BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048O24

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788658.1|  PREDICTED: probable transaldolase                  298   7e-96   Nicotiana sylvestris
ref|XP_009626614.1|  PREDICTED: probable transaldolase                  296   2e-95   Nicotiana tomentosiformis
ref|XP_006355489.1|  PREDICTED: probable transaldolase-like             294   1e-94   Solanum tuberosum [potatoes]
emb|CDP09917.1|  unnamed protein product                                289   2e-92   Coffea canephora [robusta coffee]
gb|EYU30507.1|  hypothetical protein MIMGU_mgv1a007833mg                288   2e-92   Erythranthe guttata [common monkey flower]
ref|XP_011081206.1|  PREDICTED: probable transaldolase                  287   7e-92   Sesamum indicum [beniseed]
ref|XP_010259018.1|  PREDICTED: probable transaldolase                  282   1e-89   Nelumbo nucifera [Indian lotus]
ref|XP_003631434.1|  PREDICTED: probable transaldolase isoform X2       279   2e-88   Vitis vinifera
ref|XP_002266734.2|  PREDICTED: probable transaldolase                  278   2e-88   Vitis vinifera
ref|NP_001234076.1|  transaldolase ToTAL2                               278   3e-88   
ref|XP_003631436.1|  PREDICTED: probable transaldolase isoform X1       278   4e-88   Vitis vinifera
ref|XP_008238614.1|  PREDICTED: probable transaldolase                  276   2e-87   Prunus mume [ume]
ref|XP_007209231.1|  hypothetical protein PRUPE_ppa006960mg             275   2e-87   Prunus persica
ref|XP_010053436.1|  PREDICTED: probable transaldolase                  275   5e-87   Eucalyptus grandis [rose gum]
gb|KDP25631.1|  hypothetical protein JCGZ_20787                         275   5e-87   Jatropha curcas
ref|XP_010093688.1|  hypothetical protein L484_019027                   275   5e-87   Morus notabilis
ref|XP_010676173.1|  PREDICTED: probable transaldolase                  274   8e-87   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006368174.1|  hypothetical protein POPTR_0001s00260g             274   8e-87   Populus trichocarpa [western balsam poplar]
ref|XP_004298660.1|  PREDICTED: probable transaldolase                  273   1e-86   Fragaria vesca subsp. vesca
ref|XP_009350312.1|  PREDICTED: transaldolase-like                      266   2e-86   Pyrus x bretschneideri [bai li]
ref|XP_011018260.1|  PREDICTED: probable transaldolase                  273   3e-86   Populus euphratica
gb|KHG09888.1|  Transaldolase                                           273   3e-86   Gossypium arboreum [tree cotton]
gb|KJB37608.1|  hypothetical protein B456_006G212700                    266   6e-86   Gossypium raimondii
gb|EPS67513.1|  hypothetical protein M569_07263                         270   8e-86   Genlisea aurea
ref|XP_008373821.1|  PREDICTED: transaldolase                           266   1e-85   
ref|XP_007155630.1|  hypothetical protein PHAVU_003G218000g             271   1e-85   Phaseolus vulgaris [French bean]
gb|KJB84455.1|  hypothetical protein B456_N027100                       263   1e-85   Gossypium raimondii
gb|KJB37609.1|  hypothetical protein B456_006G212700                    267   2e-85   Gossypium raimondii
gb|ADG27842.1|  transaldolase                                           270   2e-85   Gossypium hirsutum [American cotton]
ref|XP_007039918.1|  Transaldolase isoform 1                            270   3e-85   
ref|XP_009343901.1|  PREDICTED: probable transaldolase                  269   6e-85   Pyrus x bretschneideri [bai li]
ref|XP_006440370.1|  hypothetical protein CICLE_v10020501mg             268   2e-84   Citrus clementina [clementine]
gb|KDO48369.1|  hypothetical protein CISIN_1g016178mg                   268   2e-84   Citrus sinensis [apfelsine]
ref|XP_006477245.1|  PREDICTED: probable transaldolase-like             268   2e-84   Citrus sinensis [apfelsine]
ref|XP_003525805.1|  PREDICTED: transaldolase-like                      268   2e-84   Glycine max [soybeans]
gb|KJB37607.1|  hypothetical protein B456_006G212700                    268   3e-84   Gossypium raimondii
gb|ACU24347.1|  unknown                                                 268   3e-84   Glycine max [soybeans]
ref|XP_009407153.1|  PREDICTED: probable transaldolase                  267   4e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007039919.1|  Transaldolase isoform 2                            261   9e-83   
ref|XP_009382350.1|  PREDICTED: probable transaldolase                  264   1e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010493876.1|  PREDICTED: probable transaldolase isoform X3       258   4e-82   
ref|XP_010493869.1|  PREDICTED: probable transaldolase isoform X2       258   4e-82   
ref|XP_010493866.1|  PREDICTED: probable transaldolase isoform X1       258   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_008437125.1|  PREDICTED: probable transaldolase                  262   4e-82   Cucumis melo [Oriental melon]
ref|XP_008787008.1|  PREDICTED: probable transaldolase                  261   7e-82   Phoenix dactylifera
ref|XP_004516847.1|  PREDICTED: transaldolase-like                      261   1e-81   Cicer arietinum [garbanzo]
gb|KHN09791.1|  Transaldolase                                           261   1e-81   Glycine soja [wild soybean]
ref|NP_001242359.1|  uncharacterized protein LOC100800377               261   2e-81   Glycine max [soybeans]
gb|KEH31658.1|  transaldolase total2 protein                            260   3e-81   Medicago truncatula
ref|XP_003608757.1|  Transaldolase                                      260   3e-81   Medicago truncatula
ref|XP_010919480.1|  PREDICTED: probable transaldolase                  259   7e-81   Elaeis guineensis
ref|XP_006307691.1|  hypothetical protein CARUB_v10009318mg             259   8e-81   Capsella rubella
ref|XP_008794812.1|  PREDICTED: probable transaldolase                  259   9e-81   Phoenix dactylifera
ref|XP_010458643.1|  PREDICTED: probable transaldolase                  259   1e-80   Camelina sativa [gold-of-pleasure]
emb|CDX98081.1|  BnaA06g08320D                                          258   1e-80   
ref|XP_010476185.1|  PREDICTED: probable transaldolase isoform X1       259   1e-80   Camelina sativa [gold-of-pleasure]
gb|ABK26234.1|  unknown                                                 258   1e-80   Picea sitchensis
ref|XP_010906619.1|  PREDICTED: probable transaldolase                  258   1e-80   Elaeis guineensis
ref|XP_009148608.1|  PREDICTED: probable transaldolase                  258   2e-80   Brassica rapa
ref|XP_004147589.1|  PREDICTED: transaldolase-like                      258   2e-80   
gb|KGN50221.1|  hypothetical protein Csa_5G160240                       258   2e-80   Cucumis sativus [cucumbers]
ref|XP_010941128.1|  PREDICTED: probable transaldolase                  258   2e-80   Elaeis guineensis
dbj|BAD94458.1|  hypothetical protein                                   254   3e-80   Arabidopsis thaliana [mouse-ear cress]
gb|ACN40140.1|  unknown                                                 256   6e-80   Picea sitchensis
gb|KFK43488.1|  hypothetical protein AALP_AA1G131500                    257   7e-80   Arabis alpina [alpine rockcress]
ref|XP_008778383.1|  PREDICTED: probable transaldolase                  255   1e-79   
ref|XP_006417256.1|  hypothetical protein EUTSA_v10007790mg             256   1e-79   Eutrema salsugineum [saltwater cress]
emb|CDY30055.1|  BnaC05g09650D                                          258   2e-79   Brassica napus [oilseed rape]
ref|XP_006840956.1|  hypothetical protein AMTR_s00085p00019560          254   6e-79   Amborella trichopoda
ref|NP_563900.1|  transaldolase-like protein                            254   7e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533770.1|  PREDICTED: probable transaldolase                  254   9e-79   Tarenaya hassleriana [spider flower]
ref|NP_001184971.1|  transaldolase-like protein                         254   1e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66063.1|  transaldolase ToTAL2                                    252   4e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AFK49390.1|  unknown                                                 249   3e-77   Lotus japonicus
ref|XP_003573490.1|  PREDICTED: probable transaldolase                  242   3e-74   
gb|AAQ17460.1|  transaldolase                                           241   8e-74   Gossypium hirsutum [American cotton]
ref|XP_004972823.1|  PREDICTED: transaldolase-like                      240   2e-73   Setaria italica
ref|XP_002889922.1|  hypothetical protein ARALYDRAFT_888542             254   4e-73   
dbj|BAJ97939.1|  predicted protein                                      237   3e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ05627.1|  hypothetical protein OsI_27846                          237   3e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_002445069.1|  hypothetical protein SORBIDRAFT_07g003600          237   3e-72   Sorghum bicolor [broomcorn]
gb|AFW61221.1|  hypothetical protein ZEAMMB73_046549                    231   9e-72   
ref|NP_001061014.1|  Os08g0154300                                       235   1e-71   
ref|NP_001131550.1|  hypothetical protein                               233   1e-70   Zea mays [maize]
ref|XP_006659843.1|  PREDICTED: probable transaldolase-like             231   2e-70   
ref|XP_008356506.1|  PREDICTED: probable transaldolase                  216   1e-66   
gb|EMT17151.1|  Transaldolase                                           214   6e-64   
ref|XP_001780973.1|  predicted protein                                  214   2e-63   
gb|KDO48370.1|  hypothetical protein CISIN_1g016178mg                   210   3e-62   Citrus sinensis [apfelsine]
gb|AAL65638.1|  transaldolase-like protein                              209   7e-62   Arabidopsis lyrata [lyrate rockcress]
gb|AAL65624.1|  transaldolase-like protein                              209   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL65627.1|  transaldolase-like protein                              209   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL65623.1|  transaldolase-like protein                              207   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL65605.1|  transaldolase-like protein                              207   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL65622.1|  transaldolase-like protein                              207   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL65634.1|  transaldolase-like protein                              207   5e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL65620.1|  transaldolase-like protein                              207   5e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL65612.1|  transaldolase-like protein                              206   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002532577.1|  transaldolase total2, putative                     198   1e-57   
gb|KEH31659.1|  transaldolase total2 protein                            194   4e-56   Medicago truncatula
gb|EMS49843.1|  Transaldolase                                           177   4e-52   Triticum urartu
gb|ACF74318.1|  transaldolase                                           135   2e-36   Arachis hypogaea [goober]
ref|XP_006417257.1|  hypothetical protein EUTSA_v10007790mg             126   1e-30   
gb|KDP36162.1|  hypothetical protein JCGZ_08806                         103   5e-24   Jatropha curcas
ref|XP_005651138.1|  aldolase                                         88.2    7e-17   Coccomyxa subellipsoidea C-169
gb|KIY94122.1|  transaldolase                                         84.3    4e-16   Monoraphidium neglectum
ref|WP_027846808.1|  transaldolase                                    82.8    3e-15   Mastigocoleus testarum
emb|CCI36366.1|  Transaldolase                                        82.4    3e-15   Microcystis aeruginosa PCC 9701
ref|WP_038015619.1|  transaldolase                                    81.3    9e-15   
gb|EDX83816.1|  transaldolase                                         81.3    1e-14   Synechococcus sp. PCC 7335
ref|XP_005844288.1|  hypothetical protein CHLNCDRAFT_59034            80.9    3e-14   Chlorella variabilis
ref|WP_026442069.1|  transaldolase                                    79.7    4e-14   Acidobacterium ailaaui
ref|WP_024968637.1|  transaldolase                                    80.1    5e-14   Microcystis aeruginosa
dbj|GAN06651.1|  transaldolase 1                                      79.0    5e-14   Mucor ambiguus
ref|WP_002755039.1|  transaldolase                                    79.7    6e-14   Microcystis aeruginosa
ref|WP_002757178.1|  transaldolase                                    79.3    7e-14   Microcystis aeruginosa
ref|WP_012266979.1|  transaldolase                                    79.3    7e-14   Microcystis aeruginosa
ref|WP_004162807.1|  transaldolase                                    79.3    7e-14   Microcystis aeruginosa
ref|WP_009725410.1|  transaldolase                                    78.2    1e-13   Methylophaga lonarensis
ref|WP_002781072.1|  Transaldolase                                    79.0    1e-13   Microcystis aeruginosa
ref|WP_022637038.1|  transaldolase                                    77.8    1e-13   Chitinivibrio alkaliphilus
ref|XP_007882463.1|  hypothetical protein PFL1_06726                  77.8    1e-13   Anthracocystis flocculosa PF-1
ref|WP_008206347.1|  transaldolase                                    78.6    1e-13   Microcystis sp. T1-4
ref|WP_026785630.1|  MULTISPECIES: transaldolase                      78.6    2e-13   Planktothrix
ref|WP_024125117.1|  transaldolase TalB                               78.2    2e-13   Thermosynechococcus sp. NK55a
ref|WP_026796086.1|  MULTISPECIES: transaldolase                      78.2    2e-13   Planktothrix
ref|WP_042153668.1|  transaldolase                                    78.2    2e-13   Planktothrix agardhii
ref|WP_036315792.1|  transaldolase                                    77.4    2e-13   
ref|WP_002739596.1|  transaldolase                                    77.8    2e-13   Microcystis aeruginosa
gb|KEI66743.1|  Tal                                                   77.8    3e-13   Planktothrix agardhii NIVA-CYA 126/8
ref|WP_014704248.1|  transaldolase                                    76.6    3e-13   Methylophaga frappieri
ref|WP_019498168.1|  transaldolase                                    77.4    4e-13   Pseudanabaena sp. PCC 6802
ref|WP_011056320.1|  transaldolase                                    77.4    4e-13   Thermosynechococcus
ref|XP_001728741.1|  hypothetical protein MGL_4076                    76.3    4e-13   Malassezia globosa CBS 7966
ref|WP_039725382.1|  MULTISPECIES: transaldolase                      77.0    5e-13   Lyngbya confervoides
dbj|GAL93103.1|  transaldolase                                        76.6    6e-13   Microcystis aeruginosa NIES-44
emb|CEP15643.1|  hypothetical protein                                 75.9    7e-13   Parasitella parasitica
ref|WP_002743970.1|  transaldolase                                    76.6    7e-13   Microcystis aeruginosa
ref|WP_035356899.1|  transaldolase                                    74.7    8e-13   Edaphobacter aggregans
ref|WP_012953625.1|  transaldolase                                    75.5    1e-12   Candidatus Atelocyanobacterium thalassa
ref|WP_027159358.1|  transaldolase                                    75.5    1e-12   Methylobacter luteus
ref|WP_015198547.1|  transaldolase                                    75.5    1e-12   Calothrix parietina
ref|WP_035615704.1|  transaldolase                                    75.1    1e-12   Haloferula sp. BvORR071
ref|WP_013325338.1|  transaldolase                                    75.9    1e-12   Cyanothece sp. PCC 7822
ref|WP_043944502.1|  transaldolase                                    75.1    1e-12   Ralstonia solanacearum
ref|WP_015222082.1|  transaldolase                                    75.9    1e-12   
ref|WP_019140538.1|  transaldolase                                    74.7    1e-12   Noviherbaspirillum massiliense
ref|WP_015080657.1|  transaldolase TalAB                              75.1    2e-12   Anabaena sp. 90
ref|WP_040054790.1|  transaldolase                                    74.7    2e-12   
ref|WP_010473139.1|  transaldolase                                    75.5    2e-12   Acaryochloris sp. CCMEE 5410
ref|WP_011818027.1|  transaldolase                                    74.7    2e-12   Prochlorococcus marinus
gb|ABM69861.1|  Transaldolase                                         74.7    2e-12   Prochlorococcus marinus str. AS9601
gb|EPB92443.1|  transaldolase                                         74.3    2e-12   Mucor circinelloides f. circinelloides 1006PhL
ref|YP_002049507.1|  transaldolase                                    74.3    3e-12   Paulinella chromatophora
ref|WP_031433502.1|  transaldolase                                    74.3    3e-12   Methylomarinum vadi
ref|WP_007363108.1|  MULTISPECIES: transaldolase                      73.9    3e-12   unclassified Opitutaceae
ref|WP_038490793.1|  transaldolase                                    73.9    3e-12   Collimonas arenae
ref|WP_002772050.1|  transaldolase                                    74.7    3e-12   Microcystis aeruginosa
gb|ABW30943.1|  transaldolase                                         74.7    3e-12   Acaryochloris marina MBIC11017
ref|WP_041660622.1|  transaldolase                                    74.7    3e-12   Acaryochloris marina
ref|WP_016874473.1|  transaldolase                                    73.9    3e-12   Chlorogloeopsis fritschii
ref|WP_002791990.1|  transaldolase                                    74.7    3e-12   Microcystis aeruginosa
gb|ERG86948.1|  transaldolase                                         74.3    4e-12   
ref|WP_014707663.1|  transaldolase                                    73.9    4e-12   Methylophaga nitratireducenticrescens
ref|WP_015107738.1|  transaldolase                                    74.3    4e-12   Cyanobium gracile
ref|WP_003268474.1|  transaldolase                                    73.6    4e-12   Ralstonia
ref|WP_020733902.1|  transaldolase                                    73.6    4e-12   Sorangium cellulosum
ref|WP_035347089.1|  transaldolase                                    73.6    4e-12   Edaphobacter aggregans
ref|WP_017841577.1|  transaldolase                                    73.6    5e-12   Methylomicrobium buryatense
ref|WP_032519397.1|  transaldolase                                    73.6    5e-12   Prochlorococcus marinus
gb|KGG08009.1|  Transaldolase                                         73.6    6e-12   Prochlorococcus marinus str. SB
emb|CCQ69168.1|  Transaldolase                                        73.9    6e-12   Crocosphaera watsonii WH 0402
gb|AIN39832.1|  hypothetical protein                                  71.2    6e-12   Zoysia matrella [Japanese carpet grass]
ref|WP_015118125.1|  transaldolase                                    73.2    6e-12   Rivularia sp. PCC 7116
ref|XP_008868532.1|  transaldolase                                    73.2    7e-12   Aphanomyces invadans
ref|WP_020159800.1|  MULTISPECIES: transaldolase                      73.2    7e-12   Methylobacter
ref|WP_025926158.1|  transaldolase                                    73.2    7e-12   
gb|EIE86885.1|  transaldolase                                         73.2    7e-12   Rhizopus delemar RA 99-880
ref|WP_016725840.1|  transaldolase                                    72.8    7e-12   Ralstonia solanacearum
ref|WP_021832055.1|  Transaldolase                                    73.6    8e-12   Crocosphaera watsonii
ref|WP_026387747.1|  transaldolase                                    73.2    8e-12   Acidobacteria bacterium KBS 146
ref|WP_007305534.1|  transaldolase                                    73.6    8e-12   Crocosphaera watsonii
ref|WP_007310814.1|  transaldolase                                    73.6    9e-12   Crocosphaera watsonii
ref|WP_005879412.1|  transaldolase                                    72.8    9e-12   Oxalobacter formigenes
ref|WP_006276405.1|  transaldolase                                    72.8    9e-12   Cylindrospermopsis raciborskii
ref|WP_010316653.1|  transaldolase                                    73.6    9e-12   Synechococcus sp. CB0205
emb|CDH48653.1|  transaldolase                                        72.8    9e-12   Lichtheimia corymbifera JMRC:FSU:9682
ref|WP_011870598.1|  transaldolase                                    72.4    9e-12   Herminiimonas arsenicoxydans
ref|WP_013233125.1|  transaldolase                                    72.4    9e-12   Herbaspirillum seropedicae
ref|WP_035149652.1|  transaldolase                                    72.8    9e-12   Calothrix sp. 336/3
ref|WP_026100018.1|  transaldolase                                    72.8    1e-11   Fortiea contorta
ref|WP_028852939.1|  transaldolase                                    72.4    1e-11   Ralstonia solanacearum
ref|WP_011001180.1|  transaldolase                                    72.4    1e-11   Ralstonia
ref|WP_020749039.1|  transaldolase                                    72.4    1e-11   Ralstonia solanacearum
gb|KHJ97379.1|  transaldolase                                         72.4    1e-11   Oesophagostomum dentatum [nodule worm]
gb|EPB86724.1|  transaldolase                                         72.4    1e-11   Mucor circinelloides f. circinelloides 1006PhL
ref|WP_015897701.1|  transaldolase                                    72.8    1e-11   Acidobacterium capsulatum
emb|CEG74923.1|  Putative Transaldolase                               72.4    1e-11   Rhizopus microsporus
ref|WP_021154864.1|  transaldolase B                                  72.8    1e-11   
gb|EAQ74921.1|  transaldolase                                         73.2    1e-11   Synechococcus sp. WH 5701
gb|KIJ58399.1|  hypothetical protein HYDPIDRAFT_102724                71.2    1e-11   Hydnomerulius pinastri MD-312
ref|WP_037979690.1|  transaldolase                                    73.2    1e-11   Synechococcus sp. WH 5701
ref|WP_016950095.1|  transaldolase                                    72.4    1e-11   Anabaena sp. PCC 7108
emb|CAP22947.2|  Protein CBG01674                                     72.4    1e-11   Caenorhabditis briggsae
ref|WP_035357245.1|  transaldolase                                    72.4    1e-11   Edaphobacter aggregans
dbj|BAO93703.1|  transaldolase                                        72.4    1e-11   Moniliella megachiliensis
ref|WP_015124775.1|  transaldolase                                    72.8    1e-11   Synechococcus sp. PCC 6312
ref|WP_015212754.1|  transaldolase                                    72.4    1e-11   Anabaena cylindrica
ref|WP_009554366.1|  transaldolase                                    72.8    1e-11   Oscillatoriales cyanobacterium JSC-12
ref|WP_006530077.1|  transaldolase                                    72.8    1e-11   Gloeocapsa sp. PCC 73106
ref|WP_034756130.1|  transaldolase                                    72.0    1e-11   Janthinobacterium lividum
ref|WP_017453810.1|  MULTISPECIES: transaldolase                      72.0    2e-11   Herbaspirillum
dbj|GAN07874.1|  transaldolase 1                                      72.0    2e-11   Mucor ambiguus
ref|WP_012406860.1|  transaldolase                                    72.0    2e-11   Nostoc punctiforme
ref|WP_014150353.1|  transaldolase                                    72.0    2e-11   Methylomicrobium alcaliphilum
gb|EYC18811.1|  hypothetical protein Y032_0026g1380                   72.8    2e-11   Ancylostoma ceylanicum
ref|WP_028205749.1|  transaldolase                                    72.0    2e-11   Paraburkholderia nodosa
gb|EYC18812.1|  hypothetical protein Y032_0026g1380                   72.8    2e-11   Ancylostoma ceylanicum
ref|WP_011823313.1|  transaldolase                                    72.0    2e-11   Prochlorococcus marinus
ref|WP_011429619.1|  transaldolase                                    72.4    2e-11   Synechococcus
ref|WP_011141596.1|  transaldolase                                    72.4    2e-11   Gloeobacter violaceus
ref|WP_036531081.1|  transaldolase                                    72.4    2e-11   Neosynechococcus sphagnicola
gb|EGG99594.1|  Transaldolase                                         72.0    2e-11   gamma proteobacterium IMCC2047
ref|WP_025914337.1|  transaldolase                                    72.0    2e-11   
gb|KFM82043.1|  Transaldolase                                         71.6    2e-11   Stegodyphus mimosarum
ref|WP_044530293.1|  transaldolase                                    71.6    2e-11   Herbaspirillum sp. B65
ref|WP_040039767.1|  transaldolase                                    71.6    2e-11   Noviherbaspirillum autotrophicum
