL  323
            MAMAIPFY+G YFAIDM VGT I+FVW+KINR  AD   PAVASGLICGDG+WTLP SIL
Sbjct  122  MAMAIPFYLGGYFAIDMCVGTAIVFVWKKINRKNADIMVPAVASGLICGDGVWTLPSSIL  181

Query  322  ALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ALA V PPICMKFLSR  NT+VD F++
Sbjct  182  ALAKVNPPICMKFLSRNMNTKVDGFIN  208



>gb|EMT14396.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii]
Length=723

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAPNAA+FR+MAILGV+GFS+LPKNC+TLCYIFFVGAI +N +RD V KK +RF+
Sbjct  571  SGSEYPAPNAAIFRSMAILGVDGFSSLPKNCITLCYIFFVGAIAVNLIRDLVPKKVSRFM  630

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFY+G YF IDMF+GTVILFVWQ++++ K+D + PAVASGLICGDG+W LP 
Sbjct  631  PIPMAMAIPFYLGPYFGIDMFIGTVILFVWQRLDKVKSDTYAPAVASGLICGDGLWVLPQ  690

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            S+LALA VKPPICMKFLSR  N +VD F+
Sbjct  691  SMLALAKVKPPICMKFLSRGVNAKVDAFI  719



>ref|XP_009420946.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            G+EYP+PNA V+RNMAILGVEGFS+LPK+CL LCY+FF+ A+++N  RD VGKK ARFIP
Sbjct  546  GTEYPSPNALVYRNMAILGVEGFSSLPKHCLVLCYVFFLAAVLVNASRDVVGKKAARFIP  605

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMA+AIPFY+GS FAIDM VG+++LF+W++ ++AKA+AFGPAVASGLICGDGIWTLP S
Sbjct  606  LPMAIAIPFYLGSAFAIDMCVGSLMLFIWERTDKAKAEAFGPAVASGLICGDGIWTLPQS  665

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALA VKPPICMKFLSR  N +VD F+
Sbjct  666  VLALAKVKPPICMKFLSRSMNEKVDAFI  693



>gb|KDP41617.1| hypothetical protein JCGZ_16024 [Jatropha curcas]
Length=690

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YP PNA V+R MAILGV+GFS+LPKNCL LCY FF  AI+IN ++D +GKKW RFIPL
Sbjct  542  STYPVPNAVVYRGMAILGVDGFSSLPKNCLLLCYCFFAAAILINIIKDFLGKKWGRFIPL  601

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W+KIN+AKADAFGPAVASGLICGDGIW LP SI
Sbjct  602  PMAMAIPFYLGPYFAIDMCVGSLILFIWEKINKAKADAFGPAVASGLICGDGIWVLPSSI  661

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVK PICM+F SR  N R+D FL
Sbjct  662  LALAGVKAPICMRFFSRSTNNRIDKFL  688



>ref|NP_176750.1| putative metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
 sp|Q9SHY2.1|YSL7_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL7; 
AltName: Full=Protein YELLOW STRIPE LIKE 7; Short=AtYSL7 [Arabidopsis 
thaliana]
 gb|AAF23830.1|AC007234_2 F1E22.10 [Arabidopsis thaliana]
 gb|AAO22767.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04062.1| unknown protein [Arabidopsis thaliana]
 gb|AAS00696.1| metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
 gb|AEE34418.1| putative metal-nicotianamine transporter YSL7 [Arabidopsis thaliana]
Length=688

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + G+ YPAP A V+RNM+ILGVEGFSALPK+CL LCYIFF  A+++NG+RD +G KWARF
Sbjct  536  QPGTAYPAPYALVYRNMSILGVEGFSALPKHCLMLCYIFFAAAVIVNGIRDALGPKWARF  595

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFY+G YF IDM +G++ILF+W+K+N+ KADA+  AVASGLICG+GIWTLP
Sbjct  596  IPLPMAMAIPFYLGGYFTIDMCLGSLILFIWRKLNKPKADAYSSAVASGLICGEGIWTLP  655

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             SILALAGVK PICMKFLS   N +VD FL+P
Sbjct  656  SSILALAGVKAPICMKFLSMASNNKVDAFLNP  687



>gb|KHM99726.1| Putative metal-nicotianamine transporter YSL7 [Glycine soja]
Length=623

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++ SEYPAP A ++RNMAILGV+GF  LPKNCL LCYIFF  A+ IN ++D +G K  RF
Sbjct  473  RSTSEYPAPYAIIYRNMAILGVQGFGNLPKNCLLLCYIFFAAAVAINLIKDFIGNK-GRF  531

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YFAIDM VG++IL+VW++IN+AKADAF PAVASGLICGDGIWTLP
Sbjct  532  IPLPMAMAIPFYIGPYFAIDMCVGSLILYVWERINKAKADAFAPAVASGLICGDGIWTLP  591

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALAGVKPPICMKFLSR  N RVDTFL
Sbjct  592  ASILALAGVKPPICMKFLSRAANARVDTFL  621



>ref|XP_009383038.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=688

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A ++RNMAILGVEGFS+LPK+CLTLCY+FF  AIVIN  RD  GKK ARFIP+
Sbjct  538  SQYPAPYAIIYRNMAILGVEGFSSLPKHCLTLCYVFFALAIVINLARDLAGKKVARFIPI  597

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIGSYFAIDMF+G+VIL+VW++ N+AKADAF PA+ASGLICGDGIWTLP ++
Sbjct  598  PMAMAIPFYIGSYFAIDMFIGSVILYVWERRNKAKADAFAPAMASGLICGDGIWTLPQAV  657

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALA VKPPICMKFLSR  N +VD ++
Sbjct  658  LALAQVKPPICMKFLSRTMNDKVDAYI  684



>ref|XP_003533289.1| PREDICTED: probable metal-nicotianamine transporter YSL8-like 
[Glycine max]
Length=703

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++ SEYPAP A ++RNMAILGV+GF  LPKNCL LCYIFF  A+ IN ++D +G K  RF
Sbjct  553  RSTSEYPAPYAIIYRNMAILGVQGFGNLPKNCLLLCYIFFAAAVAINLIKDFIGNK-GRF  611

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YFAIDM VG++IL+VW++IN+AKADAF PAVASGLICGDGIWTLP
Sbjct  612  IPLPMAMAIPFYIGPYFAIDMCVGSLILYVWERINKAKADAFAPAVASGLICGDGIWTLP  671

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALAGVKPPICMKFLSR  N RVDTFL
Sbjct  672  ASILALAGVKPPICMKFLSRAANARVDTFL  701



>ref|NP_001276131.1| uncharacterized protein LOC100809484 [Glycine max]
 gb|AFD96645.1| YSL1 [Glycine max]
Length=682

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A V+RNMAILGV+GFSALP+ CLTLC +FFV AI IN VRD VG+KWA+FIP
Sbjct  533  GSAYPAPYALVYRNMAILGVDGFSALPQYCLTLCCVFFVAAIGINLVRDLVGEKWAKFIP  592

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFYIGSYFAIDM VG++ILF+WQ+I++  AD FG AVASGLICGDGIWTLP S
Sbjct  593  VPMAMAIPFYIGSYFAIDMCVGSLILFIWQRIDKVNADTFGSAVASGLICGDGIWTLPSS  652

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTF  248
             LALAGVKPPICMKFLSR  NT+VD F
Sbjct  653  FLALAGVKPPICMKFLSRGVNTKVDGF  679



>ref|XP_003617439.1| Yellow stripe-like protein 2.8 [Medicago truncatula]
Length=690

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GS YPAP A V+RN+AILGV+GFSALPKNCL LC IFF GAI+IN VRD VGKK+A++
Sbjct  531  QPGSAYPAPYALVYRNIAILGVDGFSALPKNCLVLCIIFFTGAIIINFVRDLVGKKYAKY  590

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFYIGSYFAIDM VG++ILF+WQK++RAKADAF  AVASGLICGDGIW+LP
Sbjct  591  IPVPMAMAIPFYIGSYFAIDMCVGSLILFIWQKLDRAKADAFASAVASGLICGDGIWSLP  650

Query  334  DSILALAGVKPPICMKFLSRKDNTRVD  254
             S LALAGV+PPICMKFLSR  N +VD
Sbjct  651  SSFLALAGVQPPICMKFLSRAANAKVD  677



>emb|CBI35280.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A V+ NMA+LGVEG S LPKNC TLC +FF  AI++N VRD VG+K A+FIP
Sbjct  378  GSEYPAPYALVYHNMAVLGVEGISNLPKNCFTLCCVFFGAAILVNLVRDAVGRKRAQFIP  437

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIPFY+G YFAIDM VG++ILF+WQ+IN+AKA+AFGPAVASGLICG+GIWTLP S
Sbjct  438  IPMAMAIPFYLGPYFAIDMCVGSLILFIWQRINKAKAEAFGPAVASGLICGEGIWTLPGS  497

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAG+K PICMKFLSR  N RVD FL
Sbjct  498  ILALAGIKQPICMKFLSRATNARVDKFL  525



>ref|XP_002266657.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=708

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++GSEYPAP A V+ NMA+LGVEG S LPKNC TLC +FF  AI++N VRD VG+K A+F
Sbjct  557  QSGSEYPAPYALVYHNMAVLGVEGISNLPKNCFTLCCVFFGAAILVNLVRDAVGRKRAQF  616

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFY+G YFAIDM VG++ILF+WQ+IN+AKA+AFGPAVASGLICG+GIWTLP
Sbjct  617  IPIPMAMAIPFYLGPYFAIDMCVGSLILFIWQRINKAKAEAFGPAVASGLICGEGIWTLP  676

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALAG+K PICMKFLSR  N RVD FL
Sbjct  677  GSILALAGIKQPICMKFLSRATNARVDKFL  706



>ref|XP_010112079.1| putative metal-nicotianamine transporter YSL8 [Morus notabilis]
 gb|EXC32539.1| putative metal-nicotianamine transporter YSL8 [Morus notabilis]
Length=307

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNMAILGVEGF +LP  CLTLC+IFF  A+ IN V+D +GK+  RFIP+
Sbjct  158  SQYPAPYAVVYRNMAILGVEGFDSLPNYCLTLCFIFFAAAVSINLVKDFLGKEKGRFIPI  217

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YFAIDM VG++++FVW+K+N+AKADA  PAVASGLICGDGIWTLP SI
Sbjct  218  PMAMAIPFYIGPYFAIDMCVGSLVVFVWEKLNKAKADALVPAVASGLICGDGIWTLPASI  277

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGVKPPICMKFLSR  N +VD FL
Sbjct  278  LAVAGVKPPICMKFLSRAANVKVDKFL  304



>ref|XP_003548294.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Glycine max]
 gb|KHN24500.1| Putative metal-nicotianamine transporter YSL7 [Glycine soja]
Length=702

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            ++ SEYPAP A ++RNMAILGV+GF  LPKNCL LCYIFF  A+ IN ++D +GK+  RF
Sbjct  552  RSTSEYPAPYAIIYRNMAILGVQGFGHLPKNCLLLCYIFFAAAVAINLIKDFLGKR-GRF  610

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YFAIDM VG++IL+VW++IN+AKADAF PAVASGLICGDGIWTLP
Sbjct  611  IPLPMAMAIPFYIGPYFAIDMCVGSLILYVWERINKAKADAFAPAVASGLICGDGIWTLP  670

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALAGVKPPICMKFLSR  N RVDT L
Sbjct  671  ASILALAGVKPPICMKFLSRAANARVDTLL  700