ref|WP_005796850.1|  transaldolase                                    71.6    2e-11   Acidovorax delafieldii
ref|WP_015220282.1|  transaldolase                                    72.4    2e-11   Cyanobacterium aponinum
ref|WP_015208766.1|  transaldolase                                    72.0    2e-11   Cylindrospermum stagnale
ref|WP_027400588.1|  transaldolase                                    72.0    2e-11   Aphanizomenon flos-aquae
ref|WP_042271099.1|  transaldolase                                    71.6    2e-11   Paraburkholderia heleia
ref|WP_031386061.1|  transaldolase                                    71.6    2e-11   Desulfonatronum thiodismutans
ref|WP_034111665.1|  transaldolase                                    71.6    2e-11   
ref|WP_039199424.1|  transaldolase                                    71.6    2e-11   Aphanizomenon flos-aquae
ref|WP_029969983.1|  transaldolase                                    71.2    3e-11   Burkholderia sp. URHA0054
ref|WP_026611930.1|  transaldolase                                    71.6    3e-11   Methylocaldum szegediense
ref|WP_012373527.1|  transaldolase                                    71.2    3e-11   Opitutus terrae
ref|WP_009342587.1|  transaldolase                                    71.6    3e-11   Raphidiopsis brookii
ref|WP_044106696.1|  transaldolase                                    71.2    3e-11   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_005875605.1|  transaldolase                                    71.2    3e-11   Oxalobacter formigenes
ref|WP_023494155.1|  transaldolase Tal                                71.6    3e-11   Methyloglobulus morosus
ref|XP_006643322.1|  PREDICTED: transaldolase-like                    71.2    3e-11   
ref|WP_006048374.1|  transaldolase                                    71.2    3e-11   Burkholderiaceae
ref|XP_002185708.1|  transaldolase                                    71.2    3e-11   Phaeodactylum tricornutum CCAP 1055/1
gb|KIH67069.1|  transaldolase                                         71.2    3e-11   Ancylostoma duodenale
ref|WP_006463829.1|  transaldolase B                                  71.2    3e-11   Herbaspirillum frisingense
gb|EJT50936.1|  TAL1 protein                                          68.9    3e-11   Trichosporon asahii var. asahii CBS 2479
ref|WP_008113630.1|  transaldolase                                    70.9    3e-11   Herbaspirillum sp. YR522
ref|WP_010307265.1|  transaldolase                                    71.6    3e-11   Synechococcus sp. CB0101
ref|WP_020065316.1|  transaldolase                                    71.2    3e-11   Burkholderiaceae
ref|WP_012234095.1|  transaldolase                                    71.2    3e-11   
ref|WP_034298662.1|  transaldolase                                    70.9    3e-11   Herbaspirillum sp. RV1423
emb|CCV00532.1|  unnamed protein product                              71.2    3e-11   Malassezia sympodialis ATCC 42132
ref|WP_011619923.1|  transaldolase                                    71.6    3e-11   Synechococcus sp. CC9311
ref|WP_028104815.1|  transaldolase                                    70.9    3e-11   Pseudoduganella violaceinigra
ref|WP_020713321.1|  transaldolase                                    71.2    4e-11   Acidobacteriaceae bacterium KBS 89
ref|WP_015115172.1|  transaldolase                                    71.2    4e-11   Nostoc sp. PCC 7107
ref|WP_008918242.1|  transaldolase                                    70.9    4e-11   
ref|XP_008471087.1|  PREDICTED: probable transaldolase                70.1    4e-11   
ref|WP_017321793.1|  transaldolase                                    71.2    4e-11   cyanobacterium PCC 7702
emb|CDZ80310.1|  Transaldolase A                                      70.9    4e-11   Candidatus Rubidus massiliensis
ref|WP_039564170.1|  transaldolase                                    70.9    4e-11   Ralstonia solanacearum
ref|WP_017294105.1|  transaldolase                                    71.6    4e-11   Geminocystis herdmanii
ref|WP_014005424.1|  transaldolase                                    70.9    4e-11   Collimonas fungivorans
ref|WP_039568029.1|  transaldolase                                    70.9    4e-11   Ralstonia solanacearum
ref|WP_025598900.1|  transaldolase                                    70.9    4e-11   Burkholderia sp. WSM2230
ref|WP_006529692.1|  transaldolase                                    71.6    4e-11   Gloeocapsa sp. PCC 73106
dbj|BAO80799.1|  transaldolase                                        70.9    4e-11   Serpentinomonas raichei
ref|WP_038489898.1|  transaldolase                                    70.9    4e-11   Janthinobacterium agaricidamnosum
ref|WP_034784604.1|  transaldolase                                    70.5    5e-11   Janthinobacterium lividum
ref|WP_019813413.1|  transaldolase                                    70.5    5e-11   
ref|WP_027148088.1|  transaldolase                                    70.9    5e-11   Methylobacter tundripaludum
ref|WP_012598814.1|  transaldolase                                    71.2    5e-11   Cyanothece sp. PCC 7424
ref|NP_001040544.1|  transaldolase                                    70.9    5e-11   Bombyx mori [silk moth]
ref|WP_003074125.1|  transaldolase                                    70.5    5e-11   Comamonas testosteroni
ref|WP_024650964.1|  transaldolase                                    70.5    5e-11   Pseudomonas syringae group
ref|WP_009543268.1|  MULTISPECIES: transaldolase                      71.2    5e-11   Cyanothece
ref|WP_042281327.1|  transaldolase                                    70.5    5e-11   Candidatus Protochlamydia sp. R18
gb|EGT47340.1|  hypothetical protein CAEBREN_25989                    68.2    5e-11   
gb|EYC18810.1|  hypothetical protein Y032_0026g1380                   72.0    5e-11   
ref|WP_026039422.1|  transaldolase                                    70.5    6e-11   
ref|WP_034381764.1|  transaldolase                                    70.5    6e-11   
ref|WP_027214200.1|  transaldolase                                    70.5    6e-11   
ref|WP_027248792.1|  transaldolase                                    70.9    6e-11   
ref|WP_006853387.1|  transaldolase                                    70.9    6e-11   
emb|CEP11508.1|  hypothetical protein                                 70.5    6e-11   
ref|WP_040218947.1|  transaldolase                                    70.1    6e-11   
ref|WP_003058705.1|  transaldolase                                    70.1    7e-11   
ref|WP_012080168.1|  transaldolase                                    70.1    7e-11   
ref|WP_017298425.1|  transaldolase                                    70.9    7e-11   
ref|WP_026780931.1|  transaldolase                                    70.1    7e-11   
ref|WP_012432264.1|  transaldolase                                    70.1    7e-11   
ref|WP_011432742.1|  transaldolase                                    70.9    7e-11   
ref|WP_034753971.1|  transaldolase                                    70.1    7e-11   
ref|WP_003263883.1|  transaldolase                                    70.1    7e-11   
ref|WP_031292681.1|  transaldolase                                    70.9    7e-11   
ref|WP_034357697.1|  transaldolase                                    70.1    7e-11   
ref|WP_009524156.1|  transaldolase                                    70.1    7e-11   
ref|WP_026448656.1|  transaldolase                                    70.1    7e-11   
ref|WP_008277459.1|  transaldolase                                    70.9    7e-11   
gb|AIJ44907.1|  transaldolase                                         70.1    8e-11   
ref|WP_013338615.1|  transaldolase                                    70.1    8e-11   
gb|ESA36529.1|  transaldolase                                         70.9    8e-11   
ref|WP_018970683.1|  hypothetical protein                             70.1    8e-11   
ref|XP_009835767.1|  transaldolase                                    70.1    8e-11   
ref|WP_027775582.1|  transaldolase                                    70.1    8e-11   
ref|WP_034787048.1|  transaldolase                                    69.7    9e-11   
ref|WP_029985236.1|  transaldolase                                    69.3    9e-11   
gb|EHJ64652.1|  transaldolase                                         69.7    9e-11   
ref|WP_012595416.1|  MULTISPECIES: transaldolase                      70.5    9e-11   
emb|CDH53020.1|  transaldolase                                        69.7    9e-11   
emb|CCD60318.1|  transaldolase                                        70.1    9e-11   
ref|WP_042102673.1|  transaldolase                                    69.7    1e-10   
ref|WP_035821310.1|  transaldolase                                    69.7    1e-10   
ref|WP_013587645.1|  MULTISPECIES: transaldolase                      69.7    1e-10   
ref|XP_011257235.1|  PREDICTED: transaldolase isoform X2              69.7    1e-10   
ref|WP_007232329.1|  transaldolase                                    69.7    1e-10   
ref|WP_011610160.1|  transaldolase                                    70.5    1e-10   
emb|CCA79170.1|  transaldolase                                        69.7    1e-10   
ref|WP_013212809.1|  transaldolase                                    69.7    1e-10   
ref|WP_042327589.1|  transaldolase                                    69.7    1e-10   
gb|AFT85098.1|  transaldolase                                         69.7    1e-10   
ref|WP_006043604.1|  transaldolase                                    70.1    1e-10   
ref|XP_008607278.1|  transaldolase                                    69.7    1e-10   
ref|WP_016833058.1|  transaldolase                                    69.7    1e-10   
gb|ADB55723.1|  putative transaldolase                                67.8    1e-10   
ref|WP_041746058.1|  transaldolase                                    69.7    1e-10   
ref|WP_034390647.1|  transaldolase                                    69.7    1e-10   
gb|KGH14573.1|  transaldolase                                         69.7    1e-10   
ref|WP_034409255.1|  transaldolase                                    69.7    1e-10   
ref|WP_017327811.1|  transaldolase                                    70.1    1e-10   
ref|WP_043003656.1|  transaldolase                                    69.7    1e-10   
ref|WP_015012606.1|  transaldolase                                    69.3    1e-10   
ref|WP_028831304.1|  transaldolase                                    69.7    1e-10   
emb|CCA15607.1|  transaldolase putative                               69.7    1e-10   
ref|WP_034365384.1|  transaldolase                                    69.3    1e-10   
ref|WP_018919083.1|  transaldolase                                    69.3    1e-10   
ref|WP_015129079.1|  transaldolase                                    69.7    1e-10   
ref|XP_004995983.1|  transaldolase 1                                  69.3    1e-10   
ref|WP_006195144.1|  transaldolase                                    69.3    1e-10   
ref|WP_025931533.1|  MULTISPECIES: transaldolase                      69.3    1e-10   
ref|WP_006577137.1|  transaldolase B                                  69.3    1e-10   
emb|CCI49436.1|  unnamed protein product                              69.3    1e-10   
ref|XP_001014584.1|  transaldolase family protein                     69.7    1e-10   
ref|WP_035819079.1|  transaldolase                                    69.3    1e-10   
ref|NP_001279841.1|  transaldolase 1                                  69.3    2e-10   
ref|WP_024642154.1|  transaldolase                                    68.9    2e-10   
ref|WP_007147028.1|  transaldolase                                    69.3    2e-10   
ref|WP_038651701.1|  transaldolase                                    69.3    2e-10   
ref|WP_036806174.1|  transaldolase                                    68.9    2e-10   
ref|WP_005709800.1|  transaldolase                                    68.9    2e-10   
ref|WP_025943689.1|  transaldolase                                    69.3    2e-10   
ref|WP_025894168.1|  transaldolase                                    69.3    2e-10   
ref|WP_025961855.1|  transaldolase                                    69.3    2e-10   
ref|XP_011257234.1|  PREDICTED: transaldolase isoform X1              69.3    2e-10   
ref|WP_003275006.1|  transaldolase                                    68.9    2e-10   
ref|WP_025922244.1|  MULTISPECIES: transaldolase                      69.3    2e-10   
ref|WP_008326209.1|  transaldolase                                    68.9    2e-10   
ref|WP_015170546.1|  transaldolase                                    69.7    2e-10   
ref|WP_011294483.1|  transaldolase                                    69.3    2e-10   
ref|NP_741370.1|  Protein Y24D9A.8, isoform b                         66.6    2e-10   
gb|EKD11013.1|  transaldolase                                         68.9    2e-10   
ref|WP_035999829.1|  transaldolase                                    69.7    2e-10   
ref|WP_014787647.1|  transaldolase                                    68.9    2e-10   
ref|WP_042244071.1|  transaldolase                                    68.9    2e-10   
ref|WP_006670669.1|  MULTISPECIES: transaldolase                      68.9    2e-10   
ref|WP_039385531.1|  transaldolase                                    68.9    2e-10   
ref|WP_013578822.1|  transaldolase                                    68.9    2e-10   
ref|WP_013190956.1|  transaldolase                                    68.9    2e-10   
ref|WP_015145321.1|  transaldolase                                    69.3    2e-10   
ref|WP_006911526.1|  transaldolase                                    69.3    2e-10   
ref|WP_028196859.1|  MULTISPECIES: transaldolase                      68.9    2e-10   
ref|WP_009500796.1|  transaldolase                                    68.9    2e-10   
ref|WP_011378395.1|  MULTISPECIES: transaldolase                      69.3    2e-10   
ref|WP_011244113.1|  transaldolase                                    69.3    2e-10   
ref|WP_021208584.1|  transaldolase                                    68.6    2e-10   
ref|WP_028573158.1|  transaldolase                                    68.6    2e-10   
ref|WP_025945774.1|  transaldolase                                    68.9    2e-10   
ref|WP_039136836.1|  transaldolase                                    68.6    2e-10   
emb|CDS03409.1|  hypothetical protein LRAMOSA00811                    68.6    2e-10   
ref|WP_012341545.1|  transaldolase                                    68.6    2e-10   
ref|WP_040066888.1|  transaldolase                                    68.6    2e-10   
ref|WP_027857078.1|  transaldolase                                    68.6    2e-10   
ref|WP_020707965.1|  transaldolase                                    68.9    2e-10   
ref|WP_017741825.1|  transaldolase                                    69.3    2e-10   
emb|CDS08489.1|  hypothetical protein LRAMOSA09850                    68.6    3e-10   
ref|WP_013206310.1|  transaldolase                                    68.6    3e-10   
ref|XP_010709210.1|  PREDICTED: transaldolase-like                    67.4    3e-10   
gb|KIE06870.1|  transaldolase                                         68.9    3e-10   
ref|WP_039159310.1|  transaldolase                                    68.6    3e-10   
ref|WP_036914678.1|  MULTISPECIES: transaldolase                      68.9    3e-10   
ref|WP_016864821.1|  transaldolase                                    68.6    3e-10   
ref|WP_039596033.1|  transaldolase                                    68.6    3e-10   
ref|WP_034340035.1|  transaldolase                                    68.6    3e-10   
ref|WP_009454287.1|  MULTISPECIES: transaldolase                      68.6    3e-10   
dbj|BAN20780.1|  transaldolase                                        68.6    3e-10   
ref|WP_010962233.1|  transaldolase                                    68.6    3e-10   
ref|WP_039789014.1|  transaldolase                                    68.2    3e-10   
ref|WP_011360422.1|  transaldolase                                    68.9    3e-10   
ref|WP_014596374.1|  transaldolase                                    68.2    3e-10   
ref|WP_005705396.1|  transaldolase                                    68.2    3e-10   
ref|WP_036921781.1|  transaldolase                                    68.6    3e-10   
ref|XP_001690070.1|  transaldolase                                    68.9    3e-10   
ref|WP_010397992.1|  transaldolase                                    68.2    3e-10   
ref|XP_001602166.1|  PREDICTED: transaldolase isoform X2              68.6    3e-10   
ref|WP_028210474.1|  transaldolase                                    68.2    3e-10   
ref|WP_003407017.1|  transaldolase                                    68.2    3e-10   
emb|CCA14763.1|  transaldolase putative                               68.2    4e-10   
ref|WP_027799828.1|  transaldolase                                    68.2    4e-10   
ref|WP_022606341.1|  transaldolase                                    68.6    4e-10   
gb|KDR08915.1|  Transaldolase                                         68.2    4e-10   
ref|WP_008451283.1|  transaldolase Tal                                68.2    4e-10   
ref|WP_036906935.1|  transaldolase                                    68.2    4e-10   
ref|XP_966585.1|  PREDICTED: probable transaldolase                   68.2    4e-10   
ref|WP_024459728.1|  transaldolase                                    68.2    4e-10   
ref|WP_011608357.1|  transaldolase                                    68.2    4e-10   
ref|WP_035828855.1|  transaldolase                                    68.6    4e-10   
ref|WP_003062018.1|  transaldolase                                    68.2    4e-10   
gb|KIJ60818.1|  hypothetical protein HYDPIDRAFT_177252                68.2    4e-10   
ref|WP_011176236.1|  transaldolase                                    68.2    4e-10   
gb|KIC71775.1|  Transaldolase                                         68.2    4e-10   
gb|ELS30808.1|  Transaldolase                                         68.2    4e-10   
gb|ACY31425.1|  transaldolase                                         68.2    4e-10   
ref|WP_042851291.1|  transaldolase                                    68.2    4e-10   
ref|WP_040689721.1|  transaldolase                                    68.2    4e-10   
ref|XP_964294.1|  transaldolase                                       68.2    4e-10   
ref|WP_038185209.1|  transaldolase                                    67.8    4e-10   
ref|WP_044400381.1|  transaldolase                                    67.8    4e-10   
ref|WP_027197107.1|  transaldolase                                    67.8    4e-10   
ref|WP_011932546.1|  transaldolase                                    68.6    4e-10   
ref|XP_002952416.1|  hypothetical protein VOLCADRAFT_81816            68.2    4e-10   
ref|WP_020294100.1|  transaldolase B                                  68.2    5e-10   
ref|WP_028082603.1|  transaldolase                                    68.2    5e-10   
ref|XP_001643344.1|  hypothetical protein Kpol_472p17                 68.2    5e-10   
ref|XP_006691858.1|  transaldolase-like protein                       67.8    5e-10   
ref|WP_027677615.1|  transaldolase                                    67.8    5e-10   
ref|WP_012761783.1|  transaldolase                                    67.8    5e-10   
ref|WP_009789261.1|  transaldolase                                    68.2    5e-10   
ref|WP_006890523.1|  transaldolase                                    67.8    5e-10   
ref|WP_024660673.1|  transaldolase                                    67.8    5e-10   
ref|WP_016344807.1|  transaldolase                                    67.8    5e-10   
ref|WP_011267310.1|  transaldolase                                    67.8    5e-10   
gb|AIQ94588.1|  Transaldolase                                         67.8    5e-10   
ref|WP_032124140.1|  transaldolase                                    67.8    5e-10   
ref|WP_033159418.1|  transaldolase                                    67.8    5e-10   
ref|XP_002634120.1|  Hypothetical protein CBG01674                    67.8    5e-10   
ref|WP_006513648.1|  transaldolase                                    68.2    5e-10   
ref|WP_044446857.1|  transaldolase                                    67.8    5e-10   
gb|AAO32444.1|  YGR043C                                               67.8    5e-10   
ref|WP_005374209.1|  MULTISPECIES: transaldolase                      67.8    5e-10   
ref|WP_023068130.1|  transaldolase                                    68.2    6e-10   
gb|KFE50495.1|  transaldolase                                         67.4    6e-10   
gb|EUC63237.1|  transaldolase                                         67.8    6e-10   
ref|WP_041484446.1|  transaldolase                                    67.8    6e-10   
ref|WP_019490949.1|  transaldolase                                    67.8    6e-10   
ref|XP_002955440.1|  hypothetical protein VOLCADRAFT_106782           68.2    6e-10   
ref|WP_019477260.1|  transaldolase                                    67.8    6e-10   
ref|WP_020565422.1|  transaldolase                                    67.8    6e-10   
ref|WP_011825422.1|  transaldolase                                    68.2    6e-10   
ref|WP_035991112.1|  transaldolase                                    68.2    6e-10   
gb|ABV50215.1|  Transaldolase                                         67.8    6e-10   
ref|WP_037222361.1|  transaldolase                                    67.4    6e-10   
ref|XP_006124941.1|  PREDICTED: transaldolase                         67.8    6e-10   
ref|WP_032526823.1|  transaldolase                                    67.4    7e-10   
gb|KDO35631.1|  transaldolase                                         67.4    7e-10   
ref|WP_014617306.1|  transaldolase                                    67.4    7e-10   
ref|WP_019866366.1|  transaldolase                                    67.4    7e-10   
gb|KIO05341.1|  hypothetical protein M404DRAFT_141276                 67.4    8e-10   
ref|WP_013943844.1|  transaldolase                                    67.0    8e-10   
ref|WP_016534392.1|  transaldolase B                                  65.5    8e-10   
ref|WP_020308096.1|  transaldolase B                                  67.0    8e-10   
ref|WP_016533910.1|  transaldolase B                                  65.1    8e-10   
ref|WP_022982439.1|  transaldolase                                    67.0    8e-10   
ref|WP_005555763.1|  transaldolase                                    67.0    8e-10   
ref|XP_007060970.1|  PREDICTED: transaldolase                         67.0    8e-10   
ref|WP_011862538.1|  transaldolase                                    67.4    9e-10   
ref|WP_011487399.1|  transaldolase                                    67.0    9e-10   
ref|WP_010627905.1|  transaldolase                                    67.0    9e-10   
gb|KFH73772.1|  transaldolase                                         67.0    9e-10   
ref|WP_017659244.1|  transaldolase                                    67.4    9e-10   
ref|WP_035594308.1|  transaldolase                                    67.0    9e-10   
ref|WP_040550941.1|  transaldolase                                    67.0    9e-10   
ref|WP_017774323.1|  transaldolase                                    67.0    9e-10   
gb|EFE24213.1|  transaldolase                                         67.0    1e-09   
ref|XP_004178148.1|  hypothetical protein TBLA_0A08400                67.0    1e-09   
ref|WP_010996719.1|  transaldolase                                    67.0    1e-09   
ref|WP_015141378.1|  transaldolase                                    67.0    1e-09   
ref|WP_034163065.1|  transaldolase                                    67.0    1e-09   
ref|WP_039163815.1|  transaldolase                                    67.0    1e-09   
ref|WP_011130617.1|  transaldolase                                    67.4    1e-09   
ref|WP_025941438.1|  transaldolase                                    67.0    1e-09   
ref|WP_038907139.1|  transaldolase                                    66.6    1e-09   
emb|CAX69822.1|  hypotherical protein                                 67.0    1e-09   
ref|WP_011128619.1|  transaldolase                                    67.4    1e-09   
gb|EMS49842.1|  Transaldolase                                         63.9    1e-09   
ref|WP_021616992.1|  transaldolase                                    66.6    1e-09   
gb|AAW25796.1|  SJCHGC05461 protein                                   67.0    1e-09   
ref|WP_024687338.1|  transaldolase                                    66.6    1e-09   
ref|WP_026720505.1|  transaldolase                                    67.0    1e-09   



>ref|XP_009788658.1| PREDICTED: probable transaldolase [Nicotiana sylvestris]
Length=397

 Score =   298 bits (762),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGRLRDW+RNH+GDSE+E AL+RGEDPG ALVTKAY
Sbjct  217  LTFVYSFCQAAAAAQAGASVIQIFVGRLRDWSRNHTGDSEIESALKRGEDPGLALVTKAY  276

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHKYGHKSKLMAAA+RNKQDV+++LGVDYI+TPLK+LQSLKESVTPPDEKYSF RRLS
Sbjct  277  NYIHKYGHKSKLMAAAVRNKQDVFNLLGVDYIITPLKVLQSLKESVTPPDEKYSFIRRLS  336

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            PQSAAA+NFT++E+  WDQYSF+SAMGPAAVELLT GM+GY+NQAKRVEE FGKIW
Sbjct  337  PQSAAAFNFTQDELQKWDQYSFSSAMGPAAVELLTIGMDGYTNQAKRVEEFFGKIW  392



>ref|XP_009626614.1| PREDICTED: probable transaldolase [Nicotiana tomentosiformis]
Length=397

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAG SVIQIFVGRLRDW+RNH+GDSE+E AL+RGEDPG ALVTKAY
Sbjct  217  LTFVYSFCQAAAAAQAGTSVIQIFVGRLRDWSRNHTGDSEIESALKRGEDPGMALVTKAY  276

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHKYGHKSKLMAAA+RNKQDV+++LGVDYI+TPLK+LQSLKESVTPPDEKYSF RRLS
Sbjct  277  NYIHKYGHKSKLMAAAVRNKQDVFNLLGVDYIITPLKVLQSLKESVTPPDEKYSFIRRLS  336

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            PQSAAA+NFT++E+  WDQYSF+SAMGPAAVELL+ GM+GY NQAKRVEELFGKIW
Sbjct  337  PQSAAAFNFTQDELQKWDQYSFSSAMGPAAVELLSIGMDGYINQAKRVEELFGKIW  392



>ref|XP_006355489.1| PREDICTED: probable transaldolase-like [Solanum tuberosum]
Length=397

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGRLRDW+RNH+GDSEVE ALRRGEDPG ALVTKAY
Sbjct  217  LTFVYSFCQAAAAAQAGASVIQIFVGRLRDWSRNHTGDSEVESALRRGEDPGLALVTKAY  276

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHKYGHK+KLMAAA+RNKQDV+++LGVDYI+TPLK+LQSLKESVT PDEKYSF RRLS
Sbjct  277  NYIHKYGHKTKLMAAAVRNKQDVFNLLGVDYIITPLKVLQSLKESVTLPDEKYSFTRRLS  336

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            PQSAA +NFT++E+  WDQYSF+SAMGPA+VELLT GM+GY+NQAKRVEELFGKIW
Sbjct  337  PQSAATFNFTQDELQKWDQYSFSSAMGPASVELLTIGMDGYTNQAKRVEELFGKIW  392



>emb|CDP09917.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGRLRDWARNHSGD EVE ALRRGEDPG ALVTKAY
Sbjct  219  LTFVYSFCQAAAAAQAGASVIQIFVGRLRDWARNHSGDPEVESALRRGEDPGLALVTKAY  278

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHK G+KSKLMAAAIRNKQDV+++LGVDY+VTPLKILQSLK+SVTPPDEKYS  RRLS
Sbjct  279  NYIHKNGYKSKLMAAAIRNKQDVFNLLGVDYVVTPLKILQSLKDSVTPPDEKYSLVRRLS  338

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            PQSAAAYNF++EE+V WDQ  FA AMGPA VELLTAGM+ Y NQAKRVEELFGKIW
Sbjct  339  PQSAAAYNFSQEELVKWDQNGFALAMGPATVELLTAGMDSYVNQAKRVEELFGKIW  394



>gb|EYU30507.1| hypothetical protein MIMGU_mgv1a007833mg [Erythranthe guttata]
Length=394

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGRLRDWARNHS D EVE AL+RGEDPG ALVTKAY
Sbjct  214  MTFVYSFCQAAAAAQAGASVIQIFVGRLRDWARNHSNDPEVEAALKRGEDPGLALVTKAY  273

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            +YIHKYGH SKLMAAAIRNKQDV+++LGVDYI++PLKI+QSLKESVTPPDEKYS  RRLS
Sbjct  274  SYIHKYGHNSKLMAAAIRNKQDVFNLLGVDYIISPLKIMQSLKESVTPPDEKYSLMRRLS  333

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            PQSAA+YNF+ EE+V WDQYSFASAMGPAAVELLTAG++ Y+ Q+KRVEELFGKIW
Sbjct  334  PQSAASYNFSNEELVKWDQYSFASAMGPAAVELLTAGLDSYATQSKRVEELFGKIW  389



>ref|XP_011081206.1| PREDICTED: probable transaldolase [Sesamum indicum]
Length=397

 Score =   287 bits (735),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGRLRDWAR+H GD EVE ALRRGEDPG ALVTKAY
Sbjct  217  MTFVYSFCQAAAAAQAGASVIQIFVGRLRDWARHHKGDPEVEAALRRGEDPGLALVTKAY  276

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHKYGHKSKLMAAAIRNKQDV+++LGVDYI++PLKILQSLKESVTPPDEKYS  RRLS
Sbjct  277  NYIHKYGHKSKLMAAAIRNKQDVFNLLGVDYIISPLKILQSLKESVTPPDEKYSLIRRLS  336

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            PQ+AA+YNFT  E+V WDQYSFA A+GPAAVELL+AGM+GY++Q+KRVEELF KIW
Sbjct  337  PQTAASYNFTNAELVKWDQYSFAEALGPAAVELLSAGMDGYASQSKRVEELFEKIW  392



>ref|XP_010259018.1| PREDICTED: probable transaldolase [Nelumbo nucifera]
Length=396

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIF+GRLRDWARNHSGD E+E A RRGEDPG ALVTKAYNYIHKYG KSKLMAAA+R
Sbjct  234  SVIQIFIGRLRDWARNHSGDPEIEAACRRGEDPGLALVTKAYNYIHKYGFKSKLMAAAVR  293

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLKILQSLKES+T PDEKYSF R LSPQSAAAYNF++E++V WD
Sbjct  294  NKQDIFSLLGVDYIIAPLKILQSLKESITSPDEKYSFVRSLSPQSAAAYNFSEEDLVKWD  353

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASAMGPAA ELL AG+EGY NQAKRVEELFGKIW
Sbjct  354  QLSFASAMGPAAEELLAAGLEGYVNQAKRVEELFGKIW  391



>ref|XP_003631434.1| PREDICTED: probable transaldolase isoform X2 [Vitis vinifera]
 emb|CBI31886.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGR+RDWARNHSGD E+E AL+RGEDPG ALVTKAY
Sbjct  216  LTFVYSFCQAAAAAQAGASVIQIFVGRVRDWARNHSGDPEIEAALKRGEDPGLALVTKAY  275

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHK+G+KSKLMAAA+RNKQD++S+LGVDYI+ PLK+L+SLKES+T PDEKYSF RRLS
Sbjct  276  NYIHKHGYKSKLMAAAVRNKQDLFSLLGVDYIIAPLKVLESLKESITSPDEKYSFVRRLS  335

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            P SAA+Y+F++EE+V WDQ +FAS+MGPAAVELL AG+EGY+ QAKRVEELFGKIW
Sbjct  336  PNSAASYSFSEEELVKWDQLNFASSMGPAAVELLAAGLEGYATQAKRVEELFGKIW  391



>ref|XP_002266734.2| PREDICTED: probable transaldolase [Vitis vinifera]
 emb|CBI25778.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGR+RDWARNHSGD E+E AL+RGEDPG ALVTKAY
Sbjct  216  LTFVYSFCQAAAAAQAGASVIQIFVGRVRDWARNHSGDPEIEAALKRGEDPGLALVTKAY  275

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHK+G+KSKLMAAA+RNKQD++S+LGVDYI+ PLK+L+SLKES+T PDEKYSF RRLS
Sbjct  276  NYIHKHGYKSKLMAAAVRNKQDLFSLLGVDYIIAPLKVLESLKESITSPDEKYSFVRRLS  335

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            P SAA+Y+F++EE+V WDQ +FAS+MGPAAVELL AG+EGY+ QAKRVEELFGKIW
Sbjct  336  PNSAASYSFSEEELVKWDQLNFASSMGPAAVELLAAGLEGYATQAKRVEELFGKIW  391



>ref|NP_001234076.1| transaldolase ToTAL2 [Solanum lycopersicum]
 gb|AAG34725.1| transaldolase ToTAL2 [Solanum lycopersicum]
Length=397

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGRLRDW+RNH+GDSEVE ALRRGEDPG ALVTK Y
Sbjct  217  LTFVYSFCQAAAAAQAGASVIQIFVGRLRDWSRNHTGDSEVESALRRGEDPGLALVTKTY  276

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHKYGHK+KLMAAA+RNK DV+++LG  YI+TPLK+LQSLKESVT  DEKYSF RRLS
Sbjct  277  NYIHKYGHKTKLMAAAVRNKPDVFNLLGGGYIITPLKVLQSLKESVTLLDEKYSFTRRLS  336

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            PQSAAA+NFT++E+  WDQYSF+SAMGPA+VELLT G++GY NQAKRVEELFGKIW
Sbjct  337  PQSAAAFNFTQDELQKWDQYSFSSAMGPASVELLTIGLDGYINQAKRVEELFGKIW  392



>ref|XP_003631436.1| PREDICTED: probable transaldolase isoform X1 [Vitis vinifera]
Length=414

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAAAQAGASVIQIFVGR+RDWARNHSGD E+E AL+RGEDPG ALVTKAY
Sbjct  234  LTFVYSFCQAAAAAQAGASVIQIFVGRVRDWARNHSGDPEIEAALKRGEDPGLALVTKAY  293

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHK+G+KSKLMAAA+RNKQD++S+LGVDYI+ PLK+L+SLKES+T PDEKYSF RRLS
Sbjct  294  NYIHKHGYKSKLMAAAVRNKQDLFSLLGVDYIIAPLKVLESLKESITSPDEKYSFVRRLS  353

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            P SAA+Y+F++EE+V WDQ +FAS+MGPAAVELL AG+EGY+ QAKRVEELFGKIW
Sbjct  354  PNSAASYSFSEEELVKWDQLNFASSMGPAAVELLAAGLEGYATQAKRVEELFGKIW  409



>ref|XP_008238614.1| PREDICTED: probable transaldolase [Prunus mume]
Length=389

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  227  SVIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  286

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES+T P+EKYSF RRLSPQSAA Y F++EE+V WD
Sbjct  287  NKQDLFSLLGVDYIIAPLKVLQSLKESITTPEEKYSFVRRLSPQSAAIYKFSEEELVKWD  346

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASA+GPAAVELL +G++GY+NQA RVEELF KIW
Sbjct  347  QLSFASAVGPAAVELLASGLDGYANQANRVEELFEKIW  384



>ref|XP_007209231.1| hypothetical protein PRUPE_ppa006960mg [Prunus persica]
 gb|EMJ10430.1| hypothetical protein PRUPE_ppa006960mg [Prunus persica]
Length=389

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  227  SVIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  286

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES+T P+EKYSF RRLSPQSAA Y F++EE+V WD
Sbjct  287  NKQDLFSLLGVDYIIAPLKVLQSLKESITTPEEKYSFVRRLSPQSAAIYKFSEEELVKWD  346

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASA+GPAAVELL +G++GY+NQA RVEELF KIW
Sbjct  347  QLSFASAVGPAAVELLASGLDGYANQANRVEELFEKIW  384



>ref|XP_010053436.1| PREDICTED: probable transaldolase [Eucalyptus grandis]
 gb|KCW77733.1| hypothetical protein EUGRSUZ_D02030 [Eucalyptus grandis]
Length=407

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD EV+ AL RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  245  SVIQIFVGRIRDWARNHSGDPEVDAALGRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  304

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES+T PDEKYSF RRLSP+SAA YNF++EE+  WD
Sbjct  305  NKQDLFSLLGVDYIIAPLKVLQSLKESITTPDEKYSFVRRLSPESAATYNFSEEELCKWD  364

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q + ASAMGP +VELL AG++GY NQAKRVEELFGKIW
Sbjct  365  QLTLASAMGPTSVELLAAGLDGYVNQAKRVEELFGKIW  402



>gb|KDP25631.1| hypothetical protein JCGZ_20787 [Jatropha curcas]
Length=399

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD E+E AL+RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  237  SVIQIFVGRLRDWARNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  296

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES+T PDEKYSF RRLSPQSAAAY+F++ EV  WD
Sbjct  297  NKQDLFSLLGVDYIIAPLKVLQSLKESITTPDEKYSFVRRLSPQSAAAYSFSEGEVAKWD  356

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPAAV+LL AG++GY +QA+RVEELF KIW
Sbjct  357  QLSVASAMGPAAVDLLAAGLDGYVDQARRVEELFAKIW  394



>ref|XP_010093688.1| hypothetical protein L484_019027 [Morus notabilis]
 gb|EXB54468.1| hypothetical protein L484_019027 [Morus notabilis]
Length=402

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD EVE AL+RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  240  SVIQIFVGRLRDWARNHSGDPEVEAALKRGEDPGIALVTKAYNYIHKYGHKSKLMAAAVR  299