>ref|XP_007146944.1| hypothetical protein PHAVU_006G083800g [Phaseolus vulgaris]
 gb|ESW18938.1| hypothetical protein PHAVU_006G083800g [Phaseolus vulgaris]
Length=680

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A V+RNMAILGV+G SALP+ CL  CY+FF  AIVIN +RD VGKKWARFIP
Sbjct  531  GSPYPAPYALVYRNMAILGVDGLSALPQYCLIFCYVFFGVAIVINLIRDLVGKKWARFIP  590

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMA+PFYIGSYFAIDM VG++ILF+W+K+++  AD FG AVASGLICGDGIWTLP S
Sbjct  591  VPMAMAVPFYIGSYFAIDMCVGSLILFIWRKLDKVGADTFGSAVASGLICGDGIWTLPSS  650

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
             LALAGVKPPICMKFLSR +NT+VD +L 
Sbjct  651  FLALAGVKPPICMKFLSRAENTKVDGYLE  679



>gb|KEH26876.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=551

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNMAILGV+GFS+LP NCL LCYIFF  AIV+N ++D VGK   RFIPL
Sbjct  404  SQYPAPYAIVYRNMAILGVQGFSSLPDNCLLLCYIFFGAAIVVNLIKDLVGKV-GRFIPL  462

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W+K+++AKADAF PAVASGLICGDGIWTLP SI
Sbjct  463  PMAMAIPFYLGPYFAIDMCVGSLILFIWEKVDKAKADAFAPAVASGLICGDGIWTLPASI  522

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LAL GVKPPICMKFLSR  N RVDTFL
Sbjct  523  LALFGVKPPICMKFLSRSTNDRVDTFL  549



>emb|CBI35270.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYPAP A V+RNMAILGV+G S+LPKNC  LC +FF  A+++N VRD VGK+ +RF P
Sbjct  369  GSEYPAPYALVYRNMAILGVDGISSLPKNCFLLCCVFFAAAVLVNLVRDAVGKRRSRFTP  428

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            +PMAMAIP Y+G YFAIDM VG++IL++W+++N+AKADAFGPAVASGLICGDGIWTLP S
Sbjct  429  IPMAMAIPLYLGPYFAIDMCVGSLILYIWERMNKAKADAFGPAVASGLICGDGIWTLPSS  488

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVK PICMKFLSR  N RVD  L
Sbjct  489  ILALAGVKQPICMKFLSRATNVRVDKLL  516



>gb|KEH34580.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=696

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GS YPAP A VFRN+AI+GV+GFSALPKNCL LC  FF  AIVIN VRD V KK+++F
Sbjct  545  QPGSAYPAPYALVFRNIAIIGVDGFSALPKNCLRLCIAFFFSAIVINFVRDLVPKKYSKF  604

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFYIGS FAIDM VG++ILF+WQK++RAKADAFG AVASGLICGDGIWTLP
Sbjct  605  IPVPMAMAIPFYIGSSFAIDMCVGSLILFIWQKVDRAKADAFGSAVASGLICGDGIWTLP  664

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLH  242
             S LALAGVKPPICMKFLS+  N +VD FL 
Sbjct  665  SSFLALAGVKPPICMKFLSKAKNAKVDAFLE  695



>ref|XP_010933277.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Elaeis 
guineensis]
Length=727

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A ++RN+AILGV+G S+LPK+CLTLC IFF  AI+IN +RD   KK ARFIPL
Sbjct  577  SEYPAPYAIIYRNIAILGVDGISSLPKHCLTLCCIFFAAAILINLIRDFSPKKVARFIPL  636

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIGSYFAIDM VG++ILFVW+KIN+ +ADAFGPAVASGLICGDG+WTLP S+
Sbjct  637  PMAMAIPFYIGSYFAIDMCVGSLILFVWEKINKTQADAFGPAVASGLICGDGLWTLPQSL  696

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALA VKPPICMKFLSRK N RVD F+
Sbjct  697  LALAKVKPPICMKFLSRKMNDRVDDFI  723



>ref|XP_011035385.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Populus 
euphratica]
Length=704

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 130/151 (86%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVG---KKWAR  518
            GS+YPAP A V+RNMAILGVEGFS+LPKNCL LCYIFF GAI+IN  +D +    KK+A+
Sbjct  552  GSQYPAPFAVVYRNMAILGVEGFSSLPKNCLKLCYIFFCGAILINIFKDVMERKCKKFAK  611

Query  517  FIPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTL  338
            FIPLPMAMAIPFYIG YFAIDM VG++IL+VW +IN+AKADAF PAVASGLICGDGIWTL
Sbjct  612  FIPLPMAMAIPFYIGPYFAIDMCVGSLILYVWGRINKAKADAFAPAVASGLICGDGIWTL  671

Query  337  PDSILALAGVKPPICMKFLSRKDNTRVDTFL  245
            P SILALAGVK PICM+F SR  NTR+D FL
Sbjct  672  PSSILALAGVKAPICMRFFSRATNTRIDNFL  702



>ref|XP_003620154.1| Yellow stripe-like protein 2.1 [Medicago truncatula]
 gb|AES76372.1| OPT family oligopeptide transporter [Medicago truncatula]
Length=712

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNMAILGV+GFS+LP NCL LCYIFF  AIV+N ++D VGK   RFIPL
Sbjct  565  SQYPAPYAIVYRNMAILGVQGFSSLPDNCLLLCYIFFGAAIVVNLIKDLVGKV-GRFIPL  623

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W+K+++AKADAF PAVASGLICGDGIWTLP SI
Sbjct  624  PMAMAIPFYLGPYFAIDMCVGSLILFIWEKVDKAKADAFAPAVASGLICGDGIWTLPASI  683

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LAL GVKPPICMKFLSR  N RVDTFL
Sbjct  684  LALFGVKPPICMKFLSRSTNDRVDTFL  710



>ref|XP_006372358.1| hypothetical protein POPTR_0017s00840g [Populus trichocarpa]
 gb|ERP50155.1| hypothetical protein POPTR_0017s00840g [Populus trichocarpa]
Length=242

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 123/148 (83%), Gaps = 7/148 (5%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+YPAP A VFRNMAILGVEGFS+LPKNCL LCY FF  AI+IN ++D +GKK A FIP
Sbjct  100  GSQYPAPCATVFRNMAILGVEGFSSLPKNCLYLCYWFFGAAILINLIKDAMGKKRASFIP  159

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
             PM       IGSYFAIDM VG++ILF+W+KI+ AKADAFGPAVASGLICGDGIWTLP S
Sbjct  160  NPM-------IGSYFAIDMCVGSLILFIWEKIDNAKADAFGPAVASGLICGDGIWTLPSS  212

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVKPPICMKFLSR  N +VD FL
Sbjct  213  ILALAGVKPPICMKFLSRGTNAKVDAFL  240



>ref|XP_004515282.1| PREDICTED: probable metal-nicotianamine transporter YSL5-like 
[Cicer arietinum]
Length=709

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+RNMAILGV+GF +LP NCL LCYIFF  AIV+N  +D +GK   RFIPL
Sbjct  562  SQYPAPYAIVYRNMAILGVQGFGSLPDNCLLLCYIFFGAAIVVNLTKDLIGKV-GRFIPL  620

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W+KIN+AKADAF PAVASGLICGDGIWTLP SI
Sbjct  621  PMAMAIPFYLGPYFAIDMCVGSLILFIWEKINKAKADAFAPAVASGLICGDGIWTLPASI  680

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LAL GVKPPICMKFLSR  N+RVDTFL
Sbjct  681  LALFGVKPPICMKFLSRATNSRVDTFL  707



>ref|XP_007152542.1| hypothetical protein PHAVU_004G138900g [Phaseolus vulgaris]
 gb|ESW24536.1| hypothetical protein PHAVU_004G138900g [Phaseolus vulgaris]
Length=701

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            K+ SEYPAP A ++RNMAILGV+GF +LPKNCL LCYIFF  A+VIN  +D +GKK  +F
Sbjct  551  KSTSEYPAPYAIIYRNMAILGVQGFGSLPKNCLLLCYIFFAAAVVINLFKDFLGKK-GKF  609

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YFAIDM VG++IL+VW++IN+AKADAF PAVASGLICGDGIWTLP
Sbjct  610  IPLPMAMAIPFYIGPYFAIDMCVGSLILYVWERINKAKADAFAPAVASGLICGDGIWTLP  669

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALA VKPPICM+F SR  N++VDT L
Sbjct  670  ASILALAEVKPPICMRFFSRAANSKVDTLL  699



>ref|XP_008779403.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Phoenix 
dactylifera]
Length=680

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GSEYPAP A+++R +AILGV+GFS+LPK+CLT CY+FF  AI+IN  RD  GKK ARFI
Sbjct  527  SGSEYPAPYASIYRGIAILGVDGFSSLPKHCLTFCYVFFAAAILINLGRDFSGKKVARFI  586

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAMAIPFYIG+YF IDM VG++ILFVW+ +N+A+ADAF PAVASGLICGDGIWTLP 
Sbjct  587  PLPMAMAIPFYIGAYFCIDMCVGSLILFVWETVNKAQADAFAPAVASGLICGDGIWTLPQ  646

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            S+LA+A VKPPICMKFLSR+ N +VD F+ 
Sbjct  647  SVLAIAKVKPPICMKFLSRQVNDKVDAFIS  676



>ref|XP_002269403.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Vitis 
vinifera]
Length=708

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GSEYPAP A V+RNMAILGV+G S+LPKNC  LC +FF  A+++N VRD VGK+ +RF
Sbjct  557  QDGSEYPAPYALVYRNMAILGVDGISSLPKNCFLLCCVFFAAAVLVNLVRDAVGKRRSRF  616

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
             P+PMAMAIP Y+G YFAIDM VG++IL++W+++N+AKADAFGPAVASGLICGDGIWTLP
Sbjct  617  TPIPMAMAIPLYLGPYFAIDMCVGSLILYIWERMNKAKADAFGPAVASGLICGDGIWTLP  676

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILALAGVK PICMKFLSR  N RVD  L
Sbjct  677  SSILALAGVKQPICMKFLSRATNVRVDKLL  706



>ref|XP_002305689.1| hypothetical protein POPTR_0004s06790g [Populus trichocarpa]
 gb|EEE86200.1| hypothetical protein POPTR_0004s06790g [Populus trichocarpa]
Length=689

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVG---KKWAR  518
            GS+YPAP A V+RNMAILGVEGFS+LPKNCL LCYIFF GAI+IN  +D +    KK+A+
Sbjct  537  GSQYPAPYAVVYRNMAILGVEGFSSLPKNCLKLCYIFFCGAILINIFKDVMERKCKKFAK  596

Query  517  FIPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTL  338
            FIPLPMAMAIPFYIG YFAIDM VG++IL+VW +IN+AKADAF PAVASGLICGDGIWTL
Sbjct  597  FIPLPMAMAIPFYIGPYFAIDMCVGSLILYVWGRINKAKADAFAPAVASGLICGDGIWTL  656

Query  337  PDSILALAGVKPPICMKFLSRKDNTRVDTFL  245
            P SILALAGVK PICM+F SR  +TR+D F+
Sbjct  657  PSSILALAGVKAPICMRFFSRATSTRIDNFI  687



>ref|XP_010086691.1| putative metal-nicotianamine transporter YSL8 [Morus notabilis]
 gb|EXB22895.1| putative metal-nicotianamine transporter YSL8 [Morus notabilis]
Length=423

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP   V+RNMAILGVEGF +LP  CLTLC+IFF  A+ IN V+D +GK+  RFIP+
Sbjct  274  SQYPAPYVVVYRNMAILGVEGFDSLPNYCLTLCFIFFAAAVSINLVKDFLGKEKGRFIPI  333