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT P EKYSF RRLSP++AA YNF+KEE+  WD
Sbjct  300  NKQDLFSLLGVDYIIAPLKVLQSLKESVTAPGEKYSFVRRLSPETAAIYNFSKEELTKWD  359

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S A AMGPAAVELL  G+EG +NQA+RVEELFGKIW
Sbjct  360  QLSLALAMGPAAVELLATGLEGNANQARRVEELFGKIW  397



>ref|XP_010676173.1| PREDICTED: probable transaldolase [Beta vulgaris subsp. vulgaris]
Length=394

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGR+RDWARNHSGD+E++ A++RGEDPG AL+TKAYNYIHKYGHKSKLMAAA+RN
Sbjct  233  VIQIFVGRIRDWARNHSGDTEIDAAVKRGEDPGLALMTKAYNYIHKYGHKSKLMAAAVRN  292

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
            KQD+YS+LGVDYI+ PLK+LQSLKES++ PDEKY+  RRLSPQSAA Y F+K+E+V WDQ
Sbjct  293  KQDLYSLLGVDYIIAPLKVLQSLKESISSPDEKYAIMRRLSPQSAATYEFSKDELVKWDQ  352

Query  242  YSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
             + ASAMGPAAVELLTAG++GY+NQA RVEELFGKIW
Sbjct  353  RTLASAMGPAAVELLTAGIDGYANQANRVEELFGKIW  389



>ref|XP_006368174.1| hypothetical protein POPTR_0001s00260g [Populus trichocarpa]
 gb|ERP64743.1| hypothetical protein POPTR_0001s00260g [Populus trichocarpa]
Length=399

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTKAYNYIHKYG+KSKLMAAA+R
Sbjct  237  SVIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKYGYKSKLMAAAVR  296

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK++QSLKES+T PDEKYSF RRLSP SAAAY+F++EE++ WD
Sbjct  297  NKQDLFSLLGVDYIIAPLKVMQSLKESLTTPDEKYSFVRRLSPHSAAAYSFSEEELIKWD  356

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+VELL AG++GY NQAKRVEELF KIW
Sbjct  357  QLSLASAMGPASVELLAAGLDGYVNQAKRVEELFAKIW  394



>ref|XP_004298660.1| PREDICTED: probable transaldolase [Fragaria vesca subsp. vesca]
Length=389

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTK YNYIHKYGHKSKLMAAA+R
Sbjct  227  SVIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKTYNYIHKYGHKSKLMAAAVR  286

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKE+VT P+EKYSF RRLSPQSAA YNF + E++ WD
Sbjct  287  NKQDLFSLLGVDYIIAPLKVLQSLKETVTTPEEKYSFVRRLSPQSAAKYNFNEAELIKWD  346

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q +FASA+GPAAVELL  G++GY+NQA RVEELFGK+W
Sbjct  347  QLTFASAVGPAAVELLAGGLDGYANQANRVEELFGKLW  384



>ref|XP_009350312.1| PREDICTED: transaldolase-like [Pyrus x bretschneideri]
Length=183

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTKAYNYIHK GHKSKLMAAA+RN
Sbjct  22   VIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKNGHKSKLMAAAVRN  81

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
            KQD++S+LGVDYI+ PLK+LQSLKESVT P++KYSF RRLSPQ+AA Y F +EE++ WDQ
Sbjct  82   KQDLFSLLGVDYIIAPLKVLQSLKESVTTPEDKYSFIRRLSPQTAATYKFNEEELIKWDQ  141

Query  242  YSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
             SFASA+GPAAVELL +G++GY+NQA RVEELF KIW
Sbjct  142  LSFASAVGPAAVELLASGLDGYANQANRVEELFEKIW  178



>ref|XP_011018260.1| PREDICTED: probable transaldolase [Populus euphratica]
Length=401

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTKAYNYIHKYG+KSKLMAAA+R
Sbjct  239  SVIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKYGYKSKLMAAAVR  298

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK++QSLKES T PDEKYSF RRLSP SAAAY+F++EE++ WD
Sbjct  299  NKQDLFSLLGVDYIIAPLKVMQSLKESTTTPDEKYSFVRRLSPHSAAAYSFSEEELIKWD  358

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+VELL AG++GY NQ+KRVEELF KIW
Sbjct  359  QLSLASAMGPASVELLAAGLDGYVNQSKRVEELFAKIW  396



>gb|KHG09888.1| Transaldolase [Gossypium arboreum]
Length=395

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A++RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  233  SVIQIFVGRVRDWARNHSGDPEIEAAIQRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  292

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES+T PDEKYS+ RRLSPQSAA Y+FT EE+  WD
Sbjct  293  NKQDIFSLLGVDYIIAPLKVLQSLKESITSPDEKYSYVRRLSPQSAARYDFTAEELTKWD  352

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+VELL AG++GY NQAKRVEEL  KIW
Sbjct  353  QLSLASAMGPASVELLAAGLDGYVNQAKRVEELLDKIW  390



>gb|KJB37608.1| hypothetical protein B456_006G212700 [Gossypium raimondii]
Length=233

 Score =   266 bits (681),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A++RGEDPG  LVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  71   SVIQIFVGRVRDWARNHSGDPEIEAAIQRGEDPGLGLVTKAYNYIHKYGHKSKLMAAAVR  130

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDY++ PLKILQSLKESVT PDEKYS+ RRLSPQSAA +NFT EE+  WD
Sbjct  131  NKQDLFSLLGVDYVIAPLKILQSLKESVTAPDEKYSYVRRLSPQSAANHNFTAEELTKWD  190

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+++LL AG+EGY NQA RVEEL  KIW
Sbjct  191  QLSLASAMGPASMQLLAAGLEGYVNQANRVEELLDKIW  228



>gb|EPS67513.1| hypothetical protein M569_07263, partial [Genlisea aurea]
Length=338

 Score =   270 bits (690),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            + F   FCQAAAA QAGASVIQIFVGRLRDW+R H+GD EV  AL+RGEDPG ALVTKAY
Sbjct  158  MTFVYSFCQAAAAVQAGASVIQIFVGRLRDWSRGHTGDHEVAEALKRGEDPGLALVTKAY  217

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLS  300
            NYIHKYG+KSKLMAAAIRNKQDV+++LGVDYIV+PLKIL+SLKESVTPPDEKY   RRLS
Sbjct  218  NYIHKYGYKSKLMAAAIRNKQDVFNLLGVDYIVSPLKILESLKESVTPPDEKYRLTRRLS  277

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            PQSAA+Y+F+ EEVV WD+  FAS MGPAAVEL++ G++GY+ Q+K+VEELFGKIW
Sbjct  278  PQSAASYSFSNEEVVKWDEQKFASGMGPAAVELVSGGLDGYATQSKKVEELFGKIW  333



>ref|XP_008373821.1| PREDICTED: transaldolase [Malus domestica]
Length=234

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTKAYNYIHK GHKSKLMAAA+R
Sbjct  72   SVIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKNGHKSKLMAAAVR  131

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT P++KYSF  RLSPQ+AA Y F +EE++ WD
Sbjct  132  NKQDLFSLLGVDYIIAPLKVLQSLKESVTTPEDKYSFIXRLSPQTAATYKFNEEELIKWD  191

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASA+GPAAVELL +G++GY+NQA RVEELF KIW
Sbjct  192  QLSFASAVGPAAVELLASGLDGYANQANRVEELFEKIW  229



>ref|XP_007155630.1| hypothetical protein PHAVU_003G218000g [Phaseolus vulgaris]
 gb|ESW27624.1| hypothetical protein PHAVU_003G218000g [Phaseolus vulgaris]
Length=400

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR RDWARNHSGD E+E AL RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  238  SVIQIFVGRTRDWARNHSGDKEIESALLRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  297

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLKILQ+LKESV  PDEKYSF RRLSPQSAA Y F+ EE+V WD
Sbjct  298  NKQDLFSLLGVDYIIAPLKILQTLKESVASPDEKYSFVRRLSPQSAAQYKFSDEELVKWD  357

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q+S A+AMGPAAV+LL AG++G ++QAKRVE+LFGKIW
Sbjct  358  QHSLANAMGPAAVQLLAAGLDGNADQAKRVEDLFGKIW  395



>gb|KJB84455.1| hypothetical protein B456_N027100, partial [Gossypium raimondii]
Length=159

 Score =   263 bits (672),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  593  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD  414
            IFVGR+RDWAR HSGD E+E A++RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+RNKQD
Sbjct  1    IFVGRVRDWARTHSGDPEIEAAIQRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVRNKQD  60

Query  413  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF  234
            ++S+LGVDYI+ PLK+LQSLKES+T PDEKYS++RRLSPQSAA Y+FT EE+  WDQ S 
Sbjct  61   IFSLLGVDYIIAPLKLLQSLKESITSPDEKYSYDRRLSPQSAARYDFTAEELTKWDQLSL  120

Query  233  ASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            ASAMGPA+VELL AG++GY NQAKRVEEL  KIW
Sbjct  121  ASAMGPASVELLAAGLDGYVNQAKRVEELLDKIW  154



>gb|KJB37609.1| hypothetical protein B456_006G212700 [Gossypium raimondii]
 gb|KJB37610.1| hypothetical protein B456_006G212700 [Gossypium raimondii]
Length=283

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A++RGEDPG  LVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  121  SVIQIFVGRVRDWARNHSGDPEIEAAIQRGEDPGLGLVTKAYNYIHKYGHKSKLMAAAVR  180

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDY++ PLKILQSLKESVT PDEKYS+ RRLSPQSAA +NFT EE+  WD
Sbjct  181  NKQDLFSLLGVDYVIAPLKILQSLKESVTAPDEKYSYVRRLSPQSAANHNFTAEELTKWD  240

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+++LL AG+EGY NQA RVEEL  KIW
Sbjct  241  QLSLASAMGPASMQLLAAGLEGYVNQANRVEELLDKIW  278



>gb|ADG27842.1| transaldolase [Gossypium hirsutum]
Length=395

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWAR+HSGD E+E A++RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  233  SVIQIFVGRVRDWARSHSGDPEIEAAIQRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  292

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NK+D++S+LGVDYI+ PLK+LQSLKES+T PDEKYS++RRLSPQSAA Y+FT EE+  WD
Sbjct  293  NKRDIFSLLGVDYIIAPLKVLQSLKESITSPDEKYSYDRRLSPQSAARYDFTAEELTKWD  352

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+VELL AG++GY NQAKRVEEL  KIW
Sbjct  353  QLSLASAMGPASVELLAAGLDGYVNQAKRVEELLDKIW  390



>ref|XP_007039918.1| Transaldolase isoform 1 [Theobroma cacao]
 gb|EOY24419.1| Transaldolase isoform 1 [Theobroma cacao]
Length=400

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A++RGEDPG  LVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  238  SVIQIFVGRVRDWARNHSGDPEIEAAIQRGEDPGLVLVTKAYNYIHKYGHKSKLMAAAVR  297

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT PDEKYS+ RRLSPQSAA YNFT EE+  WD
Sbjct  298  NKQDLFSLLGVDYIIAPLKVLQSLKESVTVPDEKYSYVRRLSPQSAATYNFTAEELTNWD  357

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S AS+MGPA+VELL AG++GY NQ KRVEEL  KIW
Sbjct  358  QLSLASSMGPASVELLAAGLDGYVNQGKRVEELLVKIW  395



>ref|XP_009343901.1| PREDICTED: probable transaldolase [Pyrus x bretschneideri]
 ref|XP_009343904.1| PREDICTED: probable transaldolase [Pyrus x bretschneideri]
Length=390

 Score =   269 bits (688),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTKAYNYIHK GHKSKLMAAA+R
Sbjct  228  SVIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKNGHKSKLMAAAVR  287

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT P++KYSF RRLSPQ+AA Y F +EE++ WD
Sbjct  288  NKQDLFSLLGVDYIIAPLKVLQSLKESVTTPEDKYSFIRRLSPQTAATYKFNEEELIKWD  347

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASA+GPAAVELL +G++GY+NQA RVEELF KIW
Sbjct  348  QLSFASAVGPAAVELLASGLDGYANQANRVEELFEKIW  385



>ref|XP_006440370.1| hypothetical protein CICLE_v10020501mg [Citrus clementina]
 gb|ESR53610.1| hypothetical protein CICLE_v10020501mg [Citrus clementina]
Length=394

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD E++  L+RGEDP  +LV+KAYNYIHKYGHKSKLMAAA+R
Sbjct  232  SVIQIFVGRLRDWARNHSGDPEIDATLKRGEDPALSLVSKAYNYIHKYGHKSKLMAAAVR  291

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES   PDEKYSF RRLSPQSAA YNFT+EE+  WD
Sbjct  292  NKQDLFSLLGVDYIIAPLKVLQSLKESAISPDEKYSFVRRLSPQSAAMYNFTEEELTKWD  351

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+VELL AG++GY NQA+RVEELF K+W
Sbjct  352  QLSLASAMGPASVELLAAGLDGYVNQARRVEELFEKMW  389



>gb|KDO48369.1| hypothetical protein CISIN_1g016178mg [Citrus sinensis]
Length=394

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD E++ AL+RGEDP  +LV+KAYNYIHKYGHKSKLMAAA+R
Sbjct  232  SVIQIFVGRLRDWARNHSGDPEIDDALKRGEDPALSLVSKAYNYIHKYGHKSKLMAAAVR  291

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES   PDEKYSF RRLSPQSAA YNFT+EE+  WD
Sbjct  292  NKQDLFSLLGVDYIIAPLKVLQSLKESAISPDEKYSFVRRLSPQSAAMYNFTEEELTKWD  351

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+VELL AG++GY NQA+RVE+LF K+W
Sbjct  352  QLSLASAMGPASVELLAAGLDGYVNQARRVEDLFEKMW  389



>ref|XP_006477245.1| PREDICTED: probable transaldolase-like [Citrus sinensis]
Length=398

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD E++ AL+RGEDP  +LV+KAYNYIHKYGHKSKLMAAA+R
Sbjct  236  SVIQIFVGRLRDWARNHSGDPEIDDALKRGEDPALSLVSKAYNYIHKYGHKSKLMAAAVR  295

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES   PDEKYSF RRLSPQSAA YNFT+EE+  WD
Sbjct  296  NKQDLFSLLGVDYIIAPLKVLQSLKESAISPDEKYSFVRRLSPQSAAMYNFTEEELTKWD  355

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+VELL AG++GY NQA+RVE+LF K+W
Sbjct  356  QLSLASAMGPASVELLAAGLDGYVNQARRVEDLFEKMW  393



>ref|XP_003525805.1| PREDICTED: transaldolase-like [Glycine max]
 gb|KHN04339.1| Transaldolase [Glycine soja]
Length=398

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD+E+E A  RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  236  SVIQIFVGRIRDWARNHSGDTEIESAQLRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  295

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESV  PDEKYSF RRLSPQSAA Y F+ EE+V WD
Sbjct  296  NKQDLFSLLGVDYIIAPLKVLQSLKESVASPDEKYSFVRRLSPQSAAKYTFSDEELVRWD  355

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            + S + AMGPAAV+LL AG++G+++QAKRVEELFGKIW
Sbjct  356  EDSLSKAMGPAAVQLLAAGLDGHADQAKRVEELFGKIW  393



>gb|KJB37607.1| hypothetical protein B456_006G212700 [Gossypium raimondii]
Length=395

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A++RGEDPG  LVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  233  SVIQIFVGRVRDWARNHSGDPEIEAAIQRGEDPGLGLVTKAYNYIHKYGHKSKLMAAAVR  292

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDY++ PLKILQSLKESVT PDEKYS+ RRLSPQSAA +NFT EE+  WD
Sbjct  293  NKQDLFSLLGVDYVIAPLKILQSLKESVTAPDEKYSYVRRLSPQSAANHNFTAEELTKWD  352

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ASAMGPA+++LL AG+EGY NQA RVEEL  KIW
Sbjct  353  QLSLASAMGPASMQLLAAGLEGYVNQANRVEELLDKIW  390



>gb|ACU24347.1| unknown [Glycine max]
Length=398

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD+E+E A  RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  236  SVIQIFVGRIRDWARNHSGDTEIESAQLRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  295

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESV  PDEKYSF RRLSPQSAA Y F+ EE+V WD
Sbjct  296  NKQDLFSLLGVDYIIAPLKVLQSLKESVASPDEKYSFVRRLSPQSAAKYTFSDEELVRWD  355

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            + S + AMGPAAV+LL AG++G+++QAKRVEELFGKIW
Sbjct  356  EDSLSKAMGPAAVQLLAAGLDGHADQAKRVEELFGKIW  393



>ref|XP_009407153.1| PREDICTED: probable transaldolase [Musa acuminata subsp. malaccensis]
Length=393

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A R GEDPG ALV K YNYIHKYGHKSKLMAAA+R
Sbjct  231  SVIQIFVGRIRDWARNHSGDPEIEAACRNGEDPGLALVKKTYNYIHKYGHKSKLMAAAVR  290

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LG+DYI+ PLK+LQSLKESVT PDEKYS+ RRLSP SA  YNFT+EE+V WD
Sbjct  291  NKQDIFSLLGIDYIIAPLKLLQSLKESVTYPDEKYSYVRRLSPGSARMYNFTEEELVKWD  350

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASAMGPAA EL+ AG+EGY NQ +RVEELFGKIW
Sbjct  351  QRSFASAMGPAAEELVAAGLEGYVNQTRRVEELFGKIW  388



>ref|XP_007039919.1| Transaldolase isoform 2, partial [Theobroma cacao]
 gb|EOY24420.1| Transaldolase isoform 2, partial [Theobroma cacao]
Length=295

 Score =   261 bits (666),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A++RGEDPG  LVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  144  SVIQIFVGRVRDWARNHSGDPEIEAAIQRGEDPGLVLVTKAYNYIHKYGHKSKLMAAAVR  203

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT PDEKYS+ RRLSPQSAA YNFT EE+  WD
Sbjct  204  NKQDLFSLLGVDYIIAPLKVLQSLKESVTVPDEKYSYVRRLSPQSAATYNFTAEELTNWD  263

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEE  150
            Q S AS+MGPA+VELL AG++GY NQ KRVEE
Sbjct  264  QLSLASSMGPASVELLAAGLDGYVNQGKRVEE  295



>ref|XP_009382350.1| PREDICTED: probable transaldolase [Musa acuminata subsp. malaccensis]
Length=400

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDW+RNH+GD E++   R+GEDPG  LV KAYNYIHKYGHKSKLM AAIR
Sbjct  238  SVIQIFVGRIRDWSRNHTGDPELDAICRKGEDPGLELVAKAYNYIHKYGHKSKLMVAAIR  297

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDY++ PLKILQSLKES+T PDEKYSF R+LSP SA  YNF++EE+V WD
Sbjct  298  NKQDIFSLLGVDYMIAPLKILQSLKESITYPDEKYSFVRKLSPSSAMPYNFSQEELVNWD  357

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SF+SAMGPA+ ELL AG+EGY+NQ KRVEELFGKIW
Sbjct  358  QASFSSAMGPASKELLAAGLEGYANQTKRVEELFGKIW  395



>ref|XP_010493876.1| PREDICTED: probable transaldolase isoform X3 [Camelina sativa]
 ref|XP_010493883.1| PREDICTED: probable transaldolase isoform X4 [Camelina sativa]
 ref|XP_010493889.1| PREDICTED: probable transaldolase isoform X5 [Camelina sativa]
 ref|XP_010493894.1| PREDICTED: probable transaldolase isoform X4 [Camelina sativa]
 ref|XP_010493899.1| PREDICTED: probable transaldolase isoform X5 [Camelina sativa]
Length=259

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  78   ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDTEIETAIKSGEDPGLALVRRSY  137

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  138  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKL  197

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            +P++A  YNFT +E+V WDQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  198  TPETATHYNFTNKELVKWDQLSMASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  254



>ref|XP_010493869.1| PREDICTED: probable transaldolase isoform X2 [Camelina sativa]
Length=265

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  84   ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDTEIETAIKSGEDPGLALVRRSY  143

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  144  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKL  203

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            +P++A  YNFT +E+V WDQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  204  TPETATHYNFTNKELVKWDQLSMASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  260



>ref|XP_010493866.1| PREDICTED: probable transaldolase isoform X1 [Camelina sativa]
 ref|XP_010493906.1| PREDICTED: probable transaldolase isoform X6 [Camelina sativa]
Length=284

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  103  ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDTEIETAIKSGEDPGLALVRRSY  162

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  163  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKL  222

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            +P++A  YNFT +E+V WDQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  223  TPETATHYNFTNKELVKWDQLSMASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  279



>ref|XP_008437125.1| PREDICTED: probable transaldolase [Cucumis melo]
Length=405

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD E+E AL+RGEDPG ALVTKAYNYIHKYG++SKLMAAA+R
Sbjct  243  SVIQIFVGRLRDWARNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKYGYRSKLMAAAVR  302

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT PD+KYSF R+LSPQSAA Y F+++EV  WD
Sbjct  303  NKQDLFSLLGVDYIIAPLKVLQSLKESVTTPDDKYSFIRKLSPQSAANYIFSEDEVKKWD  362

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S AS MGPAA++LL  G+EGY++Q KRVEELF KIW
Sbjct  363  QLSLASGMGPAALQLLANGLEGYADQTKRVEELFEKIW  400



>ref|XP_008787008.1| PREDICTED: probable transaldolase [Phoenix dactylifera]
Length=394

 Score =   261 bits (668),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDW+RNHSGD E+E A ++GEDPG ALVTKAYNYIHKYGH+SKLMAAAIR
Sbjct  232  SVIQIFVGRIRDWSRNHSGDPEIEAACKKGEDPGLALVTKAYNYIHKYGHRSKLMAAAIR  291

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLKILQSLKES+T PDEKYSF RR+SP SA AY+F++EE+V  D
Sbjct  292  NKQDIFSLLGVDYIIAPLKILQSLKESLTYPDEKYSFVRRMSPSSATAYSFSEEELVKLD  351

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            + SF++AMGP A ELL AG+EGY+NQA+R+EEL GKIW
Sbjct  352  RESFSAAMGPGAKELLAAGLEGYANQAQRLEELLGKIW  389



>ref|XP_004516847.1| PREDICTED: transaldolase-like [Cicer arietinum]
Length=389

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHS D E+E A   GEDPG AL  KAYNYIHKYGHKSKLMAAA+R
Sbjct  227  SVIQIFVGRVRDWARNHSDDQEIESAKLNGEDPGLALAAKAYNYIHKYGHKSKLMAAAVR  286

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESV  PDEKYSF RRLSPQSA +Y F+ EE++ WD
Sbjct  287  NKQDLFSLLGVDYIIAPLKVLQSLKESVASPDEKYSFVRRLSPQSARSYMFSDEELIKWD  346

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S A+AMGPAAV+LLTAG++GY +QAKRVE+LFGKIW
Sbjct  347  QMSLANAMGPAAVQLLTAGLDGYVDQAKRVEDLFGKIW  384



>gb|KHN09791.1| Transaldolase [Glycine soja]
Length=397

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD+E+E A  RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  235  SVIQIFVGRIRDWARNHSGDTEIESAQLRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  294

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES+  PDEKYSF RRLS QSAA Y F+ EE+V WD
Sbjct  295  NKQDLFSLLGVDYIIAPLKVLQSLKESIASPDEKYSFVRRLSAQSAAKYTFSDEELVKWD  354

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            + S   AMGPAAV+LL AG++G+++QAKRVEELF KIW
Sbjct  355  EDSLTKAMGPAAVQLLAAGLDGHADQAKRVEELFEKIW  392



>ref|NP_001242359.1| uncharacterized protein LOC100800377 [Glycine max]
 gb|ACU24408.1| unknown [Glycine max]
Length=397

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD+E+E A  RGEDPG ALVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  235  SVIQIFVGRIRDWARNHSGDTEIESAQLRGEDPGLALVTKAYNYIHKYGHKSKLMAAAVR  294

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES+  PDEKYSF RRLS QSAA Y F+ EE+V WD
Sbjct  295  NKQDLFSLLGVDYIIAPLKVLQSLKESIASPDEKYSFVRRLSAQSAAKYTFSDEELVKWD  354

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            + S   AMGPAAV+LL AG++G+++QAKRVEELF KIW
Sbjct  355  EDSLTKAMGPAAVQLLAAGLDGHADQAKRVEELFEKIW  392



>gb|KEH31658.1| transaldolase total2 protein [Medicago truncatula]
Length=399

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A   GEDPG ALVTKAYNYIH+YGHKSKLMAAA+R
Sbjct  237  SVIQIFVGRVRDWARNHSGDKEIESAKLNGEDPGLALVTKAYNYIHQYGHKSKLMAAAVR  296

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESV   DEKYSF RRLSPQSA  Y F+ EE+V WD
Sbjct  297  NKQDLFSLLGVDYIIAPLKVLQSLKESVASGDEKYSFARRLSPQSADRYMFSDEELVKWD  356

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S  +AMGPAAV+LLT+G++GY++QAKRVE+LFGKIW
Sbjct  357  QMSLTNAMGPAAVQLLTSGLDGYADQAKRVEDLFGKIW  394



>ref|XP_003608757.1| Transaldolase [Medicago truncatula]
 gb|AES90954.1| transaldolase total2 protein [Medicago truncatula]
Length=400

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A   GEDPG ALVTKAYNYIH+YGHKSKLMAAA+R
Sbjct  238  SVIQIFVGRVRDWARNHSGDKEIESAKLNGEDPGLALVTKAYNYIHQYGHKSKLMAAAVR  297

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESV   DEKYSF RRLSPQSA  Y F+ EE+V WD
Sbjct  298  NKQDLFSLLGVDYIIAPLKVLQSLKESVASGDEKYSFARRLSPQSADRYMFSDEELVKWD  357

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S  +AMGPAAV+LLT+G++GY++QAKRVE+LFGKIW
Sbjct  358  QMSLTNAMGPAAVQLLTSGLDGYADQAKRVEDLFGKIW  395



>ref|XP_010919480.1| PREDICTED: probable transaldolase [Elaeis guineensis]
Length=394

 Score =   259 bits (661),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDW+RNHSGD E+E A ++GEDPG ALVTKAYNYIHKYGH++KLMAAAIR
Sbjct  232  SVIQIFVGRIRDWSRNHSGDPEIEAACKKGEDPGLALVTKAYNYIHKYGHRTKLMAAAIR  291

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLKILQSLKES+T PDEKYSF RR+SP SA  ++F++EE+V WD
Sbjct  292  NKQDIFSLLGVDYIIAPLKILQSLKESLTYPDEKYSFVRRMSPSSATTHSFSEEELVNWD  351

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SF++A+GP A ELL +G+EGY NQA+R+EEL GKIW
Sbjct  352  QESFSAAVGPGAKELLASGLEGYVNQAQRLEELLGKIW  389



>ref|XP_006307691.1| hypothetical protein CARUB_v10009318mg [Capsella rubella]
 gb|EOA40589.1| hypothetical protein CARUB_v10009318mg [Capsella rubella]
Length=405

 Score =   259 bits (662),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  224  ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVRRSY  283

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  284  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPNDEKYSFVRKL  343

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            +P++A  YNFT +E+V WDQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  344  TPETATHYNFTNKELVKWDQLSLASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  400



>ref|XP_008794812.1| PREDICTED: probable transaldolase [Phoenix dactylifera]
Length=396

 Score =   259 bits (661),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A + GEDPG ALV K YNYIHKYGHKSKL+AAA+R
Sbjct  234  SVIQIFVGRIRDWARNHSGDPEIEAACKNGEDPGLALVKKTYNYIHKYGHKSKLIAAAVR  293

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LG+DYI+ PLKILQSLKESVT P+EKYS+ RRLSP SA  Y+FT+EE++ WD
Sbjct  294  NKQDIFSLLGIDYIIAPLKILQSLKESVTYPEEKYSYVRRLSPGSAKMYDFTEEELIKWD  353

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFA AMGPAA ELL+AG+EGY NQ +R+EELF KIW
Sbjct  354  QMSFACAMGPAAEELLSAGLEGYVNQTRRLEELFAKIW  391



>ref|XP_010458643.1| PREDICTED: probable transaldolase [Camelina sativa]
Length=405

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  224  ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDTEIETAIKSGEDPGLALVRRSY  283

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  284  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKL  343

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            +P++A  YNFT +E+V WDQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  344  TPETATHYNFTNKELVKWDQLSMASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  400



>emb|CDX98081.1| BnaA06g08320D [Brassica napus]
Length=406

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+R
Sbjct  243  SVIQIFVGRLRDWARNHSGDTEIETAVKSGEDPGLALVRRSYNYIHKYGYKSKLMAAAVR  302

Query  425  NKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
            NKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+LSP++A  YNFT +E++ W
Sbjct  303  NKQDLFSLLGVDYVIAPLKVLQSLKDSPAVPDDEKYSFVRKLSPETATHYNFTNKELIKW  362

Query  248  DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            DQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  363  DQLSLASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  401



>ref|XP_010476185.1| PREDICTED: probable transaldolase isoform X1 [Camelina sativa]
 ref|XP_010476186.1| PREDICTED: probable transaldolase isoform X2 [Camelina sativa]
Length=420

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  239  ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDTEIETAIKSGEDPGLALVRRSY  298

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  299  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKL  358

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            +P++A  YNFT +E+V WDQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  359  TPETATHYNFTNKELVKWDQLSMASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  415



>gb|ABK26234.1| unknown [Picea sitchensis]
Length=387

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E AL RGEDPG AL TKA+NYIHK+GHKSKL+AAAIR
Sbjct  225  SVIQIFVGRVRDWARNHSGDQEIESALARGEDPGIALATKAFNYIHKHGHKSKLVAAAIR  284

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LG+DYI+ PLKILQSLK+S T PD+KYSF RRLSP +A AYNFT EE+V WD
Sbjct  285  NKQDIFSLLGIDYIIVPLKILQSLKDSKTLPDDKYSFVRRLSPNAAQAYNFTAEELVKWD  344

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q +FASA+GPAA ELL AG+EGY NQ+KRVE  F KIW
Sbjct  345  QATFASAIGPAAEELLAAGLEGYINQSKRVEAYFTKIW  382



>ref|XP_010906619.1| PREDICTED: probable transaldolase [Elaeis guineensis]
Length=396

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A + GEDPG ALV K YNYIHKYGH+SKLMAAA+R
Sbjct  234  SVIQIFVGRIRDWARNHSGDPEIEAASKNGEDPGLALVKKTYNYIHKYGHESKLMAAAVR  293

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQDV+S+LG+DYI+ PLKILQSLKESVT P EKYS+ R+LSP SA  Y+FT+EE++ WD
Sbjct  294  NKQDVFSLLGIDYIIAPLKILQSLKESVTYPQEKYSYVRKLSPGSAKMYDFTEEELIKWD  353

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASAMGPA+ ELL AG+EGY+NQ +R+EELF KIW
Sbjct  354  QMSFASAMGPASEELLAAGLEGYANQTRRLEELFAKIW  391



>ref|XP_009148608.1| PREDICTED: probable transaldolase [Brassica rapa]
Length=409

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+R
Sbjct  246  SVIQIFVGRLRDWARNHSGDTEIETAVKSGEDPGLALVRRSYNYIHKYGYKSKLMAAAVR  305

Query  425  NKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
            NKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+LSP++A  YNFT +E++ W
Sbjct  306  NKQDLFSLLGVDYVIAPLKVLQSLKDSPAVPDDEKYSFVRKLSPETATHYNFTNKELIKW  365

Query  248  DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            DQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  366  DQLSLASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  404



>ref|XP_004147589.1| PREDICTED: transaldolase-like [Cucumis sativus]
 ref|XP_004167919.1| PREDICTED: transaldolase-like [Cucumis sativus]
Length=405

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD E+E AL+RGEDPG ALVTKA++YIHKYG++SKLMAAA+R
Sbjct  243  SVIQIFVGRLRDWARNHSGDPEIEAALKRGEDPGLALVTKAHHYIHKYGYRSKLMAAAVR  302

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT PD+KYSF R+LSPQSAA Y F+++EV  WD
Sbjct  303  NKQDLFSLLGVDYIIAPLKVLQSLKESVTTPDDKYSFIRKLSPQSAANYIFSEDEVKKWD  362

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S AS MGPAA++LL  G+EGY++Q KRVEELF KIW
Sbjct  363  QLSLASGMGPAALQLLANGLEGYADQTKRVEELFEKIW  400



>gb|KGN50221.1| hypothetical protein Csa_5G160240 [Cucumis sativus]
Length=405

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD E+E AL+RGEDPG ALVTKA++YIHKYG++SKLMAAA+R
Sbjct  243  SVIQIFVGRLRDWARNHSGDPEIEAALKRGEDPGLALVTKAHHYIHKYGYRSKLMAAAVR  302

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT PD+KYSF R+LSPQSAA Y F+++EV  WD
Sbjct  303  NKQDLFSLLGVDYIIAPLKVLQSLKESVTTPDDKYSFIRKLSPQSAANYIFSEDEVKKWD  362

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S AS MGPAA++LL  G+EGY++Q KRVEELF KIW
Sbjct  363  QLSLASGMGPAALQLLANGLEGYADQTKRVEELFEKIW  400



>ref|XP_010941128.1| PREDICTED: probable transaldolase [Elaeis guineensis]
Length=396

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHS D E+E A + GEDPG ALV K YNYIHKYGHKSKLMAAA+R
Sbjct  234  SVIQIFVGRVRDWARNHSSDPEIEAACKNGEDPGLALVKKTYNYIHKYGHKSKLMAAAVR  293

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LG+DYI+ PLKILQSLKESVT P+EKYS+ RRLSP SA  Y+FT+EE+  WD
Sbjct  294  NKQDIFSLLGIDYIIAPLKILQSLKESVTYPEEKYSYVRRLSPGSARMYDFTEEELTKWD  353

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFA AMGPAA ELL AG+EGY NQ KR+EELF KIW
Sbjct  354  QMSFACAMGPAAEELLAAGLEGYVNQTKRLEELFAKIW  391



>dbj|BAD94458.1| hypothetical protein [Arabidopsis thaliana]
Length=284

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  122  VIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  181

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  182  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATHYHFTNKELVKWD  241

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S AS+MGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  242  QLSLASSMGPASVELLSAGVEGYANQAKRVEELFGKIW  279



>gb|ACN40140.1| unknown [Picea sitchensis]
Length=387

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E AL RGEDPG AL TKA+NYIHK+GHKSKL+AA IR
Sbjct  225  SVIQIFVGRVRDWARNHSGDQEIESALARGEDPGIALATKAFNYIHKHGHKSKLVAATIR  284

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LG+DYI+ PLKILQSLK+S T PD+KYSF RRLSP +A AYNFT EE+V WD
Sbjct  285  NKQDIFSLLGIDYIIVPLKILQSLKDSKTLPDDKYSFVRRLSPNAAQAYNFTAEELVKWD  344

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q +FASA+GPAA ELL AG+EGY NQ+KRVE  F KIW
Sbjct  345  QATFASAIGPAAEELLAAGLEGYINQSKRVEAYFTKIW  382



>gb|KFK43488.1| hypothetical protein AALP_AA1G131500 [Arabis alpina]
Length=406

 Score =   257 bits (656),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+R
Sbjct  243  SVIQIFVGRLRDWARNHSGDTEIEAAIKSGEDPGLALVRRSYNYIHKYGYKSKLMAAAVR  302

Query  425  NKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
            NKQD++S+LGVDY++ PLK+LQSLK+S     DEKYSF R+LSP++A  YNFT +E+V W
Sbjct  303  NKQDLFSLLGVDYVIAPLKVLQSLKDSPAISDDEKYSFVRKLSPETATHYNFTNKELVKW  362

Query  248  DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            DQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  363  DQLSLASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  401



>ref|XP_008778383.1| PREDICTED: probable transaldolase, partial [Phoenix dactylifera]
Length=377

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDW+R HSGD ++E A + GEDPG ALV K YNYIHKYGH+SKLMAAA+R
Sbjct  215  SVIQIFVGRIRDWSRTHSGDHDIEAACKNGEDPGLALVKKTYNYIHKYGHRSKLMAAAVR  274

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LG+DYI+ PLKILQ LKESVT P+EKYS+ RRLSP SA  YNFT+EE++ WD
Sbjct  275  NKQDIFSLLGIDYIIAPLKILQYLKESVTYPEEKYSYVRRLSPGSAKMYNFTEEELIEWD  334

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASAMGPAA ELL AG+EGY NQ +R+EELF KIW
Sbjct  335  QMSFASAMGPAAEELLAAGLEGYVNQTRRLEELFAKIW  372



>ref|XP_006417256.1| hypothetical protein EUTSA_v10007790mg [Eutrema salsugineum]
 gb|ESQ35609.1| hypothetical protein EUTSA_v10007790mg [Eutrema salsugineum]
Length=406

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+R
Sbjct  243  SVIQIFVGRLRDWARNHSGDTEIEDAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVR  302

Query  425  NKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
            NKQD++S+LGVDY++ PLK+L+SLK+S   P DEKYSF R+LSP +A  YNFT +E++ W
Sbjct  303  NKQDLFSLLGVDYVIAPLKVLESLKDSPAIPDDEKYSFVRKLSPDTATHYNFTNKELIKW  362

Query  248  DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            DQ S ASAMGPA+VELL+AG+EGY+NQA+RVEELFGKIW
Sbjct  363  DQLSLASAMGPASVELLSAGVEGYANQARRVEELFGKIW  401



>emb|CDY30055.1| BnaC05g09650D [Brassica napus]
Length=471

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+R
Sbjct  308  SVIQIFVGRLRDWARNHSGDTEIETAVKSGEDPGLALVRRSYNYIHKYGYKSKLMAAAVR  367

Query  425  NKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
            NKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  YNFT +E++ W
Sbjct  368  NKQDLFSLLGVDYVIAPLKVLQSLKDSPAVPDDEKYSFVRKLTPETATHYNFTNKELIKW  427

Query  248  DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            DQ S ASAMGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  428  DQLSLASAMGPASVELLSAGVEGYANQAKRVEELFGKIW  466



>ref|XP_006840956.1| hypothetical protein AMTR_s00085p00019560 [Amborella trichopoda]
 gb|ERN02631.1| hypothetical protein AMTR_s00085p00019560 [Amborella trichopoda]
Length=395

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD+EVE A  +GEDPG +LVTKAYNYI K+G+KSKLMAAA+R
Sbjct  233  SVIQIFVGRLRDWARNHSGDAEVEAACLKGEDPGISLVTKAYNYIQKHGYKSKLMAAAVR  292

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDY++ PLKIL SLK+SVT P+EKYS+ RRLSP +AA ++F +EE+V WD
Sbjct  293  NKQDLFSLLGVDYLIIPLKILLSLKDSVTSPEEKYSYIRRLSPSAAATFSFNEEELVKWD  352

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q SFASAMGPAA ELL  G+EGY NQ +RVEELFGKIW
Sbjct  353  QLSFASAMGPAAEELLGVGLEGYVNQTRRVEELFGKIW  390



>ref|NP_563900.1| transaldolase-like protein [Arabidopsis thaliana]
 gb|AAG12571.1|AC022522_4 Similar to transaldolase [Arabidopsis thaliana]
 gb|AAN72047.1| expressed protein [Arabidopsis thaliana]
 gb|AAP37846.1| At1g12230 [Arabidopsis thaliana]
 gb|AEE28853.1| transaldolase-like protein [Arabidopsis thaliana]
Length=405

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  243  VIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  302

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  303  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATHYHFTNKELVKWD  362