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YFAIDM VG++++FVW+K+N+AKADA  PAVASGLICGDGIWTLP SI
Sbjct  334  PMAMAIPFYIGPYFAIDMCVGSLVVFVWEKLNKAKADALVPAVASGLICGDGIWTLPASI  393

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGVKPPICMKFLSR  N +VD FL
Sbjct  394  LAVAGVKPPICMKFLSRAANVKVDKFL  420



>ref|XP_008240337.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Prunus 
mume]
Length=735

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+RNMAILGVEGF +LPK+CL LC +FF  AI+ N ++D +GKK ARF+PL
Sbjct  583  SAYPAPFAVVYRNMAILGVEGFKSLPKHCLLLCAVFFGAAILTNVIKDCIGKKRARFVPL  642

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM +G++I+F+W+++N+AKADAF PAVASGLICGDG+WTLP SI
Sbjct  643  PMAMAIPFYLGSYFAIDMCIGSLIVFLWERVNKAKADAFVPAVASGLICGDGVWTLPASI  702

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICM+FLSR +N RV TFL
Sbjct  703  LALAGVKPPICMRFLSRAENDRVTTFL  729



>ref|XP_007210334.1| hypothetical protein PRUPE_ppa002002mg [Prunus persica]
 gb|EMJ11533.1| hypothetical protein PRUPE_ppa002002mg [Prunus persica]
Length=731

 Score =   230 bits (587),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+RNMAILGVEGF +LPK+CL LC +FF  AI+ N ++D +GKK ARF+PL
Sbjct  581  SAYPAPLAVVYRNMAILGVEGFKSLPKHCLLLCTVFFGAAILTNVIKDCIGKKRARFVPL  640

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM +G++I+F+W+++N+AKADAF PAVASGLICGDG+WTLP SI
Sbjct  641  PMAMAIPFYLGSYFAIDMCIGSLIVFLWERVNKAKADAFVPAVASGLICGDGVWTLPASI  700

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            L+LAGVKPPICM+FLSR +N RV TFL
Sbjct  701  LSLAGVKPPICMRFLSRAENDRVTTFL  727



>gb|KCW83950.1| hypothetical protein EUGRSUZ_B00835 [Eucalyptus grandis]
Length=631

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            G EY  P   V+R+MA LGVEGF++LPK+CLTLC  F V A++ING RD VGKKWARFIP
Sbjct  482  GKEYVVPYGIVYRSMAELGVEGFTSLPKHCLTLCCGFLVAAMIINGFRDLVGKKWARFIP  541

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG  FAIDM VG++ILF+W+K ++AKADAFGPAVASGLICGDG+WTLP S
Sbjct  542  LPMAMAIPFYIGPSFAIDMCVGSLILFIWEKTDKAKADAFGPAVASGLICGDGLWTLPSS  601

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            IL LAGV PPICMKFLSR  N R+D FL
Sbjct  602  ILTLAGVNPPICMKFLSRATNKRLDAFL  629



>ref|XP_004299460.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Fragaria 
vesca subsp. vesca]
Length=711

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS Y AP A V+RNM+IL VEG  +LPKNCL LC +FF  AI+IN ++D +GK+ ARFIP
Sbjct  562  GSAYAAPFAVVYRNMSILAVEGLDSLPKNCLLLCGVFFAAAILINLIKDCIGKQRARFIP  621

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG+YFAIDM +G++I FVW+KIN+AKADAF PAVASG+ICGDGIWTLP S
Sbjct  622  LPMAMAIPFYIGTYFAIDMCIGSLIKFVWEKINKAKADAFVPAVASGMICGDGIWTLPAS  681

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGVKPPICM+FLS KDN RVD FL
Sbjct  682  ILALAGVKPPICMRFLSSKDNARVDKFL  709



>ref|XP_011072202.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Sesamum 
indicum]
Length=691

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            T SEYPAP A V+  MA LGVEGFS LPK+CL LCY+FF  A++IN +RD +GKK + FI
Sbjct  541  TTSEYPAPFATVYYTMARLGVEGFSPLPKHCLNLCYVFFAAAVLINLIRDILGKKRSWFI  600

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            PLPMAM IPF++GSYFAIDM VG++IL++WQK+N+AKADAFGP VASGLICGDG+WTLP 
Sbjct  601  PLPMAMGIPFFLGSYFAIDMCVGSLILYIWQKVNKAKADAFGPVVASGLICGDGMWTLPS  660

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +ILALAGV+PPICMKF+SR  N+RVD +L
Sbjct  661  AILALAGVRPPICMKFISRATNSRVDKYL  689



>ref|XP_010032362.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=688

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            G EY  P   V+R+MA LGVEGF++LPK+CLTLC  F V A++ING RD VGKKWARFIP
Sbjct  539  GKEYVVPYGIVYRSMAELGVEGFTSLPKHCLTLCCGFLVAAMIINGFRDLVGKKWARFIP  598

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG  FAIDM VG++ILF+W+K ++AKADAFGPAVASGLICGDG+WTLP S
Sbjct  599  LPMAMAIPFYIGPSFAIDMCVGSLILFIWEKTDKAKADAFGPAVASGLICGDGLWTLPSS  658

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            IL LAGV PPICMKFLSR  N R+D FL
Sbjct  659  ILTLAGVNPPICMKFLSRATNKRLDAFL  686



>ref|XP_009384580.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+YPAP A ++RNMAILGV+GFS+LPK+CLTLCY FF  AIVIN  RD   KK ARFI
Sbjct  545  SGSQYPAPYALIYRNMAILGVDGFSSLPKHCLTLCYTFFALAIVINLARDTCPKKVARFI  604

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFYIG+ FAIDM +G+ IL+VW +IN+AKADAFGPAVASGLICGDGIW+LP 
Sbjct  605  PIPMAMAIPFYIGTSFAIDMCLGSAILYVWGRINKAKADAFGPAVASGLICGDGIWSLPQ  664

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFLH  242
             +LALA VKPPICMKFLSRK N +VD ++ 
Sbjct  665  GVLALARVKPPICMKFLSRKMNNKVDAYIE  694



>ref|XP_010248248.1| PREDICTED: probable metal-nicotianamine transporter YSL14, partial 
[Nelumbo nucifera]
Length=128

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  622  FSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLPMAMAIPFYIGSYFAIDMFVG  443
            FSALPK+CLTLCY FF  AI+IN +RD VGKKW++FIP+PMAMAIPFY+GSYFAIDM VG
Sbjct  1    FSALPKHCLTLCYAFFAVAILINLIRDVVGKKWSKFIPVPMAMAIPFYLGSYFAIDMCVG  60

Query  442  TVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSILALAGVKPPICMKFLSRKDNT  263
            ++ILF+W+K N+AKADAFGPAVASGLICGDGIWTLP SILALAGVKPPICMKFLSR  N 
Sbjct  61   SLILFLWEKTNKAKADAFGPAVASGLICGDGIWTLPSSILALAGVKPPICMKFLSRATNA  120

Query  262  RVDTFLH  242
            +VD FL 
Sbjct  121  KVDKFLS  127



>gb|AFW58895.1| hypothetical protein ZEAMMB73_322526 [Zea mays]
Length=182

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G  YPAP A ++RNM+ILGV+G S LPKNCLTLCYIFF  +  IN ++D V KK A+FI
Sbjct  32   SGGAYPAPYAIMYRNMSILGVDGLSLLPKNCLTLCYIFFAVSFTINLIKDLVPKKVAKFI  91

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMA AIPFY+G YFAIDMF+G+VILF W+  N+A+AD+FGPAVASGL+CGDG+W LP 
Sbjct  92   PIPMAAAIPFYLGPYFAIDMFLGSVILFFWEWKNKAEADSFGPAVASGLMCGDGLWALPQ  151

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ++L+LA VKPPICMKFLSR  N +VDTFL
Sbjct  152  AVLSLANVKPPICMKFLSRSLNAKVDTFL  180



>ref|XP_007211297.1| hypothetical protein PRUPE_ppa001999mg [Prunus persica]
 gb|EMJ12496.1| hypothetical protein PRUPE_ppa001999mg [Prunus persica]
Length=731

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+RNMAILGVEGF +LPK+CL LC +FF  AI+ N ++D +GKK ARF+PL
Sbjct  581  SAYPAPFAVVYRNMAILGVEGFKSLPKHCLLLCTVFFGAAILTNVIKDCIGKKRARFVPL  640

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            P+AMA+PFY+GSYFAIDM +G++I+F+W+++N+AKADAF PAVASGLICGDG+WTLP SI
Sbjct  641  PVAMAVPFYLGSYFAIDMCIGSLIVFLWERVNKAKADAFVPAVASGLICGDGVWTLPASI  700

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICM+FLSR +N RV TFL
Sbjct  701  LALAGVKPPICMRFLSRAENDRVTTFL  727



>ref|XP_002510093.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF52280.1| oligopeptide transporter, putative [Ricinus communis]
Length=709

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YP P A V+R MAILGV+GFS+LPKNCL LCY FFV A++IN ++D  GKKW RFIPL
Sbjct  560  STYPVPFAVVYRGMAILGVDGFSSLPKNCLYLCYGFFVAAVLINIIKDVAGKKWRRFIPL  619

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+G YFAIDM VG++ILF+W++IN+ KADAF PAVASGLICGDGIW LP SI
Sbjct  620  PMAMAIPFYLGPYFAIDMCVGSLILFIWERINKTKADAFAPAVASGLICGDGIWVLPSSI  679

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVK PICM+F +R  N+R+D FL
Sbjct  680  LALAGVKAPICMRFFNRGTNSRIDQFL  706



>ref|XP_004158539.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL7-like [Cucumis sativus]
Length=678

 Score =   226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+RNMA+L VEG S+LPKNCL L Y+FF  AIV+N +RD + KK +++IP+
Sbjct  530  SAYPAPYATVYRNMALLAVEGVSSLPKNCLYLSYLFFAAAIVLNLIRDLLEKKVSQYIPI  589

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            P AMAIPFYIG YFAIDM +G++ILFVW+KIN+AKADAF PAVASGLICGDGIWTLP SI
Sbjct  590  PTAMAIPFYIGPYFAIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLPSSI  649

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICMKFLSR  N +V TFL
Sbjct  650  LALAGVKPPICMKFLSRTANVKVSTFL  676



>gb|KEH28405.1| metal-nicotianamine transporter YSL3-like protein [Medicago truncatula]
Length=295

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GS YPAP A V+RN+AILGV+GFSALPKNCL LC IFF+GAI+IN VRD VGKK+A++
Sbjct  71   QPGSAYPAPYALVYRNIAILGVDGFSALPKNCLVLCIIFFIGAIIINFVRDLVGKKYAKY  130

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFYIGSYFAIDM VG++ILF+WQK++RAKADAF  AVASGLICGDGIW+LP
Sbjct  131  IPVPMAMAIPFYIGSYFAIDMCVGSLILFIWQKLDRAKADAFASAVASGLICGDGIWSLP  190

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTF  248
             S LALAGV+PPICMKFLSR  N +   +
Sbjct  191  SSFLALAGVQPPICMKFLSRAANAKTQQW  219



>ref|XP_004138639.1| PREDICTED: probable metal-nicotianamine transporter YSL7-like 
[Cucumis sativus]
Length=678

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+RNMA+L VEG S+LPKNCL L Y+FF  AIV+N +RD + KK +++IP+
Sbjct  530  SAYPAPYATVYRNMALLAVEGVSSLPKNCLYLSYLFFAAAIVLNLIRDLLEKKVSQYIPI  589

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            P AMAIPFYIG YFAIDM +G++ILFVW+KIN+AKADAF PAVASGLICGDGIWTLP SI
Sbjct  590  PTAMAIPFYIGPYFAIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLPRSI  649

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICMKFLSR  N +V TFL
Sbjct  650  LALAGVKPPICMKFLSRTANVKVTTFL  676



>gb|KGN63126.1| hypothetical protein Csa_2G404780 [Cucumis sativus]
Length=675

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+RNMA+L VEG S+LPKNCL L Y+FF  AIV+N +RD + KK +++IP+
Sbjct  527  SAYPAPYATVYRNMALLAVEGVSSLPKNCLYLSYLFFAAAIVLNLIRDLLEKKVSQYIPI  586

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            P AMAIPFYIG YFAIDM +G++ILFVW+KIN+AKADAF PAVASGLICGDGIWTLP SI
Sbjct  587  PTAMAIPFYIGPYFAIDMCLGSLILFVWEKINKAKADAFAPAVASGLICGDGIWTLPRSI  646

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGVKPPICMKFLSR  N +V TFL
Sbjct  647  LALAGVKPPICMKFLSRTANVKVTTFL  673



>gb|KFK36098.1| hypothetical protein AALP_AA4G077100 [Arabis alpina]
Length=713

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP++CL LCY+FF  AI+IN VRD +G +W RFIPL
Sbjct  563  SEYPAPFATVYRSMAKLGVEGVSSLPRDCLVLCYVFFAVAIIINLVRDSLGNRWGRFIPL  622

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILFVW++++  KA+AF  AVASGLICGDGIWTLP S+
Sbjct  623  PMAMAIPFFLGPYFAIDMCVGSLILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSV  682

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPP+CMKFLS   N RVD FLH
Sbjct  683  LAIAGVKPPVCMKFLSSATNHRVDKFLH  710



>ref|XP_006847869.1| hypothetical protein AMTR_s00029p00088690 [Amborella trichopoda]
 gb|ERN09450.1| hypothetical protein AMTR_s00029p00088690 [Amborella trichopoda]
Length=375

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            +  SEYPAP A V+RN++++GVEGFS+LP +CLTLC +FF+ A+ IN VRD   K+ ++F
Sbjct  224  REKSEYPAPFALVYRNISLIGVEGFSSLPDHCLTLCLVFFLAAMAINLVRDLTPKRISQF  283

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IPLPMAMAIPFYIG YFAIDM VG++ILFVW+++++ KADAF PAVASG+ICGDGIW+LP
Sbjct  284  IPLPMAMAIPFYIGGYFAIDMCVGSLILFVWRRLDKKKADAFAPAVASGMICGDGIWSLP  343

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFL  245
             SILA+A VKPPICMKFLSR  N +VD FL
Sbjct  344  ASILAIAKVKPPICMKFLSRAVNAKVDGFL  373



>gb|KCW57904.1| hypothetical protein EUGRSUZ_H00651 [Eucalyptus grandis]
Length=683

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A+++R+MAILGVEGFS+LPK+CLTLCY FF  AIVIN +RD V KK++RFIP+
Sbjct  541  STYPAPYASIYRSMAILGVEGFSSLPKHCLTLCYGFFAAAIVINAIRDLVPKKYSRFIPV  600

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM +G++ILF+W+++++ KADAF PAVASGLICGDGIWTLP SI
Sbjct  601  PMAMAIPFYLGSYFAIDMCIGSLILFLWERMDKTKADAFAPAVASGLICGDGIWTLPSSI  660

Query  325  LALAGVKPPICMKFLSRKD  269
            LAL GVKPPICMKFLSR +
Sbjct  661  LALVGVKPPICMKFLSRAE  679



>ref|XP_003617442.1| Oligopeptide transporter OPT family, partial [Medicago truncatula]
Length=296

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            + GS YPAP A V+RN+AILGV+GFSALPKNCL LC IFF+GAI+IN VRD VGKK+A++
Sbjct  72   QPGSAYPAPYALVYRNIAILGVDGFSALPKNCLVLCIIFFIGAIIINFVRDLVGKKYAKY  131

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
            IP+PMAMAIPFYIGSYFAIDM VG++ILF+WQK++RAKADAF  AVASGLICGDGIW+LP
Sbjct  132  IPVPMAMAIPFYIGSYFAIDMCVGSLILFIWQKLDRAKADAFASAVASGLICGDGIWSLP  191

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTF  248
             S LALAGV+PPICMKFLSR  N +   +
Sbjct  192  SSFLALAGVQPPICMKFLSRAANAKTQQW  220



>ref|XP_010025985.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Eucalyptus 
grandis]
Length=827

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A+++R+MAILGVEGFS+LPK+CLTLCY FF  AIVIN +RD V KK++RFIP+
Sbjct  685  STYPAPYASIYRSMAILGVEGFSSLPKHCLTLCYGFFAAAIVINAIRDLVPKKYSRFIPV  744

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM +G++ILF+W+++++ KADAF PAVASGLICGDGIWTLP SI
Sbjct  745  PMAMAIPFYLGSYFAIDMCIGSLILFLWERMDKTKADAFAPAVASGLICGDGIWTLPSSI  804

Query  325  LALAGVKPPICMKFLSRKD  269
            LAL GVKPPICMKFLSR +
Sbjct  805  LALVGVKPPICMKFLSRAE  823



>ref|XP_006847871.1| hypothetical protein AMTR_s00029p00090440 [Amborella trichopoda]
 gb|ERN09452.1| hypothetical protein AMTR_s00029p00090440 [Amborella trichopoda]
Length=372

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEY AP A V+RN++ILGVEGFS+LP +CLTLC +FF+GA+V+N  RD   K  ++FIP+
Sbjct  224  SEYSAPFATVYRNISILGVEGFSSLPMHCLTLCLVFFLGAMVVNFFRDVTPKSISQFIPI  283

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YFAIDM +G++IL++W++ ++ KADAF PAVASGLICGDGIWTLP S 
Sbjct  284  PMAMAIPFYIGGYFAIDMCIGSLILYLWERTDKRKADAFAPAVASGLICGDGIWTLPASF  343

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALA V PPICMKFLSR  N +VDTFL
Sbjct  344  LALAKVNPPICMKFLSRSVNAKVDTFL  370



>ref|XP_010666835.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Beta 
vulgaris subsp. vulgaris]
Length=672

 Score =   221 bits (564),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A+++RN+A+LGVEG S+LPKNC+TLC IFF GAIVING++D +GKK+ARFIP+
Sbjct  536  SRYPAPYASLYRNIALLGVEGLSSLPKNCVTLCIIFFFGAIVINGLKDFLGKKYARFIPI  595

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YFAIDM VG++ILF+WQ  N+A+ADAF PAVASGLICGDGIWTLP SI
Sbjct  596  PMAMAIPFYIGGYFAIDMCVGSLILFLWQYKNKAEADAFSPAVASGLICGDGIWTLPSSI  655

Query  325  LALAGVKPPICMKFLSR  275
            LALAG+ PPICMKF+ R
Sbjct  656  LALAGINPPICMKFVPR  672



>ref|XP_010465819.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Camelina sativa]
 ref|XP_010487655.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Camelina sativa]
 ref|XP_010487656.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Camelina sativa]
Length=425

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  KW RFIPL
Sbjct  275  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFSVAILVNIVKDSLKSKWGRFIPL  334

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  335  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  394

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N++VD FL
Sbjct  395  LAIAGVNPPVCMKFLSAATNSKVDNFL  421



>ref|XP_010505677.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=425

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  KW RFIPL
Sbjct  275  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFSVAILVNIVKDSLKSKWGRFIPL  334

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  335  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  394

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N++VD FL
Sbjct  395  LAIAGVNPPVCMKFLSAATNSKVDHFL  421



>ref|XP_010461657.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=721

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP++CL LCY FF  AI+IN V+DG+G +W RF+PL
Sbjct  571  SEYPAPFATVYRSMAKLGVEGVSSLPRDCLVLCYAFFGVAIIINVVKDGIGNRWGRFVPL  630

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+ ILFVW++++  KA+AF  AVASGLICGDGIWTLP S+
Sbjct  631  PMAMAIPFFLGPYFAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSV  690

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL+
Sbjct  691  LAIAGVKPPICMKFLSASTNHRVDKFLN  718



>gb|AEQ28190.1| yellow stripe-like protein 5 [Malus baccata var. xiaojinensis]
Length=733

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS YPAP A V+RN+A+L VEG  +LPKNCL LC IFF  AI IN ++D +GKK  RF+P
Sbjct  581  GSAYPAPFAVVYRNIAVLAVEGVKSLPKNCLLLCGIFFGAAIAINVLKDCLGKKRGRFVP  640

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+GSYFAIDM +G++I+F+W ++N+AKADAF PAVASGLICGDG WTLP S
Sbjct  641  LPMAMAIPFYLGSYFAIDMCIGSLIVFLWGRVNKAKADAFVPAVASGLICGDGTWTLPAS  700

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ILALAGV+PPICMKFLS   NTRVD F+
Sbjct  701  ILALAGVQPPICMKFLSSSQNTRVDAFI  728



>ref|XP_010479258.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Camelina 
sativa]
Length=722

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP++CL LCY FF  AI+IN V+DG+G +W RF+PL
Sbjct  572  SEYPAPFATVYRSMAKLGVEGVSSLPRDCLVLCYAFFGVAIIINVVKDGLGNRWGRFVPL  631

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+ ILFVW++++  KA+AF  AVASGLICGDGIWTLP S+
Sbjct  632  PMAMAIPFFLGPYFAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSV  691

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL+
Sbjct  692  LAIAGVKPPICMKFLSSATNHRVDKFLN  719



>dbj|BAJ34371.1| unnamed protein product [Thellungiella halophila]
Length=425

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  +W RFIPL
Sbjct  274  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFSVAILVNIVKDSLWSRWGRFIPL  333

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  334  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  393

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFLS   N++VD FL 
Sbjct  394  LAIAGVNPPVCMKFLSAATNSKVDNFLK  421



>emb|CDY64854.1| BnaCnng45400D [Brassica napus]
Length=397

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  248  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFGVAILVNIVKDSLPSRWGRFVPL  307

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA AFG AVASGLICGDGIW+LP S+
Sbjct  308  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAGAFGTAVASGLICGDGIWSLPSSV  367

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFL    N++VD FLH
Sbjct  368  LAIAGVSPPVCMKFLDAATNSKVDKFLH  395



>ref|XP_006393421.1| hypothetical protein EUTSA_v10011269mg [Eutrema salsugineum]
 gb|ESQ30707.1| hypothetical protein EUTSA_v10011269mg [Eutrema salsugineum]
Length=721

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+R+MA LGVEG S+LP++CL LCY FF  AI IN VRDG+G +W RF+PL
Sbjct  571  SRYPAPFATVYRSMAKLGVEGVSSLPRDCLVLCYAFFGVAIFINLVRDGLGDRWGRFVPL  630

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILFVW++++ AKA+AF   VASGLICGDGIWTLP S+
Sbjct  631  PMAMAIPFFLGPYFAIDMCVGSLILFVWERLDAAKAEAFATVVASGLICGDGIWTLPSSV  690

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL 
Sbjct  691  LAIAGVKPPICMKFLSSATNHRVDKFLQ  718



>ref|XP_006306886.1| hypothetical protein CARUB_v10008440mg [Capsella rubella]
 gb|EOA39784.1| hypothetical protein CARUB_v10008440mg [Capsella rubella]
Length=723