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S AS+MGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  363  QLSLASSMGPASVELLSAGVEGYANQAKRVEELFGKIW  400



>ref|XP_010533770.1| PREDICTED: probable transaldolase [Tarenaya hassleriana]
Length=404

 Score =   254 bits (648),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD EVE A++ G+DPG ALV K+YNYIHKYG++SKLMAAA+R
Sbjct  242  SVIQIFVGRLRDWARNHSGDPEVEAAIKAGDDPGLALVRKSYNYIHKYGYRSKLMAAAVR  301

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES T PDEKYSF R+LSP+ A  YNFT +E+V WD
Sbjct  302  NKQDLFSLLGVDYIIAPLKVLQSLKESATTPDEKYSFVRKLSPEIATHYNFTNKELVKWD  361

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q   ASAMG A+VELL+ G+EGY+NQA+RVEELF KIW
Sbjct  362  QLGMASAMGAASVELLSGGVEGYANQARRVEELFAKIW  399



>ref|NP_001184971.1| transaldolase-like protein [Arabidopsis thaliana]
 gb|AEE28854.1| transaldolase-like protein [Arabidopsis thaliana]
Length=427

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  265  VIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  324

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  325  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATHYHFTNKELVKWD  384

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S AS+MGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  385  QLSLASSMGPASVELLSAGVEGYANQAKRVEELFGKIW  422



>gb|AAM66063.1| transaldolase ToTAL2 [Arabidopsis thaliana]
Length=405

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E++ A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  243  VIQIFVGRLRDWARNHSGDTEIKSAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  302

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  303  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATHYHFTNKELVKWD  362

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S AS+MGPA+VELL+AG+EGY+NQAKRVEELFGKIW
Sbjct  363  QLSLASSMGPASVELLSAGVEGYANQAKRVEELFGKIW  400



>gb|AFK49390.1| unknown [Lotus japonicus]
Length=394

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHS D E+E +  RGEDPG  LVTKAYNYIHKYGHKSKLMAAA+R
Sbjct  232  SVIQIFVGRIRDWARNHSDDKEIESSKLRGEDPGLTLVTKAYNYIHKYGHKSKLMAAAVR  291

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSL ESV  PDEKYSF RRLSP+SA+ Y F+ EE++ WD
Sbjct  292  NKQDLFSLLGVDYIIAPLKVLQSLNESVAFPDEKYSFVRRLSPESASRYLFSDEELIKWD  351

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S   AMGPAAV+LL AG++GY++QA RVEE F KIW
Sbjct  352  QTSLTEAMGPAAVQLLAAGLDGYADQATRVEEYFRKIW  389



>ref|XP_003573490.1| PREDICTED: probable transaldolase [Brachypodium distachyon]
Length=397

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SV+QIFVGR+RDWARNHSGD E++ ALR+GED G ALV K Y YIHK G+++KLMAAA+R
Sbjct  235  SVVQIFVGRIRDWARNHSGDPEIDEALRKGEDAGLALVKKVYAYIHKNGYRTKLMAAAVR  294

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQDV+S+LG+DYI+TPLKILQSL ESVT PDEKY + +RL+P     YNF++EE++ WD
Sbjct  295  NKQDVFSLLGIDYIITPLKILQSLDESVTDPDEKYGYVQRLTPSLDKMYNFSEEELLKWD  354

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S A+AMGPAA +LL +G+EGY++QA+RVEELFGKIW
Sbjct  355  QLSLAAAMGPAAEDLLASGLEGYADQARRVEELFGKIW  392



>gb|AAQ17460.1| transaldolase [Gossypium hirsutum]
Length=396

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMA-AAI  429
            SVIQIFVGR+RDWARNHSGD E+E A++RGEDPG  LVTKAYNYIHKYGHK K       
Sbjct  233  SVIQIFVGRVRDWARNHSGDPEIEAAIQRGEDPGLGLVTKAYNYIHKYGHKXKAYGLQQF  292

Query  428  RNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
              KQD++S LGVDYI+ PLKILQSLKES+T PDEKYS+ RRLSPQSAA ++FT EE+  W
Sbjct  293  ETKQDLFSXLGVDYIIAPLKILQSLKESITAPDEKYSYIRRLSPQSAANHDFTAEELTKW  352

Query  248  DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            DQ S ASAMGPA+++LL AG+EGY NQA RVEEL  KIW
Sbjct  353  DQLSLASAMGPASMQLLAAGLEGYVNQANRVEELLDKIW  391



>ref|XP_004972823.1| PREDICTED: transaldolase-like [Setaria italica]
Length=396

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SV+QIFVGRLRDW RNHSGD E++ AL++GED G AL  K Y YIH+ G+K+KLMAAAIR
Sbjct  234  SVVQIFVGRLRDWGRNHSGDPEIDEALKKGEDAGLALAEKVYAYIHRNGYKTKLMAAAIR  293

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N+QDV+S+LG+DYI+ PLKILQSL+ESVT PD KYS+  RL+P     YNFT+EE+V WD
Sbjct  294  NRQDVFSLLGIDYIIAPLKILQSLEESVTDPDVKYSYAPRLTPALGKTYNFTEEELVKWD  353

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S A+AMGPAA ELL +G+EGY NQA+RVEELFGKIW
Sbjct  354  QLSLAAAMGPAAEELLASGLEGYVNQARRVEELFGKIW  391



>ref|XP_002889922.1| hypothetical protein ARALYDRAFT_888542 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66181.1| hypothetical protein ARALYDRAFT_888542 [Arabidopsis lyrata subsp. 
lyrata]
Length=1851

 Score =   254 bits (648),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = -3

Query  605   SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
             SVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+R
Sbjct  1688  SVIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVR  1747

Query  425   NKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
             NKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E++ W
Sbjct  1748  NKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPGDEKYSFVRKLTPETATHYHFTNKELIKW  1807

Query  248   DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
             DQ S ASAMGPA+VEL +AG+EGY+NQAKRVEELFGKIW
Sbjct  1808  DQLSLASAMGPASVELSSAGVEGYANQAKRVEELFGKIW  1846



>dbj|BAJ97939.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SV+QIFVGR+RDWA+NHSGD E++ AL++GED G ALV KAY YIHK G+K+KLMAAA+R
Sbjct  234  SVVQIFVGRIRDWAKNHSGDPEIDEALKKGEDAGLALVKKAYVYIHKNGYKTKLMAAAVR  293

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQDV+S+LG+DYI+ PLKILQSL ESVT  DEKY + +RL+P     YNF++EE+V WD
Sbjct  294  NKQDVFSLLGIDYIIAPLKILQSLDESVTDSDEKYGYVQRLTPSLDKMYNFSQEELVKWD  353

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S A+AMGPAA ELL +G+EGY+NQA+RVEELF K+W
Sbjct  354  QLSLAAAMGPAAEELLASGLEGYANQARRVEELFAKMW  391



>gb|EAZ05627.1| hypothetical protein OsI_27846 [Oryza sativa Indica Group]
Length=399

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SV+QIFVGR+RDWAR HSGD E++ AL++GED G ALV K Y YIHK G+K+KLMAAAIR
Sbjct  237  SVVQIFVGRVRDWARTHSGDPEIDEALKKGEDAGLALVKKVYAYIHKNGYKTKLMAAAIR  296

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQDV+S+LG+DYI+ PLKILQSL+ESVT  D KY +  RL+P     YNFT+EE+V WD
Sbjct  297  NKQDVFSLLGIDYIIAPLKILQSLEESVTDTDVKYGYVPRLTPALGKTYNFTEEELVKWD  356

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S A+AMGPAA ELL +G+EGY NQA+RVEELFGKIW
Sbjct  357  QLSLAAAMGPAAEELLASGLEGYVNQARRVEELFGKIW  394



>ref|XP_002445069.1| hypothetical protein SORBIDRAFT_07g003600 [Sorghum bicolor]
 gb|EES14564.1| hypothetical protein SORBIDRAFT_07g003600 [Sorghum bicolor]
Length=394

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SV+QIFVGRLRDWARNHSGD E++ AL++GED G AL  K Y YIH+ G+K+KLM AAIR
Sbjct  232  SVVQIFVGRLRDWARNHSGDPEIDEALKKGEDAGLALAKKVYAYIHRNGYKTKLMVAAIR  291

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQDV+S+LG+DYI+ PLKILQSL+ESVT PD KY +  +L+P     YNFT+EE+V WD
Sbjct  292  NKQDVFSLLGIDYIIAPLKILQSLEESVTDPDVKYGYVPKLTPAIGKTYNFTEEELVKWD  351

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ++AMGPAA ELL +G+EGY NQA+RVEELFGKIW
Sbjct  352  QLSLSAAMGPAAEELLASGLEGYVNQARRVEELFGKIW  389



>gb|AFW61221.1| hypothetical protein ZEAMMB73_046549 [Zea mays]
Length=266

 Score =   231 bits (590),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SV+Q+FVGRLRDWAR+HSGD E++ AL+ GED G +L  K Y YIH+ G+K+KLMAAAIR
Sbjct  104  SVVQMFVGRLRDWARHHSGDPEIDEALKNGEDAGLSLAKKVYAYIHRNGYKTKLMAAAIR  163

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQDV+S+LG+DYI+ PLKILQSL+ESVT PD KY +  +L+P     YNFT+EE+V WD
Sbjct  164  NKQDVFSLLGIDYIIAPLKILQSLEESVTDPDVKYGYVPKLTPAIGKTYNFTEEELVKWD  223

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ++AMGPAA ELL +G+EGY NQA+RVEELFGKIW
Sbjct  224  QLSLSAAMGPAAEELLASGLEGYVNQARRVEELFGKIW  261



>ref|NP_001061014.1| Os08g0154300 [Oryza sativa Japonica Group]
 dbj|BAC55687.1| putative transaldolase ToTAL2 [Oryza sativa Japonica Group]
 dbj|BAF22928.1| Os08g0154300 [Oryza sativa Japonica Group]
 gb|EAZ41547.1| hypothetical protein OsJ_26073 [Oryza sativa Japonica Group]
Length=399

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SV+QIFVGR+RDWAR HSGD E++ AL++GED G AL  K Y YIHK G+K+KLMAAAIR
Sbjct  237  SVVQIFVGRVRDWARTHSGDPEIDEALKKGEDAGLALAKKVYAYIHKNGYKTKLMAAAIR  296

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQDV+S+LG+DYI+ PLKILQSL+ESVT  D KY +  RL+P     YNFT+EE+V WD
Sbjct  297  NKQDVFSLLGIDYIIAPLKILQSLEESVTDTDVKYGYVPRLTPALGKTYNFTEEELVKWD  356

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S A+AMGPAA ELL +G+EGY NQA+RVEELFGKIW
Sbjct  357  QLSLAAAMGPAAEELLASGLEGYVNQARRVEELFGKIW  394



>ref|NP_001131550.1| hypothetical protein [Zea mays]
 gb|ACF79996.1| unknown [Zea mays]
 gb|AFW61220.1| hypothetical protein ZEAMMB73_046549 [Zea mays]
Length=394

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SV+Q+FVGRLRDWAR+HSGD E++ AL+ GED G +L  K Y YIH+ G+K+KLMAAAIR
Sbjct  232  SVVQMFVGRLRDWARHHSGDPEIDEALKNGEDAGLSLAKKVYAYIHRNGYKTKLMAAAIR  291

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQDV+S+LG+DYI+ PLKILQSL+ESVT PD KY +  +L+P     YNFT+EE+V WD
Sbjct  292  NKQDVFSLLGIDYIIAPLKILQSLEESVTDPDVKYGYVPKLTPAIGKTYNFTEEELVKWD  351

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
            Q S ++AMGPAA ELL +G+EGY NQA+RVEELFGKIW
Sbjct  352  QLSLSAAMGPAAEELLASGLEGYVNQARRVEELFGKIW  389



>ref|XP_006659843.1| PREDICTED: probable transaldolase-like [Oryza brachyantha]
Length=370

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            V+QIFVGR+RDWAR HSGD E++ AL++GED G AL  K Y YIHK G+K+KLMAAAIRN
Sbjct  209  VVQIFVGRVRDWARTHSGDPEIDDALKKGEDAGLALAKKVYAYIHKNGYKTKLMAAAIRN  268

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
            KQDV+S+LG+DYI+ PLKILQSL+E VT  D KY +  RL+P     YNFT+EE+V WDQ
Sbjct  269  KQDVFSLLGIDYIIAPLKILQSLEECVTDTDVKYGYVPRLTPVLGKTYNFTEEELVKWDQ  328

Query  242  YSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
             S A+AMGPAA ELL +G+EGY NQA+RVEELFGKIW
Sbjct  329  LSLAAAMGPAAEELLASGLEGYVNQARRVEELFGKIW  365



>ref|XP_008356506.1| PREDICTED: probable transaldolase [Malus domestica]
Length=214

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDW+RNHSGD E+E AL+RGEDPG ALVTKAYNYIHK GHKSKLMAAA+R
Sbjct  83   SVIQIFVGRLRDWSRNHSGDPEIEAALKRGEDPGLALVTKAYNYIHKNGHKSKLMAAAVR  142

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKESVT P++KYSF  RLSPQ+AA Y F +EE++ WD
Sbjct  143  NKQDLFSLLGVDYIIAPLKVLQSLKESVTTPEDKYSFIXRLSPQTAATYKFNEEELIKWD  202

Query  245  QYSFASAM  222
            Q SFASA+
Sbjct  203  QLSFASAV  210



>gb|EMT17151.1| Transaldolase [Aegilops tauschii]
Length=351

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -3

Query  575  RDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILG  396
            +DWA+NHSGD E++ AL++GED G ALV KAY YIHK G+K+KLMAAA+RNKQDV+S+LG
Sbjct  199  QDWAKNHSGDPEIDEALKKGEDAGLALVKKAYVYIHKNGYKTKLMAAAVRNKQDVFSLLG  258

Query  395  VDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGP  216
            +DYI+ PLKILQSL ESVT  DEKY + +RL+      YNF++EE+V WDQ S A+AMGP
Sbjct  259  IDYIIAPLKILQSLDESVTDSDEKYGYVQRLTLSLDKMYNFSQEELVKWDQLSLAAAMGP  318

Query  215  AAVELLTAGMEGYSNQAKRVEELFGKIW  132
            AA ELL +G+EGY+NQA+RVEELF KIW
Sbjct  319  AAEELLASGLEGYANQARRVEELFAKIW  346



>ref|XP_001780973.1| predicted protein [Physcomitrella patens]
 gb|EDQ54233.1| predicted protein [Physcomitrella patens]
Length=408

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGR+RDWAR +SGD +V+ AL  G DPG ALVTK+YNYIHKYGHKSKLMAAA+RN
Sbjct  247  VIQIFVGRVRDWARTNSGDKDVDAALASGADPGIALVTKSYNYIHKYGHKSKLMAAAVRN  306

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
            KQDV+S+LG+DY++ P+K+L SLKES    ++KY+F RRLSP +A    F+++E+  WDQ
Sbjct  307  KQDVFSLLGLDYLIVPVKVLLSLKESKADLEDKYAFARRLSPSTAQNATFSEQEIQKWDQ  366

Query  242  YSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW  132
             +FA A+GP A +LL  G++GY N  +RVEE F KIW
Sbjct  367  GTFAKALGPLAEDLLRRGLDGYINNTERVEEHFSKIW  403



>gb|KDO48370.1| hypothetical protein CISIN_1g016178mg [Citrus sinensis]
Length=374

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD E++ AL+RGEDP  +LV+KAYNYIHKYGHKSKLMAAA+R
Sbjct  232  SVIQIFVGRLRDWARNHSGDPEIDDALKRGEDPALSLVSKAYNYIHKYGHKSKLMAAAVR  291

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            NKQD++S+LGVDYI+ PLK+LQSLKES   PDEKYSF RRLSPQSAA YNFT+EEV  + 
Sbjct  292  NKQDLFSLLGVDYIIAPLKVLQSLKESAISPDEKYSFVRRLSPQSAAMYNFTEEEVCVFS  351

Query  245  QYSF  234
             + F
Sbjct  352  NFPF  355



>gb|AAL65638.1| transaldolase-like protein [Arabidopsis lyrata]
Length=375

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+R
Sbjct  242  SVIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVR  301

Query  425  NKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
            NKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E++ W
Sbjct  302  NKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPGDEKYSFVRKLTPETATHYHFTNKELIKW  361

Query  248  DQYSFASAMGPAAV  207
            DQ S ASAMGPA+V
Sbjct  362  DQLSLASAMGPASV  375



>gb|AAL65624.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65625.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  224  ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDNEIESAIKSGEDPGLALVKRSY  283

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  284  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPEDEKYSFVRKL  343

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV  207
            +P++A  Y+FT +E+V WDQ S AS+MGPA+V
Sbjct  344  TPETATHYHFTNKELVKWDQLSLASSMGPASV  375



>gb|AAL65627.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65629.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65630.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65631.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  224  ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDNEIESAIKSGEDPGLALVKRSY  283

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  284  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPEDEKYSFVRKL  343

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV  207
            +P++A  Y+FT +E+V WDQ S AS+MGPA+V
Sbjct  344  TPETATHYHFTNKELVKWDQLSLASSMGPASV  375



>gb|AAL65623.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65632.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  243  VIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  302

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  303  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATHYHFTNKELVKWD  362

Query  245  QYSFASAMGPAAV  207
            Q S AS+MGPA+V
Sbjct  363  QLSLASSMGPASV  375



>gb|AAL65605.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65607.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65609.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65611.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65615.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65617.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65619.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  243  VIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  302

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  303  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATHYHFTNKELVKWD  362

Query  245  QYSFASAMGPAAV  207
            Q S AS+MGPA+V
Sbjct  363  QLSLASSMGPASV  375



>gb|AAL65622.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  243  VIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  302

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  303  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATHYHFTNKELVKWD  362

Query  245  QYSFASAMGPAAV  207
            Q S AS+MGPA+V
Sbjct  363  QLSLASSMGPASV  375



>gb|AAL65634.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65636.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  659  IDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY  480
            I F   F QAAAAAQAGASVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++Y
Sbjct  224  ITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDNEIESAIKSGEDPGLALVKRSY  283

Query  479  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRL  303
            NYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L
Sbjct  284  NYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPEDEKYSFVRKL  343

Query  302  SPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV  207
            +P++A  Y+FT +E+V W+Q S AS+MGPA+V
Sbjct  344  TPETATHYHFTNKELVKWNQLSLASSMGPASV  375



>gb|AAL65620.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  243  VIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  302

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  303  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATYYHFTNKELVKWD  362

Query  245  QYSFASAMGPAAV  207
            Q S AS+MGPA+V
Sbjct  363  QLSLASSMGPASV  375



>gb|AAL65612.1| transaldolase-like protein, partial [Arabidopsis thaliana]
 gb|AAL65613.1| transaldolase-like protein, partial [Arabidopsis thaliana]
Length=375

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            VIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+RN
Sbjct  243  VIQIFVGRLRDWARNHSGDTEIESAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVRN  302

Query  422  KQDVYSILGVDYIVTPLKILQSLKES-VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            KQD++S+LGVDY++ PLK+LQSLK+S   P DEKYSF R+L+P++A  Y+FT +E+V WD
Sbjct  303  KQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDDEKYSFVRKLTPETATHYHFTNKELVKWD  362

Query  245  QYSFASAMGPAAV  207
            Q S +S+MGPA+V
Sbjct  363  QLSLSSSMGPASV  375



>ref|XP_002532577.1| transaldolase total2, putative [Ricinus communis]
 gb|EEF29811.1| transaldolase total2, putative [Ricinus communis]
Length=367

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 125/178 (70%), Gaps = 23/178 (13%)
 Frame = -3

Query  683  WKLRAYRPIDFRLQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPG  504
            W LR     DFRLQ C            I++        A  H G  +V   +  GE   
Sbjct  209  WNLRHPDSFDFRLQKC-----------TIKLCAPN----AMGHVG--KVCKEIAAGE---  248