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP++CL LCY FF  AI+IN V+DG+G +W RF+PL
Sbjct  573  SEYPAPFATVYRSMAKLGVEGVSSLPRDCLVLCYAFFGIAIIINVVKDGLGNRWGRFVPL  632

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+ +LFVW+++N   A+AF  AVASGLICGDGIWTLP S+
Sbjct  633  PMAMAIPFFLGPYFAIDMCVGSFLLFVWERLNAPNAEAFATAVASGLICGDGIWTLPSSV  692

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL 
Sbjct  693  LAIAGVKPPICMKFLSAATNHRVDKFLQ  720



>ref|XP_010675190.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Beta 
vulgaris subsp. vulgaris]
Length=683

 Score =   219 bits (557),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+Y AP A+++ NMA+LGV+GF +LPKNCL LC IFF+GA+ ING+RD +GKKWARFIP+
Sbjct  544  SQYKAPYASIYHNMAVLGVQGFGSLPKNCLKLCLIFFIGAMAINGMRDLLGKKWARFIPI  603

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YFAIDM VG++ILF+WQ  NRA ADAFGPAVASGLICGDGIWTLP S+
Sbjct  604  PMAMAIPFYIGGYFAIDMCVGSLILFLWQHSNRANADAFGPAVASGLICGDGIWTLPSSV  663

Query  325  LALAGVKPPICMKFLSR  275
            LAL GV PP+C++ + R
Sbjct  664  LALVGVHPPLCLQVVPR  680



>ref|XP_009113870.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Brassica rapa]
Length=427

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  278  SEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFSVAILVNIVKDSLPSRWGRFVPL  337

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA+AFG AVASGLICGDGIW+ P S+
Sbjct  338  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAEAFGTAVASGLICGDGIWSFPSSV  397

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N+RVD+FL
Sbjct  398  LAIAGVNPPVCMKFLSAATNSRVDSFL  424



>ref|XP_010549025.1| PREDICTED: probable metal-nicotianamine transporter YSL8 isoform 
X2 [Tarenaya hassleriana]
Length=281

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI+IN ++DG+G +W RF+PL
Sbjct  131  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFGAAILINMMKDGLGNRWGRFVPL  190

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILFVW++++ AKA+AF PAVASGLICGDGIWTLP S+
Sbjct  191  PMAMAIPFFLGPYFAIDMCVGSLILFVWERVDAAKAEAFAPAVASGLICGDGIWTLPSSV  250

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL 
Sbjct  251  LAIAGVKPPICMKFLSGATNARVDQFLQ  278



>emb|CDY66980.1| BnaCnng53010D [Brassica napus]
Length=558

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+R+MA LGVEG S+LP++CL LCY FF  AI+IN V+DG+G +W RF+PL
Sbjct  408  SKYPAPFATVYRSMAKLGVEGVSSLPRDCLVLCYAFFGFAILINVVKDGLGNRWGRFVPL  467

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++  +A+AF  AVASGLICGDGIWTLP S+
Sbjct  468  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERLDAPRAEAFATAVASGLICGDGIWTLPSSV  527

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV+PPICMKFLS + N RVD FL 
Sbjct  528  LAIAGVEPPICMKFLSSETNHRVDKFLQ  555



>gb|KHG02257.1| putative metal-nicotianamine transporter YSL5 -like protein [Gossypium 
arboreum]
Length=696

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+Y AP   V+RNM++LGV+GFSALPK+CL LCY+FF  AI+IN ++D +GKKW  +IP
Sbjct  545  GSQYAAPFGIVYRNMSVLGVQGFSALPKDCLLLCYVFFGAAILINSIKDMLGKKWGSYIP  604

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YFAIDM VG++ILFVW+K+N+ KA AF PAVASGLICGDGIWTLP S
Sbjct  605  LPMAMAIPFYLGPYFAIDMCVGSLILFVWEKLNKEKAAAFAPAVASGLICGDGIWTLPSS  664

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILALAGV+PPICMKFLSR  N RVD FL+
Sbjct  665  ILALAGVQPPICMKFLSRATNARVDNFLN  693



>ref|XP_009135544.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Brassica rapa]
Length=423

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  274  SEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFGVAILVNIVKDSLPSRWGRFVPL  333

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA AFG AVASGLICGDGIW+LP S+
Sbjct  334  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAGAFGTAVASGLICGDGIWSLPSSV  393

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFL    N++VD FLH
Sbjct  394  LAIAGVSPPVCMKFLDAATNSKVDKFLH  421



>ref|XP_008393519.1| PREDICTED: probable metal-nicotianamine transporter YSL7 [Malus 
domestica]
Length=733

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YP+P A V+RN+A+L VEG  +LPKNCL LC IFF  AI IN ++D +GKK  RF+PL
Sbjct  582  SAYPSPFAVVYRNIAVLAVEGVKSLPKNCLLLCGIFFGAAIAINVLKDCLGKKRGRFVPL  641

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFY+GSYFAIDM +G++I+F+W ++N+AKADAF PAVASGLICGDG WTLP SI
Sbjct  642  PMAMAIPFYLGSYFAIDMCIGSLIVFLWGRVNKAKADAFVPAVASGLICGDGTWTLPASI  701

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LALAGV+PPICMKFLS   NTRVD F+
Sbjct  702  LALAGVQPPICMKFLSSSQNTRVDAFI  728



>ref|XP_002891428.1| hypothetical protein ARALYDRAFT_473974 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67687.1| hypothetical protein ARALYDRAFT_473974 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP++CL LCY FF  A +IN ++DG+G +W RF+PL
Sbjct  571  SEYPAPFATVYRSMAKLGVEGVSSLPRDCLVLCYSFFAVAGLINLIKDGLGNRWGRFVPL  630

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILFVW++++  KA+AF  AVASGLICGDGIWTLP S+
Sbjct  631  PMAMAIPFFLGPYFAIDMCVGSLILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSV  690

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL 
Sbjct  691  LAIAGVKPPICMKFLSGATNHRVDKFLQ  718



>gb|KCW83949.1| hypothetical protein EUGRSUZ_B00833 [Eucalyptus grandis]
Length=281

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEY AP+  V+R+MA LGVEGF++LP++ LTLC  F   A++ING +D VGKKW  FIP
Sbjct  145  GSEYLAPHGIVYRSMAELGVEGFTSLPEHYLTLCCGFLAVAMIINGFKDLVGKKWVHFIP  204

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFYIG YFAIDM VG++ILF+W+K ++AK DAFGPAVASGLICGDGIWTLP S
Sbjct  205  LPMAMAIPFYIGPYFAIDMCVGSLILFIWEKTDKAKVDAFGPAVASGLICGDGIWTLPSS  264

Query  328  ILALAGVKPPICMKFL  281
            ILALAGV PPICMKFL
Sbjct  265  ILALAGVNPPICMKFL  280



>gb|EMT18807.1| Putative metal-nicotianamine transporter YSL12 [Aegilops tauschii]
Length=678

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+YPAP A V+RNMAI GV+GFS+LPK+CLTLC + F  A+VIN  RD   +K +RFI
Sbjct  523  SGSDYPAPYAVVYRNMAIFGVQGFSSLPKHCLTLCCVVFAAAVVINLARDLAPEKVSRFI  582

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFY+GSYFAIDM VG+ ILFVW+K+++A AD F  +VASGLICG+GIW++P 
Sbjct  583  PVPMAMAIPFYLGSYFAIDMCVGSAILFVWEKVDKAGADMFARSVASGLICGEGIWSMPQ  642

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            S+LALA V+PPICMKFLSR  N RVD F+ 
Sbjct  643  SVLALAKVQPPICMKFLSRSTNARVDAFIQ  672



>gb|AAS00697.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
Length=724

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP++CL LCY+FF  AI+IN ++D +G +W RF+PL
Sbjct  574  SEYPAPFATVYRSMAKLGVEGVSSLPRDCLMLCYVFFGVAILINLIKDCLGNRWGRFVPL  633

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+ ILFVW++++  KA+AF  AVASGLICGDGIWTLP S+
Sbjct  634  PMAMAIPFFLGPYFAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSV  693

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL 
Sbjct  694  LAIAGVKPPICMKFLSAATNHRVDKFLQ  721



>emb|CDY31630.1| BnaA06g20330D [Brassica napus]
Length=306

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARF  515
            K G   P     V+RNM+ILGVEGFSALPK+CL LCYIFF  A+ +NG++D VG  WARF
Sbjct  154  KPGQHIPHLTRLVYRNMSILGVEGFSALPKHCLMLCYIFFAAAVFLNGLKDLVGPNWARF  213

Query  514  IPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLP  335
             PL MAMAI F+IG YF I M VG++ILF+W+K+N  KADA+  AVASGLICG+GIWTLP
Sbjct  214  TPLRMAMAISFHIGGYFTIYMCVGSLILFIWRKLNGLKADAYSSAVASGLICGEGIWTLP  273

Query  334  DSILALAGVKPPICMKFLSRKDNTRVDTFLHP  239
             S++ALAGVKPPICMKFLS   N +VD+F  P
Sbjct  274  SSVVALAGVKPPICMKFLSGGTNVKVDSFSTP  305


 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  646  MAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLPMAMAIPFYIGSY  467
            M+ILGVEGFSALPK+CL LCYIFF  A+ +NG++D VG  WARFIPLPMAMAI F+IG Y
Sbjct  1    MSILGVEGFSALPKHCLMLCYIFFAAAVFVNGLKDLVGPNWARFIPLPMAMAISFHIGGY  60

Query  466  FAIDMFVG  443
            F I M VG
Sbjct  61   FTISMCVG  68



>ref|NP_564525.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
 sp|Q6R3K4.2|YSL8_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL8; 
AltName: Full=Protein YELLOW STRIPE LIKE 8; Short=AtYSL8 [Arabidopsis 
thaliana]
 gb|AAK62655.1| At1g48370/F11A17_27 [Arabidopsis thaliana]
 gb|AAQ65095.1| At1g48370/F11A17_27 [Arabidopsis thaliana]
 gb|AEE32281.1| metal-nicotianamine transporter YSL8 [Arabidopsis thaliana]
Length=724

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP++CL LCY+FF  AI+IN ++D +G +W RF+PL
Sbjct  574  SEYPAPFATVYRSMAKLGVEGVSSLPRDCLMLCYVFFGVAILINLIKDCLGNRWGRFVPL  633

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+ ILFVW++++  KA+AF  AVASGLICGDGIWTLP S+
Sbjct  634  PMAMAIPFFLGPYFAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSV  693

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL 
Sbjct  694  LAIAGVKPPICMKFLSAATNHRVDKFLQ  721



>ref|XP_010487657.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=711

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  KW RFIPL
Sbjct  561  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFSVAILVNIVKDSLKSKWGRFIPL  620

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  621  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  680

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N++VD FL
Sbjct  681  LAIAGVNPPVCMKFLSAATNSKVDNFL  707



>ref|XP_010465820.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X2 [Camelina sativa]
Length=711

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  KW RFIPL
Sbjct  561  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFSVAILVNIVKDSLKSKWGRFIPL  620

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  621  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  680

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N++VD FL
Sbjct  681  LAIAGVNPPVCMKFLSAATNSKVDNFL  707



>ref|XP_010505667.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Camelina sativa]
Length=711

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  KW RFIPL
Sbjct  561  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFSVAILVNIVKDSLKSKWGRFIPL  620

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  621  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  680

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N++VD FL
Sbjct  681  LAIAGVNPPVCMKFLSAATNSKVDHFL  707



>gb|AAD49762.2|AC007932_10 F11A17.8 [Arabidopsis thaliana]
Length=803

 Score =   217 bits (553),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP++CL LCY+FF  AI+IN ++D +G +W RF+PL
Sbjct  653  SEYPAPFATVYRSMAKLGVEGVSSLPRDCLMLCYVFFGVAILINLIKDCLGNRWGRFVPL  712

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+ ILFVW++++  KA+AF  AVASGLICGDGIWTLP S+
Sbjct  713  PMAMAIPFFLGPYFAIDMCVGSFILFVWERLDAPKAEAFATAVASGLICGDGIWTLPSSV  772

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL 
Sbjct  773  LAIAGVKPPICMKFLSAATNHRVDKFLQ  800



>gb|KJB26835.1| hypothetical protein B456_004G262100 [Gossypium raimondii]
Length=697

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GS+Y AP   V+RNM++LGV+GFSALPK+CL LCY+FF  AI+IN ++D +GKKW   IP
Sbjct  546  GSQYAAPFGIVYRNMSVLGVQGFSALPKDCLLLCYVFFGAAILINSIKDMLGKKWGSCIP  605

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YFAIDM VG++ILFVW+K+N+ KA AF PAVASGLICGDGIWTLP S
Sbjct  606  LPMAMAIPFYLGPYFAIDMCVGSLILFVWEKLNKEKAAAFAPAVASGLICGDGIWTLPSS  665

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            ILALAGV+PPICMKFLSR  N RVD FL+
Sbjct  666  ILALAGVQPPICMKFLSRATNARVDNFLN  694



>ref|NP_001185810.1| yellow stripe-like transporter 11 [Zea mays]
 gb|ADO20998.1| yellow stripe-like transporter 11 [Zea mays]
Length=714

 Score =   216 bits (551),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G  YPAP A ++RNM+ILGV+G S LPKNCLTLCYIFF  +  IN ++D V KK A+FI
Sbjct  564  SGGAYPAPYAIMYRNMSILGVDGLSLLPKNCLTLCYIFFAVSFTINLIKDLVPKKVAKFI  623

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMA AIPFY+G YFAIDMF+G+VILF W+  N+A+AD+FGPAVASGL+CGDG+W LP 
Sbjct  624  PIPMAAAIPFYLGPYFAIDMFLGSVILFFWEWKNKAEADSFGPAVASGLMCGDGLWALPQ  683

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ++L+LA VKPPICMKFLSR  N +VDTFL
Sbjct  684  AVLSLANVKPPICMKFLSRSLNAKVDTFL  712



>ref|XP_009107360.1| PREDICTED: probable metal-nicotianamine transporter YSL8 [Brassica 
rapa]
 emb|CDY41835.1| BnaA08g03300D [Brassica napus]
Length=718

 Score =   216 bits (551),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S+YPAP A V+R+MA LGVEG S+LP++CL LCY FF  AI+IN V+DG+G +W R++PL
Sbjct  568  SKYPAPFATVYRSMAKLGVEGVSSLPRDCLVLCYAFFGFAILINVVKDGLGNRWGRYVPL  627

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++  +A+AF  AVASGLICGDGIWTLP S+
Sbjct  628  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERLDAPRAEAFATAVASGLICGDGIWTLPSSV  687

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV+PPICMKFLS + N RVD FL 
Sbjct  688  LAIAGVEPPICMKFLSSETNHRVDKFLQ  715



>gb|EMS64344.1| putative metal-nicotianamine transporter YSL12 [Triticum urartu]
Length=561

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +GS+YPAP A V+RNMAI GV+GFS+LPK+CLTLC + F  A+VIN  RD   +K +RF+
Sbjct  406  SGSDYPAPYAVVYRNMAIFGVQGFSSLPKHCLTLCCVVFAAAVVINLARDLAPEKVSRFM  465

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMAMAIPFY+GSYFAIDM VG+ ILFVW+++++A AD F  +VASGLICG+GIW++P 
Sbjct  466  PVPMAMAIPFYLGSYFAIDMCVGSAILFVWERVDKAGADMFARSVASGLICGEGIWSMPQ  525

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            S+LALA V+PPICMKFLSR  N RVD F+ 
Sbjct  526  SVLALAKVQPPICMKFLSRSTNARVDAFIQ  555



>ref|XP_004978146.1| PREDICTED: probable metal-nicotianamine transporter YSL12-like 
[Setaria italica]
Length=705

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A V+RNMAILGV+GFS LPK+CLTLC +FFVGAI +N  +D   +K AR IPL
Sbjct  555  SAYPAPYAIVYRNMAILGVDGFSKLPKHCLTLCCVFFVGAIALNMAKDLAPRKVARLIPL  614

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAM IPFYIGSYFAIDMF+G+VILF W+ +++A+ADAFG AVASGLICGDG+WTLP ++
Sbjct  615  PMAMGIPFYIGSYFAIDMFLGSVILFAWEWVDKAQADAFGYAVASGLICGDGVWTLPQAV  674

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            L+L  VKPPICMKFLSR  N +VD F+
Sbjct  675  LSLFNVKPPICMKFLSRGVNYKVDDFI  701



>ref|XP_010240603.1| PREDICTED: probable metal-nicotianamine transporter YSL10 [Brachypodium 
distachyon]
Length=518

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G   LPK+CL LC  FFVGAI +N  RD VG   ARF+P
Sbjct  365  GSEYPSPNALVYRNMAILGVQGIGTLPKHCLQLCIGFFVGAIAMNLARDVVGPSAARFVP  424

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G++I FVW +++ AKA  F P VASGLICG+GIWTLP S
Sbjct  425  LPMAMAIPFYLGPYFGIDMCIGSLIRFVWDRVDSAKAGVFAPPVASGLICGEGIWTLPQS  484

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGV PPICMKFLSR +N +VD  +
Sbjct  485  LLALAGVHPPICMKFLSRANNAKVDAII  512



>ref|XP_006406708.1| hypothetical protein EUTSA_v10020160mg [Eutrema salsugineum]
 dbj|BAJ33889.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48161.1| hypothetical protein EUTSA_v10020160mg [Eutrema salsugineum]
Length=716

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  +W RFIPL
Sbjct  565  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFSVAILVNIVKDSLWSRWGRFIPL  624

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  625  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  684

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFLS   N++VD FL 
Sbjct  685  LAIAGVNPPVCMKFLSAATNSKVDNFLK  712



>gb|EMS55053.1| putative metal-nicotianamine transporter YSL10 [Triticum urartu]
Length=706

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC +FFVGAIV+N  RD  G   A+FIP
Sbjct  551  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIVFFVGAIVVNLARDLAGPNIAQFIP  610

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G++I FVW  ++ A+A AF P VASGLICGDGIWTLP S
Sbjct  611  LPMAMAIPFYLGPYFGIDMCIGSLIRFVWDHVDGARAKAFAPPVASGLICGDGIWTLPQS  670

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGV+PPICMKFL R  N +V+ F+
Sbjct  671  VLALAGVRPPICMKFLPRATNIQVEAFI  698



>ref|XP_006297072.1| hypothetical protein CARUB_v10013074mg [Capsella rubella]
 gb|EOA29970.1| hypothetical protein CARUB_v10013074mg [Capsella rubella]
Length=714

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI+IN V+D +  +W RFIPL
Sbjct  564  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFGVAILINIVKDSLQSRWGRFIPL  623

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ A A+AFG AVASGLICGDGIW+LP S+
Sbjct  624  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAANAEAFGTAVASGLICGDGIWSLPSSV  683

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFLS   N++VD FL 
Sbjct  684  LAIAGVNPPVCMKFLSTATNSKVDNFLQ  711



>sp|Q0J932.2|YSL10_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL10; 
AltName: Full=Protein YELLOW STRIPE LIKE 10; Short=OsYSL10 
[Oryza sativa Japonica Group]
 dbj|BAE91890.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAG91535.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61895.1| hypothetical protein OsJ_16603 [Oryza sativa Japonica Group]
Length=686

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC  FFV AI +N  RD    K ARF+P
Sbjct  533  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAAPKVARFLP  592

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G++I FVW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  593  LPMAMAIPFYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQS  652

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGVKPPICMKFLSR  N +VD F+
Sbjct  653  VLALAGVKPPICMKFLSRTTNIKVDAFI  680



>ref|XP_006653020.1| PREDICTED: probable metal-nicotianamine transporter YSL10-like 
[Oryza brachyantha]
Length=694

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC  FFV AI +N  RD  G K ARF+P
Sbjct  540  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAGPKVARFVP  599

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G+++  VW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  600  LPMAMAIPFYLGPYFGIDMCIGSLVRLVWDRLDSARAKAFAPPVASGLICGDGIWTLPQS  659

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGVKPPICMKFL+R  N +VD FL
Sbjct  660  VLALAGVKPPICMKFLARGTNVKVDEFL  687



>emb|CAE03239.2| OSJNBa0018M05.14 [Oryza sativa Japonica Group]
Length=695

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC  FFV AI +N  RD    K ARF+P
Sbjct  542  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAAPKVARFLP  601

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G++I FVW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  602  LPMAMAIPFYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQS  661

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGVKPPICMKFLSR  N +VD F+
Sbjct  662  VLALAGVKPPICMKFLSRTTNIKVDAFI  689



>ref|NP_001054241.1| Os04g0674600 [Oryza sativa Japonica Group]
 dbj|BAF16155.1| Os04g0674600, partial [Oryza sativa Japonica Group]
Length=708

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC  FFV AI +N  RD    K ARF+P
Sbjct  555  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAAPKVARFLP  614

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G++I FVW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  615  LPMAMAIPFYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQS  674

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGVKPPICMKFLSR  N +VD F+
Sbjct  675  VLALAGVKPPICMKFLSRTTNIKVDAFI  702



>emb|CAJ86097.1| H0103C06.1 [Oryza sativa Indica Group]
 emb|CAH68189.1| H0403D02.17 [Oryza sativa Indica Group]
Length=700

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC  FFV AI +N  RD    K ARF+P
Sbjct  547  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAAPKVARFLP  606

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G++I FVW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  607  LPMAMAIPFYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQS  666

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGVKPPICMKFLSR  N +VD F+
Sbjct  667  VLALAGVKPPICMKFLSRTTNIKVDAFI  694



>emb|CBG76262.1| OO_Ba0005L10-OO_Ba0081K17.13 [Oryza officinalis]
Length=691

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC  FFV AI +N  RD    K ARF+P
Sbjct  538  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAAPKVARFLP  597

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G+++ FVW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  598  LPMAMAIPFYLGPYFGIDMCIGSLVRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQS  657

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGVKPPICMKFLSR  N +VD F+
Sbjct  658  VLALAGVKPPICMKFLSRSTNLKVDAFI  685



>emb|CDY46890.1| BnaA01g27900D [Brassica napus]
Length=715

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  566  SEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFSVAILVNIVKDSLPSRWGRFVPL  625

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA+AFG AVASGLICGDGIW+ P S+
Sbjct  626  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAEAFGTAVASGLICGDGIWSFPSSV  685

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N+RVD+FL
Sbjct  686  LAIAGVNPPVCMKFLSAATNSRVDSFL  712



>ref|XP_009113863.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Brassica rapa]
Length=714

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  565  SEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFSVAILVNIVKDSLPSRWGRFVPL  624

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA+AFG AVASGLICGDGIW+ P S+
Sbjct  625  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAEAFGTAVASGLICGDGIWSFPSSV  684

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N+RVD+FL
Sbjct  685  LAIAGVNPPVCMKFLSAATNSRVDSFL  711



>gb|EMT25295.1| Putative metal-nicotianamine transporter YSL10 [Aegilops tauschii]
Length=875

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC +FFVGAIV+N  RD  G   A+FIP
Sbjct  720  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIVFFVGAIVVNLARDLAGPNIAQFIP  779