Query  503  SALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEK  324
               VTKAYNYIHKYGHKSKLMAAA+RNKQD++S+LGVDYI+ PLK+LQSLKES+T PDEK
Sbjct  249  ---VTKAYNYIHKYGHKSKLMAAAVRNKQDLFSLLGVDYIIAPLKVLQSLKESITSPDEK  305

Query  323  YSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEE  150
            YSF +RLSPQSAAAY F++EE+V WDQ   ASAMGPAAVELL AG++GY +QA+RV+E
Sbjct  306  YSFVQRLSPQSAAAYKFSEEELVKWDQLGLASAMGPAAVELLAAGLDGYVDQARRVDE  363



>gb|KEH31659.1| transaldolase total2 protein [Medicago truncatula]
Length=353

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGR+RDWARNHSGD E+E A   GEDPG ALVTKAYNYIH+YGHKSKLMAAA+R
Sbjct  238  SVIQIFVGRVRDWARNHSGDKEIESAKLNGEDPGLALVTKAYNYIHQYGHKSKLMAAAVR  297

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV  258
            NKQD++S+LGVDYI+ PLK+LQSLKESV   DEKYSF RRLSPQSA  Y F+ EEV
Sbjct  298  NKQDLFSLLGVDYIIAPLKVLQSLKESVASGDEKYSFARRLSPQSADRYMFSDEEV  353



>gb|EMS49843.1| Transaldolase [Triticum urartu]
Length=170

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  506  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDE  327
            G   V KAY YIHK G+K+KLMAAA+RNKQDV+S+LG+DYI+ PLKILQSL ESVT  DE
Sbjct  41   GRPTVKKAYVYIHKNGYKTKLMAAAVRNKQDVFSLLGIDYIIAPLKILQSLDESVTDSDE  100

Query  326  KYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEEL  147
            KY + +RL+P     YNF++EE+V WDQ S A+AMGPAA ELL +G+EGY+NQA+RVEEL
Sbjct  101  KYGYVQRLTPSLDKMYNFSQEELVKWDQLSLAAAMGPAAEELLASGLEGYANQARRVEEL  160

Query  146  FGKIW  132
            F KIW
Sbjct  161  FVKIW  165



>gb|ACF74318.1| transaldolase [Arachis hypogaea]
Length=92

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -3

Query  392  DYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPA  213
            DYI+ PLKILQSLKES+  PDEKYSF R+LSPQSAA+Y F  EE+V WDQ S A+AMGPA
Sbjct  1    DYIIAPLKILQSLKESIASPDEKYSFVRKLSPQSAASYVFRDEELVKWDQASLAAAMGPA  60

Query  212  AVELLTAGMEGYSNQAKRVEELFGKIW  132
            AV+LL  G++G+++QAKRVEEL GKIW
Sbjct  61   AVQLLATGLDGHADQAKRVEELLGKIW  87



>ref|XP_006417257.1| hypothetical protein EUTSA_v10007790mg [Eutrema salsugineum]
 gb|ESQ35610.1| hypothetical protein EUTSA_v10007790mg [Eutrema salsugineum]
Length=312

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVGRLRDWARNHSGD+E+E A++ GEDPG ALV ++YNYIHKYG+KSKLMAAA+R
Sbjct  243  SVIQIFVGRLRDWARNHSGDTEIEDAIKSGEDPGLALVKRSYNYIHKYGYKSKLMAAAVR  302

Query  425  NKQDVYSILG  396
            NKQD++S+LG
Sbjct  303  NKQDLFSLLG  312



>gb|KDP36162.1| hypothetical protein JCGZ_08806 [Jatropha curcas]
Length=132

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            SVIQIFVG LRDWAR+HSGD E++  L+RGEDPG A VTKAYNYIH YGHKSK MA A  
Sbjct  22   SVIQIFVGHLRDWARDHSGDPEIKATLKRGEDPGLAFVTKAYNYIHNYGHKSKFMAEAAC  81

Query  425  NK  420
            NK
Sbjct  82   NK  83



>ref|XP_005651138.1| aldolase [Coccomyxa subellipsoidea C-169]
 gb|EIE26594.1| aldolase [Coccomyxa subellipsoidea C-169]
Length=402

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 88/172 (51%), Gaps = 20/172 (12%)
 Frame = -3

Query  605  SVIQIFVGRLRDW-------ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSK  447
            SVIQ  +GR+ DW        R+  G  E  G L    +PG  +  + YNY  KY  K+K
Sbjct  225  SVIQPNIGRVDDWFHKYPGVIRDPKGPREDSGFLS-DVNPGVRMAARMYNYCQKYHPKTK  283

Query  446  LMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVT-----------PPDEKYSFERRLS  300
            +M + +R  +D  ++ GVDY+V   K+L +L E+ T           P D++Y +  RLS
Sbjct  284  VMVSGLRKAKDALALAGVDYLVVGPKVLATLSETPTLQGYNDGLTTLPGDDEY-YSPRLS  342

Query  299  PQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            P++A   +F + E+    +  F   +G A V LL  G++G  +  +R+E  F
Sbjct  343  PEAAKEADFEEFELEPVTKQIFEEGLGLAGVSLLKQGVQGLVDDIERLEPFF  394



>gb|KIY94122.1| transaldolase [Monoraphidium neglectum]
Length=222

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 84/165 (51%), Gaps = 12/165 (7%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSG------DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKL  444
            SVIQ  VGR RDW   H G           G     +DPG  LV + Y Y+  Y  ++++
Sbjct  57   SVIQPNVGRARDWNNKHPGAIHEPMGRRRRGGFGAVDDPGLQLVERLYGYVKAYHPRTRV  116

Query  443  MAAAIRNKQDVYSILGVDYIVTPLKILQSLKES--VTPPDEKYSFERRLSPQSAAAYNFT  270
            MA+ IR K D  ++ G DY+V P ++L  L++S  +  PD   + + RLSP      +  
Sbjct  117  MASGIRTKHDALALAGCDYLVLPARVLSDLQDSPALEGPD---AVQLRLSPDLPIGDD-E  172

Query  269  KEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI  135
             + +   D+ SF + +GPA  +LL AG+ G  +  + +   FG +
Sbjct  173  ADNLGQIDEASFDAWLGPAGRQLLGAGVRGMVSDVEALLPYFGAM  217



>ref|WP_027846808.1| transaldolase [Mastigocoleus testarum]
Length=332

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 84/158 (53%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKESYPAA----EDPGVLSVTKIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  I G D +    K+L  L+ ++          R+L P++AAA + +K E+   T
Sbjct  233  NIGEITEIAGCDLLTISPKLLGELQANIA------ELPRKLDPKTAAAMDISKVEMDKAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +D+      M   A E L  G++G++   + +E+L  +
Sbjct  287  FDKMHAEDRM---ASEKLDEGIKGFTKALESLEQLLAE  321



>emb|CCI36366.1| Transaldolase [Microcystis aeruginosa PCC 9701]
Length=325

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 79/147 (54%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+E+      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQET------EADLPRKLDPDQAATLDIVK---INLD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +FA   A    A E LT G++G++ 
Sbjct  283  QATFAKMHAEDAMASEKLTEGIQGFTK  309



>ref|WP_038015619.1| transaldolase [Synechococcus sp. PCC 7335]
Length=331

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 82/156 (53%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKQDTGRDSYPPA----EDPGVQSVTEVYNYYKKFGYKTEIMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +    K+L+ L E+      +    R+LSP+ A   +  K+ +   T
Sbjct  232  NIDEIKELAGCDLLTISPKLLKPLSET------EGDLPRKLSPEDAKDLDIEKKSIDKAT  285

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +D+   A  M   A + L  G+EG+S   + +E+L 
Sbjct  286  FDEMHKADRM---ANDKLAEGIEGFSKALEELEQLL  318



>gb|EDX83816.1| transaldolase [Synechococcus sp. PCC 7335]
Length=330

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 82/156 (53%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  175  TLISPFVGRILDWYKQDTGRDSYPPA----EDPGVQSVTEVYNYYKKFGYKTEIMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +    K+L+ L E+      +    R+LSP+ A   +  K+ +   T
Sbjct  231  NIDEIKELAGCDLLTISPKLLKPLSET------EGDLPRKLSPEDAKDLDIEKKSIDKAT  284

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +D+   A  M   A + L  G+EG+S   + +E+L 
Sbjct  285  FDEMHKADRM---ANDKLAEGIEGFSKALEELEQLL  317



>ref|XP_005844288.1| hypothetical protein CHLNCDRAFT_59034 [Chlorella variabilis]
 gb|EFN52186.1| hypothetical protein CHLNCDRAFT_59034 [Chlorella variabilis]
Length=407

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 83/177 (47%), Gaps = 23/177 (13%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSG-------DSEVEGALRRGE-----DPGSALVTKAYNYIHKY  462
            SV+Q  VGRL DW   H G         E+    + G      +PG  LV K YNYI KY
Sbjct  223  SVVQPNVGRLHDWYNRHPGVIRDPNAPREMSAMAKAGYGANEINPGLLLVEKIYNYIQKY  282

Query  461  -GHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVT----------PPDEKYSF  315
             G ++K+MA+ +R K +  ++ G D++V   K+L +L  S T            D   S 
Sbjct  283  HGGRTKVMASGLRTKAEALALAGCDFLVVGPKVLNTLASSATLDGYNTGLSAAEDVPGSV  342

Query  314  ERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            E RLS + A    F   E+ T D+  F   +G A  +LL  G++     A R+E  F
Sbjct  343  EPRLSAELAQRAEFLPLELDTVDEGRFNEYLGMAGRDLLQEGIQRLVEDANRLEPYF  399



>ref|WP_026442069.1| transaldolase [Acidobacterium sp. PMMR2]
Length=334

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 84/158 (53%), Gaps = 16/158 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + ++G  + +GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKNTG-KDYKGA----EDPGVQSVTRIYNYFKKFGYKTQVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    ++L  L  +      +    R+L P+ A A +  K   +  D
Sbjct  232  NTGEIIELAGCDLLTISPQLLHELDST------QGELPRKLDPEKAKAADIQK---IPMD  282

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            + +F    A    A + L+ G+EG+S   + +E+L  K
Sbjct  283  KATFDKMHAEDKMASDKLSEGIEGFSKALENLEQLLAK  320



>ref|WP_024968637.1| transaldolase [Microcystis aeruginosa]
Length=391

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+E+      +    R+L P  AA  +  K   +T D
Sbjct  232  NIGEIRELAGCDLLTISPKLLEQLQET------EADLPRKLDPDQAATLDIVK---ITMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
              +F    A    A E LT G++G++ 
Sbjct  283  HATFEKMHAEDAMASEKLTEGIQGFTK  309



>dbj|GAN06651.1| transaldolase 1 [Mucor ambiguus]
Length=321

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 76/157 (48%), Gaps = 22/157 (14%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + HSG         + EDPG   VT  YNY  +YG+K+ +M A+ R
Sbjct  174  TLISPFVGRILDWHKAHSGKD-----YSQTEDPGVISVTNIYNYYKQYGYKTIVMGASFR  228

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSP-----QSAAAYNFTKEE  261
            N  ++  + G D++    K+L  L++           ERRLSP     Q   AY F  E 
Sbjct  229  NTGEIEELAGCDFLTISPKLLAELQKDTK------KLERRLSPEGGKKQEKVAY-FNDEV  281

Query  260  VVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEE  150
               WD    A      A E L+ G+  +++   ++EE
Sbjct  282  KFRWDMNEDA-----MATEKLSEGIRNFASDGSKLEE  313



>ref|WP_002755039.1| transaldolase [Microcystis aeruginosa]
 emb|CCH93327.1| Transaldolase [Microcystis aeruginosa PCC 9432]
 emb|CCI07084.1| Transaldolase [Microcystis aeruginosa PCC 7941]
 gb|EPF19542.1| Transaldolase [Microcystis aeruginosa SPC777]
 gb|EPF21078.1| Transaldolase [Microcystis aeruginosa SPC777]
Length=391

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 79/147 (54%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+E+      +    R+L P  AA  +  K   +T D
Sbjct  232  NIGEIRELAGCDLLTISPKLLEQLQET------EADLPRKLDPDQAATLDIVK---ITVD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            + +F    A    A E LT G++G++ 
Sbjct  283  KATFEKMHAEDAMASEKLTEGIQGFTK  309



>ref|WP_002757178.1| transaldolase [Microcystis aeruginosa]
 emb|CCH99174.1| Transaldolase [Microcystis aeruginosa PCC 9717]
Length=391

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+E+      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQET------EADLPRKLDPAQAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +F    A    A E LT G++G++ 
Sbjct  283  QATFEKMHAEDAMASEKLTEGIQGFTK  309



>ref|WP_012266979.1| transaldolase [Microcystis aeruginosa]
 dbj|BAG04159.1| transaldolase [Microcystis aeruginosa NIES-843]
Length=391

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+E+      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQET------EADLPRKLDPAQAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +F    A    A E LT G++G++ 
Sbjct  283  QATFEKMHAEDAMASEKLTEGIQGFTK  309



>ref|WP_004162807.1| transaldolase [Microcystis aeruginosa]
 emb|CCI29886.1| Transaldolase [Microcystis aeruginosa PCC 9809]
Length=391

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+E+      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEIRELAGCDLLTISPKLLEQLQET------EADLPRKLDPAQAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +F    A    A E LT G++G++ 
Sbjct  283  QATFEKMHAEDAMASEKLTEGIQGFTK  309



>ref|WP_009725410.1| transaldolase [Methylophaga lonarensis]
 gb|EMR14083.1| transaldolase [Methylophaga lonarensis MPL]
Length=327

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 84/155 (54%), Gaps = 15/155 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G    E      EDPG   VT+ Y+Y  K+G+ +++M A+ RN
Sbjct  177  LISPFVGRILDWYKKDTGRDSYE----PHEDPGVLSVTEIYSYYKKFGYNTEVMGASFRN  232

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
              ++  + GVD +     +L  L+ +      + + ER+LSP++AA  +  K   +T D+
Sbjct  233  LGEITELAGVDLLTISPGLLDELQNT------EGTLERKLSPEAAAQSDIAK---LTMDK  283

Query  242  YSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELF  144
             +F +  A    A E L+ G++G++   + +EEL 
Sbjct  284  ATFDAMHAENRMAAEKLSEGIDGFAKALETLEELL  318



>ref|WP_002781072.1| Transaldolase [Microcystis aeruginosa]
 emb|CCI15073.1| Transaldolase [Microcystis aeruginosa PCC 9806]
Length=391

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+ +      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQGT------EADLPRKLDPDQAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +FA   A    A E LT G++G++ 
Sbjct  283  QATFAKMHAEDAMASEKLTEGIQGFTK  309



>ref|WP_022637038.1| transaldolase [Chitinivibrio alkaliphilus]
 gb|ERP31540.1| transaldolase [Chitinivibrio alkaliphilus ACht1]
Length=316

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 77/152 (51%), Gaps = 15/152 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW   ++ ++         EDPG   VT+ YNY  KYG+ +++M A+ RN
Sbjct  169  LISPFVGRIYDWYIANTENTSYTPL----EDPGVRSVTRIYNYYKKYGYTTEVMGASFRN  224

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +Y + G D +    K+L  LK+  TP       +R LSPQ A      +EE ++ D+
Sbjct  225  VGQIYGLAGCDLLTISPKLLGELKKESTP------VQRELSPQGAQG---CQEEKLSLDE  275

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVE  153
              F   M   P AVE L+ G+  ++   +  E
Sbjct  276  ADFRWRMNEDPMAVEKLSQGIRAFAADTRSFE  307



>ref|XP_007882463.1| hypothetical protein PFL1_06726 [Pseudozyma flocculosa PF-1]
 gb|EPQ25732.1| hypothetical protein PFL1_06726 [Pseudozyma flocculosa PF-1]
Length=322

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 82/159 (52%), Gaps = 14/159 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ D+ +  S + +  GA     DPG   V K YNY  ++G+K+ +M A+ R
Sbjct  173  TLISPFVGRILDYYKKASPEQDYSGA----NDPGVKSVQKIYNYYKQHGYKTIVMGASFR  228

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            +  +V  + G D++    K+L  LKE+  P       ER+LSP +A A +  +++V   D
Sbjct  229  STSEVLELAGCDFLTIAPKLLAELKEAKGP------VERKLSPDNAKAAD-AQDKVSYVD  281

Query  245  QYS---FASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
              S   F  A  P A   L  G+ G++     +EEL  +
Sbjct  282  NQSAFLFELAKDPMANTKLAEGIAGFAKDGNTLEELLSQ  320



>ref|WP_008206347.1| transaldolase [Microcystis sp. T1-4]
 emb|CCI34188.1| Transaldolase [Microcystis sp. T1-4]
Length=391

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+ +      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQGT------EADLPRKLDPAQAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +FA   A    A E LT G++G++ 
Sbjct  283  QATFAKMHAEDAMASEKLTEGIQGFTK  309



>ref|WP_026785630.1| MULTISPECIES: transaldolase [Planktothrix]
Length=392

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 84/158 (53%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT+ YNY  K+G+++++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYHPA----EDPGVLSVTQIYNYYKKFGYQTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L+ L+ ++          R+L+P++AA+ +  K   ++ D
Sbjct  233  NIGEITELAGCDLLTISPALLEELQSTIG------DLPRKLNPETAASLDLEK---ISID  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            Q +F    A  P A E L  G++G+S   + +E+   +
Sbjct  284  QDTFNRMHAEDPMASEKLEEGIKGFSKALEALEKFLAE  321



>ref|WP_024125117.1| transaldolase TalB [Thermosynechococcus sp. NK55a]
 gb|AHB88728.1| transaldolase TalB [Thermosynechococcus sp. NK55a]
Length=391

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 81/158 (51%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G +E  G     EDPG   VTK YNY  K+G+ +++M A+ R
Sbjct  175  TLISPFVGRILDWYKKKTGRAEYPGP----EDPGVISVTKIYNYYKKFGYPTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +LQ L+ +      +   +R+L P  AA  +  K   V  D
Sbjct  231  NIGEIIELAGCDLLTISPALLQELQNT------RGELKRKLDPAIAATLDIEK---VPMD  281

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            + +F    A    A E L  G++G++   + +E+L  +
Sbjct  282  EATFRKMHAADEMASEKLEEGIKGFTKALETLEDLLSR  319



>ref|WP_026796086.1| MULTISPECIES: transaldolase [Planktothrix]
Length=392

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 84/158 (53%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT+ YNY  K+G+++++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPPA----EDPGVLSVTQIYNYYKKFGYQTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L+ L+ ++          R+L+P++AA+ +  K   ++ D
Sbjct  233  NIGEITELAGCDLLTISPALLEELQSTIG------DLPRKLNPETAASLDLEK---ISID  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            Q +F    A  P A E L  G++G+S   + +E+   +
Sbjct  284  QDTFNRMHAEDPMASEKLEEGIKGFSKALEALEKFLAE  321



>ref|WP_042153668.1| transaldolase [Planktothrix agardhii]
Length=392

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 84/158 (53%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT+ YNY  K+G+++++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPPA----EDPGVLSVTQIYNYYKKFGYQTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L+ L+ ++          R+L+P++AA+ +  K   ++ D
Sbjct  233  NIGEITELAGCDLLTISPALLEELQSTIG------DLPRKLNPETAASLDLEK---ISID  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            Q +F    A  P A E L  G++G+S   + +E+   +
Sbjct  284  QDTFNRMHAEDPMASEKLEEGIKGFSKALEALEKFLAE  321



>ref|WP_036315792.1| transaldolase [Methylophaga thiooxydans]
 gb|KGM05901.1| Transaldolase [Methylophaga thiooxydans]
Length=327

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 79/155 (51%), Gaps = 11/155 (7%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G    E A    EDPG   VT+ +NY  K+G K+++M A+ RN
Sbjct  177  LISPFVGRILDWYKKDTGRDSYEPA----EDPGVVSVTQIFNYFKKFGLKTEVMGASFRN  232