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G++I FVW  ++ A+A AF P VASGLICGDGIWTLP S
Sbjct  780  LPMAMAIPFYLGPYFGIDMCIGSLIRFVWDHVDGARAKAFAPPVASGLICGDGIWTLPQS  839

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGV+PPICMKFL R  N +V+ F+
Sbjct  840  VLALAGVRPPICMKFLPRATNIQVEAFI  867



>gb|EEC78242.1| hypothetical protein OsI_17899 [Oryza sativa Indica Group]
Length=691

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LPK+CL LC  FFV AI +N  RD    K ARF+P
Sbjct  538  GSEYPSPNALVYRNMAILGVQGLGSLPKHCLDLCIGFFVAAIAVNLARDLAAPKVARFLP  597

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G++I FVW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  598  LPMAMAIPFYLGPYFGIDMCIGSLIRFVWDRLDGARAKAFAPPVASGLICGDGIWTLPQS  657

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LALAGVKPPICMKFLSR  N +VD F+
Sbjct  658  VLALAGVKPPICMKFLSRTTNIKVDAFI  685



>emb|CDX82356.1| BnaA03g34650D [Brassica napus]
Length=628

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  479  SEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFGVAILVNIVKDSLPSRWGRFVPL  538

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA AFG AVASGLICGDGIW+LP S+
Sbjct  539  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAGAFGTAVASGLICGDGIWSLPSSV  598

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFL    N++VD FLH
Sbjct  599  LAIAGVSPPVCMKFLDAATNSKVDKFLH  626



>gb|KFK39092.1| hypothetical protein AALP_AA3G199800 [Arabis alpina]
Length=721

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI+IN V+D +  KW RFIPL
Sbjct  571  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFGVAILINIVKDSLWSKWGRFIPL  630

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++  KA+A+G AVASGLICGDGIW+LP S+
Sbjct  631  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAGKAEAYGTAVASGLICGDGIWSLPSSV  690

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N++VD FL
Sbjct  691  LAIAGVNPPVCMKFLSSATNSKVDMFL  717



>ref|XP_002883075.1| hypothetical protein ARALYDRAFT_479246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59334.1| hypothetical protein ARALYDRAFT_479246 [Arabidopsis lyrata subsp. 
lyrata]
Length=714

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            +EYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RFIPL
Sbjct  564  TEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFGVAILVNIVKDSLQSQWGRFIPL  623

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  624  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  683

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFLS   N++VD FL 
Sbjct  684  LAIAGVNPPVCMKFLSAATNSKVDNFLQ  711



>emb|CDY46051.1| BnaC01g34980D [Brassica napus]
Length=960

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  567  SEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFSVAILVNIVKDSLPSRWGRFVPL  626

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA+AFG AVASGLICGDGIW+ P S+
Sbjct  627  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAEAFGTAVASGLICGDGIWSFPSSV  686

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N+RVD+FL
Sbjct  687  LAIAGVNPPVCMKFLSAATNSRVDSFL  713



>ref|XP_009135543.1| PREDICTED: probable metal-nicotianamine transporter YSL5 isoform 
X1 [Brassica rapa]
Length=713

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  564  SEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFGVAILVNIVKDSLPSRWGRFVPL  623

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA AFG AVASGLICGDGIW+LP S+
Sbjct  624  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAGAFGTAVASGLICGDGIWSLPSSV  683

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFL    N++VD FLH
Sbjct  684  LAIAGVSPPVCMKFLDAATNSKVDKFLH  711



>gb|AAL09744.1| AT3g17650/MKP6_20 [Arabidopsis thaliana]
 gb|AAN46868.1| At3g17650/MKP6_20 [Arabidopsis thaliana]
Length=714

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            +EYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +   W RFIPL
Sbjct  564  TEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFGVAILVNIVKDSLHSNWGRFIPL  623

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  624  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  683

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N++VD FL
Sbjct  684  LAIAGVNPPVCMKFLSSATNSKVDNFL  710



>ref|NP_566584.1| putative metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
 sp|Q9LUN2.1|YSL5_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL5; 
AltName: Full=Protein YELLOW STRIPE LIKE 5; Short=AtYSL5 [Arabidopsis 
thaliana]
 dbj|BAB02055.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS00694.1| metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
 gb|AEE75985.1| putative metal-nicotianamine transporter YSL5 [Arabidopsis thaliana]
Length=714

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            +EYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +   W RFIPL
Sbjct  564  TEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFGVAILVNIVKDSLHSNWGRFIPL  623

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  624  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  683

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            LA+AGV PP+CMKFLS   N++VD FL
Sbjct  684  LAIAGVNPPVCMKFLSSATNSKVDNFL  710



>gb|ABB76762.1| YSL transporter 2 [Noccaea caerulescens]
 gb|ABD04074.1| YSL transporter 2 [Noccaea caerulescens]
Length=716

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            +EYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI++N V+D +  +W RFIPL
Sbjct  566  TEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFGVAILVNIVKDSLWSRWGRFIPL  625

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILF+W++++ AKA+AFG AVASGLICGDGIW+LP S+
Sbjct  626  PMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAEAFGTAVASGLICGDGIWSLPSSV  685

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGV PP+CMKFL    N +VD FL 
Sbjct  686  LAIAGVNPPVCMKFLPAATNLKVDNFLQ  713



>ref|XP_002446810.1| hypothetical protein SORBIDRAFT_06g023020 [Sorghum bicolor]
 gb|EES11138.1| hypothetical protein SORBIDRAFT_06g023020 [Sorghum bicolor]
Length=723

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            +G  YPAP A ++RNM+ILGV+G S LPKNCLTLCYIFF  +  IN ++D + +K A+FI
Sbjct  573  SGGAYPAPYAIMYRNMSILGVDGLSLLPKNCLTLCYIFFAVSFAINLIKDLLPQKVAKFI  632

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMA AIPFY+G YFAIDMF+G+VILF W+  N+A+AD F PAVASGL+CGDG+W LP 
Sbjct  633  PIPMAAAIPFYLGPYFAIDMFLGSVILFFWEWKNKAEADTFTPAVASGLMCGDGLWALPQ  692

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ++L+LA V PPICMKFLSR  N +VDTFL
Sbjct  693  AVLSLANVNPPICMKFLSRSVNAKVDTFL  721



>ref|XP_010549024.1| PREDICTED: probable metal-nicotianamine transporter YSL8 isoform 
X1 [Tarenaya hassleriana]
Length=703

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG S+LP+ CL LCY FF  AI+IN ++DG+G +W RF+PL
Sbjct  553  SEYPAPFATVYRSMAKLGVEGVSSLPRECLVLCYAFFGAAILINMMKDGLGNRWGRFVPL  612

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG++ILFVW++++ AKA+AF PAVASGLICGDGIWTLP S+
Sbjct  613  PMAMAIPFFLGPYFAIDMCVGSLILFVWERVDAAKAEAFAPAVASGLICGDGIWTLPSSV  672

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFLH  242
            LA+AGVKPPICMKFLS   N RVD FL 
Sbjct  673  LAIAGVKPPICMKFLSGATNARVDQFLQ  700



>ref|XP_003581443.2| PREDICTED: probable metal-nicotianamine transporter YSL11 [Brachypodium 
distachyon]
Length=633

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            + S YPAP + ++RNMAILGV+G S LPK+CLTLCYIFF  A   N ++D V  K ++FI
Sbjct  483  SDSAYPAPYSIMYRNMAILGVDGLSVLPKHCLTLCYIFFAAAFATNLIKDLVPNKVSKFI  542

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMA+AIPFY+G YFAIDM +G+VILF W+ +N+A+A AF PAVASGL+CGDGIW LP 
Sbjct  543  PIPMAVAIPFYLGPYFAIDMSIGSVILFCWEWMNKAEAQAFAPAVASGLMCGDGIWALPQ  602

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +IL+LA V PPICMKFLSR  N +VD FL
Sbjct  603  AILSLANVNPPICMKFLSRAANAKVDAFL  631



>ref|XP_002446812.1| hypothetical protein SORBIDRAFT_06g023040 [Sorghum bicolor]
 gb|EES11140.1| hypothetical protein SORBIDRAFT_06g023040 [Sorghum bicolor]
Length=753

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A ++RNMAILGV+GFS LP NCLTLC +FFVGAI +N  +D V +K A+FIPL
Sbjct  603  SAYPAPYALIYRNMAILGVDGFSKLPGNCLTLCCVFFVGAIAVNMAKDMVPEKVAKFIPL  662

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YF IDMF+G+VILF W+ +++ +A+AF  AVASGLICGDG+W+LP + 
Sbjct  663  PMAMAIPFYIGPYFTIDMFLGSVILFAWEWVDKDQANAFAYAVASGLICGDGVWSLPQAF  722

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            L+L  VKPPICMKFLSR  N +VD F+
Sbjct  723  LSLFNVKPPICMKFLSRNLNDKVDGFI  749



>ref|XP_004976284.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like 
[Setaria italica]
Length=712

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -2

Query  679  YPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLPM  500
            YPAP   ++RNMAILGV+G S LPK+CLTLCYIFF  +  IN ++D V +K A+FIP+PM
Sbjct  566  YPAPYTIMYRNMAILGVDGLSLLPKHCLTLCYIFFAISFAINLIKDQVPEKVAKFIPIPM  625

Query  499  AMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSILA  320
            A AIPFY+G YFAIDMF+G+VILF W+  N+A+A +FGPAVASGL+CGDG+W LP ++L+
Sbjct  626  AAAIPFYLGPYFAIDMFLGSVILFFWEWKNKAEATSFGPAVASGLMCGDGLWALPQAVLS  685

Query  319  LAGVKPPICMKFLSRKDNTRVDTFL  245
            LA V PPICMKFLSR  N +VD+FL
Sbjct  686  LANVNPPICMKFLSRSVNAKVDSFL  710



>ref|XP_008669135.1| PREDICTED: probable metal-nicotianamine transporter YSL11 [Zea 
mays]
Length=727

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            T   YPAP   ++RNMAI+GV+G S LPK+CLTL YIFF  A  +N V+D V KK A+FI
Sbjct  578  TNGAYPAPYTFMYRNMAIMGVDGLS-LPKHCLTLSYIFFAAAFAVNMVKDLVPKKVAKFI  636

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMA+AIPFY+G+YF IDMF+G  ILF+W+  N+A+AD+FGPAVASG +CGDG+W LP+
Sbjct  637  PIPMAVAIPFYVGAYFTIDMFLGCTILFIWEMRNKAEADSFGPAVASGCMCGDGLWALPE  696

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +IL+LA VKPPICMKFLSR  N RVD+FL
Sbjct  697  AILSLANVKPPICMKFLSRSVNARVDSFL  725



>ref|XP_008663393.1| PREDICTED: probable metal-nicotianamine transporter YSL12 [Zea 
mays]
Length=631

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A ++RNMAILGV+GFS LP NCLTLC +FFVGAI ++  RD   +K A+F+PL
Sbjct  481  SAYPAPYALIYRNMAILGVDGFSKLPDNCLTLCCVFFVGAIAVDMARDMAPEKVAKFVPL  540

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YFAIDMF+G+V+LF W+ +++ +A+ F  AVASGLICGDG+W+LP ++
Sbjct  541  PMAMAIPFYIGPYFAIDMFLGSVVLFAWEWVDKDQANFFAYAVASGLICGDGVWSLPQAL  600

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            L+L  VKPPICMKFLSR  N +VD F+
Sbjct  601  LSLFNVKPPICMKFLSRHMNDKVDDFI  627



>ref|XP_004978145.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like 
[Setaria italica]
Length=725

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            + S YPAP   ++RNMAI+GV+G S LPK+CLTLCYIFF  +  IN ++D + KK A+FI
Sbjct  575  SNSAYPAPYTIMYRNMAIMGVDGLS-LPKHCLTLCYIFFAASFAINLIKDLMPKKVAKFI  633

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMA+AIPFY+G+YF IDMF+G VILF+W+  N+A+AD+ GPAVASG +CGDG+W LP+
Sbjct  634  PIPMAVAIPFYVGAYFTIDMFLGCVILFIWEWKNKAEADSLGPAVASGFMCGDGLWALPE  693

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            ++L+LA VKPPICMKFLSR  N +VD+FL
Sbjct  694  AVLSLANVKPPICMKFLSRSVNAKVDSFL  722



>gb|AFW58894.1| hypothetical protein ZEAMMB73_605066 [Zea mays]
Length=737

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            S YPAP A ++RNMAILGV+GFS LP NCLTLC +FFVGAI ++  RD   +K A+F+PL
Sbjct  587  SAYPAPYALIYRNMAILGVDGFSKLPDNCLTLCCVFFVGAIAVDMARDMAPEKVAKFVPL  646

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIG YFAIDMF+G+V+LF W+ +++ +A+ F  AVASGLICGDG+W+LP ++
Sbjct  647  PMAMAIPFYIGPYFAIDMFLGSVVLFAWEWVDKDQANFFAYAVASGLICGDGVWSLPQAL  706

Query  325  LALAGVKPPICMKFLSRKDNTRVDTFL  245
            L+L  VKPPICMKFLSR  N +VD F+
Sbjct  707  LSLFNVKPPICMKFLSRHMNDKVDDFI  733



>gb|EMT17260.1| Putative metal-nicotianamine transporter YSL11 [Aegilops tauschii]
Length=645

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  691  TGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFI  512
            + S YPAP A ++RNMAILGV+G S LPKNCL LCYIFF  A  +N ++D V  K A+FI
Sbjct  495  SDSAYPAPYAIMYRNMAILGVDGLSVLPKNCLMLCYIFFAAAFAVNLLKDCVPAKVAKFI  554

Query  511  PLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPD  332
            P+PMA+AIPFY+G YFA+DM +G+ ILF W+ +N+A+A AF PAVASGL+CGDGIW LP 
Sbjct  555  PIPMAVAIPFYLGPYFAMDMCIGSAILFCWEWMNKAEAQAFAPAVASGLMCGDGIWALPQ  614

Query  331  SILALAGVKPPICMKFLSRKDNTRVDTFL  245
            + L+LA V PPICMKFLSR  N +VD FL
Sbjct  615  AFLSLANVNPPICMKFLSRATNAKVDAFL  643



>ref|XP_008805741.1| PREDICTED: probable metal-nicotianamine transporter YSL14 [Phoenix 
dactylifera]
Length=683

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = -2

Query  694  KTGSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVG-KKW--  524
              GSEYPAP A V+R +A+LGVEGFS+LPKNC+ LC IFF  AI IN +++  G KKW  
Sbjct  527  SEGSEYPAPYAKVYRGIALLGVEGFSSLPKNCMNLCVIFFSLAIAINALKEVAGHKKWRI  586

Query  523  ARFIPLPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIW  344
            +R++P  M MAIPFY+GSYF IDM VG++ILFVW+++N+  AD F PA+ASGLICGDGIW
Sbjct  587  SRYVPSAMGMAIPFYLGSYFTIDMCVGSLILFVWERMNKRHADIFAPALASGLICGDGIW  646

Query  343  TLPDSILALAGVKPPICMKFLSRKDNTRVDTFL  245
            +LP S+LALA V PPICM FLSR D   VD FL
Sbjct  647  SLPASLLALAKVNPPICMGFLSRADKAMVDAFL  679



>ref|XP_008780540.1| PREDICTED: probable metal-nicotianamine transporter YSL12, partial 
[Phoenix dactylifera]
Length=343

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAPNA +FRN+AILGV+GFS+LPK+CLTLC IFF  AI+IN +RD   KK ARFIPL
Sbjct  224  SEYPAPNALIFRNIAILGVDGFSSLPKHCLTLCCIFFAAAILINLIRDLSPKKVARFIPL  283

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPFYIGSYFAIDM VG++ILFVW+KIN+ +ADAFGPAVASGLICG G+WTLP+S+
Sbjct  284  PMAMAIPFYIGSYFAIDMCVGSLILFVWEKINKTQADAFGPAVASGLICGHGMWTLPESL  343



>ref|XP_006653609.1| PREDICTED: probable metal-nicotianamine transporter YSL11-like, 
partial [Oryza brachyantha]
Length=670

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  679  YPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLPM  500
            YPAP   ++RNMAILGV G S+LPK CLTLCYI F  A  IN ++D V +K A+FIP+PM
Sbjct  524  YPAPYTIMYRNMAILGVNGLSSLPKYCLTLCYISFAAAFTINLIKDLVPEKVAKFIPIPM  583

Query  499  AMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSILA  320
            A AIPFY+G YFAIDMF+G+ ILF+W++ N+ +A +FGPAVASGL+CGDG+W LP++IL+
Sbjct  584  AAAIPFYLGPYFAIDMFIGSAILFIWERRNKDEAQSFGPAVASGLMCGDGLWALPEAILS  643

Query  319  LAGVKPPICMKFLSRKDNTRVDTFL  245
            L  + PP+CMKFLSR  N +VDTFL
Sbjct  644  LVNLNPPLCMKFLSRAANAKVDTFL  668



>emb|CDY68937.1| BnaCnng61140D, partial [Brassica napus]
Length=735

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  685  SEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPL  506
            SEYPAP A V+R+MA LGVEG ++LP+ CL LCY FF  AI++N V+D +  +W RF+PL
Sbjct  563  SEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFGVAILVNIVKDSLPSRWGRFVPL  622

Query  505  PMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSI  326
            PMAMAIPF++G YFAIDM VG+++LFVW++++ AKA AFG AVASGLICGDGIW+LP S+
Sbjct  623  PMAMAIPFFLGPYFAIDMCVGSLVLFVWERVDAAKAGAFGTAVASGLICGDGIWSLPSSV  682

Query  325  LALAGVKPPICMKFLSRKDNTR  260
            LA+AGV PP+CMKFL    NT+
Sbjct  683  LAIAGVSPPVCMKFLDAATNTK  704



>ref|XP_002448760.1| hypothetical protein SORBIDRAFT_06g032720 [Sorghum bicolor]
 gb|EES13088.1| hypothetical protein SORBIDRAFT_06g032720 [Sorghum bicolor]
Length=688

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LP++CL LC  FF  AI IN  RD  G + A +IP
Sbjct  539  GSEYPSPNALVYRNMAILGVQGLGSLPRHCLDLCIAFFAAAIAINLARDLAGARAAAYIP  598

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G+++  VW +++ A++ AF P VASGLICGDGIWT+P S
Sbjct  599  LPMAMAIPFYLGPYFGIDMCIGSLVRLVWDRLDPARSKAFAPPVASGLICGDGIWTVPQS  658

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            +LALAGVKPPICMKFLSR  N +VD FLH
Sbjct  659  VLALAGVKPPICMKFLSRTTNAKVDAFLH  687



>gb|AFW59877.1| hypothetical protein ZEAMMB73_955581 [Zea mays]
Length=695

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LP++CL LC  FF  AI IN  RD  G + A +IP
Sbjct  546  GSEYPSPNALVYRNMAILGVQGLGSLPRHCLDLCIAFFAAAIAINLARDLAGARAAAYIP  605

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G+++  VW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  606  LPMAMAIPFYLGPYFGIDMCIGSLVRLVWDRLDPARAKAFAPPVASGLICGDGIWTLPQS  665

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            +LALAGVKPPICMKFLSR  N +VD FL 
Sbjct  666  VLALAGVKPPICMKFLSRSTNVKVDAFLR  694



>ref|XP_008663726.1| PREDICTED: LOW QUALITY PROTEIN: probable metal-nicotianamine 
transporter YSL10 [Zea mays]
Length=722

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  688  GSEYPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIP  509
            GSEYP+PNA V+RNMAILGV+G  +LP++CL LC  FF  AI IN  RD  G + A +IP
Sbjct  573  GSEYPSPNALVYRNMAILGVQGLGSLPRHCLDLCIAFFAAAIAINLARDLAGARAAAYIP  632

Query  508  LPMAMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDS  329
            LPMAMAIPFY+G YF IDM +G+++  VW +++ A+A AF P VASGLICGDGIWTLP S
Sbjct  633  LPMAMAIPFYLGPYFGIDMCIGSLVRLVWDRLDPARAKAFAPPVASGLICGDGIWTLPQS  692

Query  328  ILALAGVKPPICMKFLSRKDNTRVDTFLH  242
            +LALAGVKPPICMKFLSR  N +VD FL 
Sbjct  693  VLALAGVKPPICMKFLSRSTNVKVDAFLR  721



>dbj|BAE91891.1| hypothetical protein [Oryza sativa Japonica Group]
Length=712

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  679  YPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLPM  500
            YPAP   ++RNMAILGV G S+LPK CLTLCYI FV A +IN ++D V ++ A++IP+PM
Sbjct  566  YPAPYTIMYRNMAILGVNGLSSLPKYCLTLCYIAFVAAFIINLIKDLVPERVAKYIPIPM  625

Query  499  AMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSILA  320
            A AIPFY+G YFAIDMF+G+VIL+ W+  N+ +A +FGPAVASGL+CGDG+W LP ++L+
Sbjct  626  AAAIPFYLGPYFAIDMFMGSVILYFWEWRNKDEAQSFGPAVASGLMCGDGLWALPQAVLS  685

Query  319  LAGVKPPICMKFLSRKDNTRVDTFL  245
            L  V PP+CMKFLSR  N +VDTFL
Sbjct  686  LVNVNPPLCMKFLSRAANAKVDTFL  710



>sp|Q7X660.1|YSL11_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL11; 
AltName: Full=Protein YELLOW STRIPE LIKE 11; Short=OsYSL11 
[Oryza sativa Japonica Group]
 emb|CAE05635.1| OSJNBa0038O10.1 [Oryza sativa Japonica Group]
 emb|CAI44638.1| OSJNBb0065J09.18 [Oryza sativa Japonica Group]
 gb|EAZ31387.1| hypothetical protein OsJ_15515 [Oryza sativa Japonica Group]
Length=712

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  679  YPAPNAAVFRNMAILGVEGFSALPKNCLTLCYIFFVGAIVINGVRDGVGKKWARFIPLPM  500
            YPAP   ++RNMAILGV G S+LPK CLTLCYI FV A +IN ++D V ++ A++IP+PM
Sbjct  566  YPAPYTIMYRNMAILGVNGLSSLPKYCLTLCYIAFVAAFIINLIKDLVPERVAKYIPIPM  625

Query  499  AMAIPFYIGSYFAIDMFVGTVILFVWQKINRAKADAFGPAVASGLICGDGIWTLPDSILA  320
            A AIPFY+G YFAIDMF+G+VIL+ W+  N+ +A +FGPAVASGL+CGDG+W LP ++L+
Sbjct  626  AAAIPFYLGPYFAIDMFMGSVILYFWEWRNKDEAQSFGPAVASGLMCGDGLWALPQAVLS  685

Query  319  LAGVKPPICMKFLSRKDNTRVDTFL  245
            L  V PP+CMKFLSR  N +VDTFL
Sbjct  686  LVNVNPPLCMKFLSRAANAKVDTFL  710



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340