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
              ++  + GVD +    K+L  L+ +      +    R+L+   A A +  + + +T + 
Sbjct  233  VGEITELAGVDLLTISPKLLDELQST------EGDLPRKLNEADAQASDVERID-MTKET  285

Query  242  YSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +    A  P A E L  G++G++   + +EEL   
Sbjct  286  FEAMHAQDPMATEKLQEGIDGFAKALESLEELLAN  320



>ref|WP_002739596.1| transaldolase [Microcystis aeruginosa]
 gb|ELP52094.1| transaldolase [Microcystis aeruginosa TAIHU98]
Length=391

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 77/147 (52%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+E+      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQET------EADLPRKLDPDQAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +F    A    A E L  G++G++ 
Sbjct  283  QATFEKMHAEDAMASEKLAEGIQGFTK  309



>gb|KEI66743.1| Tal [Planktothrix agardhii NIVA-CYA 126/8]
Length=408

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 84/158 (53%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT+ YNY  K+G+++++M A+ R
Sbjct  193  TLISPFVGRILDWYKKDTGRDSYPPA----EDPGVLSVTQIYNYYKKFGYQTEVMGASFR  248

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L+ L+ ++          R+L+P++AA+ +  K   ++ D
Sbjct  249  NIGEITELAGCDLLTISPALLEELQSTIG------DLPRKLNPETAASLDLEK---ISID  299

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            Q +F    A  P A E L  G++G+S   + +E+   +
Sbjct  300  QDTFNRMHAEDPMASEKLEEGIKGFSKALEALEKFLAE  337



>ref|WP_014704248.1| transaldolase [Methylophaga frappieri]
 gb|AFJ02828.1| Transaldolase [Methylophaga frappieri]
Length=327

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 84/157 (54%), Gaps = 15/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      +    EDPG   VT+ Y+Y  K+G+ +++M A+ R
Sbjct  176  TLISPFVGRILDWYKKDTG----RDSYASHEDPGVLSVTEIYSYYKKFGYNTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + GVD +     +L  L+++      + + ER+LSP+ AA  N  K  +   T
Sbjct  232  NVGEITELAGVDLLTISPALLDELQKT------EGTLERKLSPEKAANANIDKISIDKAT  285

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFG  141
            +D+    + M   A E L+ G++G++   + +EEL  
Sbjct  286  FDKMHDENRM---AAEKLSEGIDGFAKALETLEELLA  319



>ref|WP_019498168.1| transaldolase [Pseudanabaena sp. PCC 6802]
Length=392

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 78/157 (50%), Gaps = 15/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGRDSYPPA----EDPGVLSVTNIYNYFKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+E+V          R+L P  AA    TK  +   T
Sbjct  233  NAAEITELAGCDLLTISPALLAELQETVA------ELPRKLDPDKAAQSEITKLHIDKET  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFG  141
            +D+   +  M   A + LT G+ G++N    +E+L  
Sbjct  287  FDRMHESDRM---ASDKLTEGIHGFTNALIALEKLLA  320



>ref|WP_011056320.1| transaldolase [Thermosynechococcus elongatus]
 ref|NP_681257.1| transaldolase/EF-hand domain-containing protein [Thermosynechococcus 
elongatus BP-1]
 sp|Q8DLL7.1|TAL_THEEB RecName: Full=Transaldolase [Thermosynechococcus elongatus BP-1]
 dbj|BAC08019.1| transaldolase [Thermosynechococcus elongatus BP-1]
Length=391

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 79/156 (51%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G +E  G     EDPG   VTK YNY  K+G+ +++M A+ R
Sbjct  175  TLISPFVGRILDWYKKKTGRAEYPGP----EDPGVISVTKIYNYYKKFGYPTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +LQ L+ +          +R+L P  AA  +  K   V  D
Sbjct  231  NIGEIIELAGCDLLTISPALLQELQNTTG------ELKRKLDPAIAATLDIEK---VAMD  281

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            + +F    A    A E L  G++G++   + +E+L 
Sbjct  282  EATFRKMHAADEMASEKLEEGIKGFTKALETLEDLL  317



>ref|XP_001728741.1| hypothetical protein MGL_4076 [Malassezia globosa CBS 7966]
 gb|EDP41527.1| hypothetical protein MGL_4076 [Malassezia globosa CBS 7966]
Length=324

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 87/175 (50%), Gaps = 22/175 (13%)
 Frame = -3

Query  641  FCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKY  462
            FCQA A A+A  ++I  FVGR+ DW + +  D++  GA     DPG   V   YNY  ++
Sbjct  162  FCQAVACAEANVTLISPFVGRILDWFKKNKPDADYSGA----NDPGVKSVQLIYNYYKQH  217

Query  461  GHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAA  282
            G+ + +M A+ RN  ++  + GVD++    K+L  LK S T        ER+LS ++A A
Sbjct  218  GYNTIVMGASFRNTSEIVELAGVDFLTIAPKLLDELKNSQT------KLERKLSKENAQA  271

Query  281  YN-------FTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
                        E    W Q     AMG    + L  G+  +++ A  ++E+ GK
Sbjct  272  AKPIEKHSYIDNESAFRWAQ--LEDAMG---FDKLHEGIRKFADDAVTLKEIIGK  321



>ref|WP_039725382.1| MULTISPECIES: transaldolase [Oscillatoriophycideae]
 gb|KIF13713.1| transaldolase [Aphanocapsa montana BDHKU210001]
 gb|KIF41600.1| transaldolase [Lyngbya confervoides BDU141951]
Length=391

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 80/157 (51%), Gaps = 16/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VT+ YNY  K+G+++++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKE-----YNPTEDPGVQSVTEIYNYYKKFGYQTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  LKE      ++   ER+L P  AA  +  K   +T D
Sbjct  232  NIGEICELAGCDLLTISPKLLAQLKE------QEEVLERKLDPAKAADMDIEK---ITMD  282

Query  245  QYSFASAMGP--AAVELLTAGMEGYSNQAKRVEELFG  141
            + +F +       A E L  G++G+S   + +E+L  
Sbjct  283  KATFDNMHQDDRMASEKLDEGIKGFSKALESLEQLLA  319



>dbj|GAL93103.1| transaldolase [Microcystis aeruginosa NIES-44]
Length=391

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 77/147 (52%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+ +      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQGT------EADLPRKLDPDQAATLDIVK---IDLD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +F    A    A E LT G++G++ 
Sbjct  283  QATFEKMHAEDAMASEKLTEGIQGFTK  309



>emb|CEP15643.1| hypothetical protein [Parasitella parasitica]
Length=321

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 74/156 (47%), Gaps = 20/156 (13%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + HSG         + EDPG   VT  YNY  +YG+K+ +M A+ R
Sbjct  174  TLISPFVGRILDWHKAHSGKD-----YSQTEDPGVISVTNIYNYYKQYGYKTIVMGASFR  228

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYN----FTKEEV  258
            N  ++  + G D++    K+L  L++           ER+LSP+    +     F  E  
Sbjct  229  NTGEIEELAGCDFLTISPKLLGDLQKDTK------KLERKLSPEGGKKHAKVSYFNDECK  282

Query  257  VTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEE  150
              WD    A      A E L+ G+  ++    ++EE
Sbjct  283  FRWDMNEDA-----MATEKLSEGIRNFAKDGAKLEE  313



>ref|WP_002743970.1| transaldolase [Microcystis aeruginosa]
 emb|CAO86954.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS47899.1| transaldolase [Microcystis aeruginosa DIANCHI905]
Length=391

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 77/147 (52%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+ +      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQGT------EADLPRKLDPAQAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +F    A    A E LT G++G++ 
Sbjct  283  QATFEKMHAEDAMASEKLTEGIQGFTK  309



>ref|WP_035356899.1| transaldolase, partial [Edaphobacter aggregans]
Length=241

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 83/158 (53%), Gaps = 21/158 (13%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +   G  E+       +DPG A V++ YNY  KYG+++++M A+ R
Sbjct  90   TLISPFVGRIYDWYKKEHGGGEIPA----DQDPGVASVSRIYNYYKKYGYRTQIMGASFR  145

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N   +  + G D +    ++L+ L+++      + S ER+L P  A     +KEE +  D
Sbjct  146  NVNQILHLAGSDLLTISPELLEQLEQT------EGSLERKLDPAKAQE---SKEERLHLD  196

Query  245  QYSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEEL  147
            + +F       AM   A E L  G+  +++ A+ +E+ 
Sbjct  197  EKTFRWMHNEDAM---ATEKLAEGIRKFNSDARHLEDF  231



>ref|WP_012953625.1| transaldolase [Candidatus Atelocyanobacterium thalassa]
 gb|ADB94960.1| transaldolase [Candidatus Atelocyanobacterium thalassa isolate 
ALOHA]
Length=326

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 82/156 (53%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + ++G+          EDPG   V + YNY  K+G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKNTGED-----YSSSEDPGVISVAQIYNYYKKFGYKTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +    K+L+ LK +    D+K    R+L P  A + N  K  +   T
Sbjct  231  NVGEIRELAGCDLLTISPKLLEELKST----DDK--LLRKLDPNKATSMNLEKISIDKAT  284

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +D+    + M   A + L  G++G++   + +EE+ 
Sbjct  285  FDKMHKENQM---AYDKLDEGIKGFTQALESLEEML  317



>ref|WP_027159358.1| transaldolase [Methylobacter luteus]
Length=328

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 80/156 (51%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYAPA----EDPGVLSVTDVYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +      +    R+L PQ AA+ +  K   +T D
Sbjct  233  NIGEITELAGCDLLTIAPSLLGELQAT------EGELVRKLDPQKAASASIEK---ITMD  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            + +F    A    A E L+ G+EG++   + +E+L 
Sbjct  284  KATFDRMHAENRMASEKLSEGIEGFTKALETLEKLL  319



>ref|WP_015198547.1| transaldolase [Calothrix parietina]
 gb|AFZ01917.1| transaldolase [Calothrix sp. PCC 6303]
Length=334

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 79/158 (50%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPAA----EDPGVLSVTKIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +    ++L  L+ S T         R+L P  A A    K  V   +
Sbjct  233  NIGEITELAGCDLLTISPQLLTELQGSTT------ELPRKLDPAKATAMTIEKIAVDKAS  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +D+   +  M   A E L  G++G++   + +E+L  +
Sbjct  287  YDKMHASDRM---ASEKLDEGIKGFTKALETLEQLLAE  321



>ref|WP_035615704.1| transaldolase [Haloferula sp. BvORR071]
Length=319

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 79/154 (51%), Gaps = 16/154 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G +  EG     EDPG   V + Y Y  K+G+K+++M A+ RN
Sbjct  175  LISPFVGRILDWYKASTGKT-FEG----DEDPGVISVKQIYTYYKKFGYKTQVMGASFRN  229

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
            K ++ ++ G D +     +L  L  S  P       ERRLSP+ +A  +  K    T+D+
Sbjct  230  KGEILALAGCDLLTISPGLLGELASSGDP------IERRLSPEESAKADLQK---ATFDE  280

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL  147
             SF  A+     A E    G+  ++    ++E+L
Sbjct  281  KSFRFALNEDAMATEKTAQGIRAFAADIVKLEKL  314



>ref|WP_013325338.1| transaldolase [Cyanothece sp. PCC 7822]
 gb|ADN17300.1| transaldolase [Cyanothece sp. PCC 7822]
Length=392

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 82/157 (52%), Gaps = 16/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G  +  GA    EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETG-KDYTGA----EDPGVQSVTKIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    ++L+ LK +      +    R+L P+ AA+ +  K   ++ D
Sbjct  232  NISEICELAGSDLLTISPQLLEQLKNT------QAELPRKLDPEKAASLDLEK---ISLD  282

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFG  141
            + +F    A    A E L  G+ G++   + +E L  
Sbjct  283  RETFDKMHAEDRMAYEKLDEGITGFTKALEVLEHLLA  319



>ref|WP_043944502.1| transaldolase [Ralstonia solanacearum]
Length=319

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 80/158 (51%), Gaps = 17/158 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G++    A     DPG   V + YNY  ++G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKDAGNAWDPVAQGGANDPGVQSVLRIYNYYKRFGYTTEVMGASFRN  226

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++L  L++S TP       ER+LSP+ A A N  +   +  D+
Sbjct  227  TSQIVELAGCDLLTISPELLAQLQQSDTP------VERKLSPEHAQATNLVR---LPADE  277

Query  242  YSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
             +F     A AMG    E L  G+  ++  A ++E L 
Sbjct  278  AAFRWHLNADAMG---TEKLAEGIRLFAADAVKLERLI  312



>ref|WP_015222082.1| transaldolase [Cyanobacterium stanieri]
 gb|AFZ46764.1| transaldolase [Cyanobacterium stanieri PCC 7202]
Length=391

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 84/156 (54%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + ++G  +  GA    +DPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKNTG-KDYTGA----DDPGVQSVTQIYNYYKKFGYKTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +    ++LQ+LK +      +    R+L P+ AA+ +  K  V   T
Sbjct  231  NISEITELAGCDLLTISPQLLQTLKNT------EEELPRKLCPEVAASMDIEKISVDKAT  284

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +D+      M   A + L  G++G++   + +E L 
Sbjct  285  FDEMHDKDIM---ANDKLDEGIKGFTKALETLENLL  317



>ref|WP_019140538.1| transaldolase [Herbaspirillum massiliense]
Length=311

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 81/158 (51%), Gaps = 16/158 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G  E  GA    +DPG   V + YNY  K+G+++++M A+ RN
Sbjct  167  LISPFVGRIYDWHKKSTG-QEYAGA----DDPGVQSVKRIYNYYRKFGYRTEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++LQ L ES  P        R+LSP+ A   +  K   +T D+
Sbjct  222  TSQIVELAGCDLLTISPELLQKLAESNAP------VSRKLSPEQAQMTDLQK---LTLDE  272

Query  242  YSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELFGKI  135
             +F   +   A+  E L  G+  +   A ++E++  ++
Sbjct  273  KAFRLMLNDDAMGTEKLAEGIRLFCADAVKLEKMVAEL  310



>ref|WP_015080657.1| transaldolase TalAB [Anabaena sp. 90]
 gb|AFW95503.1| transaldolase TalAB [Anabaena sp. 90]
Length=333

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 77/158 (49%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPAA----EDPGVLSVTTIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ +VT         R+L P   A  +  K  V   T
Sbjct  233  NIGEITELAGCDLLTISPGLLTELQNTVT------ELPRKLDPAKVAGLSIAKISVDKAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +DQ   A  M   A + L  G++G++     +E+L  +
Sbjct  287  FDQMHNADRM---ASDKLAEGIDGFTKALISLEKLLAE  321



>ref|WP_040054790.1| transaldolase [Candidatus Atelocyanobacterium thalassa]
 gb|KFF41446.1| transaldolase [Candidatus Atelocyanobacterium thalassa isolate 
SIO64986]
Length=326

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 83/156 (53%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + ++G           EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKNTGKE-----YSSMEDPGVVSVTKIYNYYKKFGYKTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +    K+L+ LK +    D+  +  R+L P  AA+ +  K  +   T
Sbjct  231  NIGEIRELAGSDLLTISPKLLEELKST----DD--TLLRKLDPSKAASMDIEKISIDKAT  284

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +D+    + M   A + L  G++G++   + +EE+ 
Sbjct  285  FDKMHKENQM---AYDKLDEGIKGFTQALESLEEML  317



>ref|WP_010473139.1| transaldolase [Acaryochloris sp. CCMEE 5410]
Length=398

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 76/156 (49%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           +DPG   VT+ YNY  K+G+ +++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGQD-----YTPSDDPGVQSVTQIYNYYKKFGYTTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L+ S        +  R+L P  AA     K   +  D
Sbjct  232  NTGEILELAGCDLLTISPKLLAQLQASTD------NVPRKLDPSKAAGMEIEK---LAID  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELF  144
            Q +F    A  P A E L  G++G+S   + +E+L 
Sbjct  283  QATFMQMHANDPMASEKLEEGIKGFSKALETLEQLL  318



>ref|WP_011818027.1| transaldolase [Prochlorococcus marinus]
Length=333

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 84/172 (49%), Gaps = 16/172 (9%)
 Frame = -3

Query  647  LQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIH  468
              FCQA   A A  ++I  FVGR+ DW +  +G +   GA    EDPG   VT+ YNY  
Sbjct  162  FNFCQAVTCANAKITLISPFVGRILDWHKAKTGKTSFVGA----EDPGVISVTQIYNYFK  217

Query  467  KYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRL--SPQ  294
            + G K+++M A+ RN  ++  + G D +    K L+ LK+      EK    R+L  S Q
Sbjct  218  EKGFKTEVMGASFRNLDEIKELAGCDLLTIAPKFLEELKK------EKGELVRKLDESTQ  271

Query  293  SAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
               + ++  EE      +  +      A E L+ G+ G+S   + +EEL  K
Sbjct  272  INNSIDYEFEE----KDFRLSMLEDQMASEKLSEGITGFSKAIEELEELLIK  319



>gb|ABM69861.1| Transaldolase [Prochlorococcus marinus str. AS9601]
Length=341

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 84/172 (49%), Gaps = 16/172 (9%)
 Frame = -3

Query  647  LQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIH  468
              FCQA   A A  ++I  FVGR+ DW +  +G +   GA    EDPG   VT+ YNY  
Sbjct  170  FNFCQAVTCANAKITLISPFVGRILDWHKAKTGKTSFVGA----EDPGVISVTQIYNYFK  225

Query  467  KYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRL--SPQ  294
            + G K+++M A+ RN  ++  + G D +    K L+ LK+      EK    R+L  S Q
Sbjct  226  EKGFKTEVMGASFRNLDEIKELAGCDLLTIAPKFLEELKK------EKGELVRKLDESTQ  279

Query  293  SAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
               + ++  EE      +  +      A E L+ G+ G+S   + +EEL  K
Sbjct  280  INNSIDYEFEE----KDFRLSMLEDQMASEKLSEGITGFSKAIEELEELLIK  327



>gb|EPB92443.1| transaldolase [Mucor circinelloides f. circinelloides 1006PhL]
Length=321

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 74/156 (47%), Gaps = 20/156 (13%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + +SG         + EDPG   VT  YNY  +YG+K+ +M A+ R
Sbjct  174  TLISPFVGRILDWHKANSGKD-----YSQTEDPGVISVTNIYNYYKQYGYKTIVMGASFR  228

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYN----FTKEEV  258
            N  ++  + G D++    K+L  L++           ER+LSPQ     +    F  E  
Sbjct  229  NTGEIEELAGCDFLTISPKLLGELQKDTK------KLERKLSPQGGKKLDKVSYFNDEVK  282

Query  257  VTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEE  150
              WD    A      A E L+ G+  ++    ++EE
Sbjct  283  FRWDMNEDA-----MATEKLSEGIRNFAKDGVKLEE  313



>ref|YP_002049507.1| transaldolase [Paulinella chromatophora]
 gb|ACB43297.1| transaldolase [Paulinella chromatophora]
Length=325

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 77/153 (50%), Gaps = 16/153 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + +SG +   G+    EDPG   VTK +NY  KYG+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKANSGITTYLGS----EDPGVMSVTKIFNYYKKYGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G+D +     +L  LK +          E +L  +  +    + EE +  D
Sbjct  232  NIDEIVELAGIDLLTIAPTLLNQLKNT----------EGKLIRKLNSLVPISTEERLQLD  281

Query  245  QYSFASAMGP--AAVELLTAGMEGYSNQAKRVE  153
            Q  F   M     A E LT G+ G++   + +E
Sbjct  282  QRKFEQLMNLDRMASEKLTEGILGFTKAIENLE  314



>ref|WP_031433502.1| transaldolase [Methylomarinum vadi]
Length=328

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 82/156 (53%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      +    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTG----RDSYPANEDPGVLSVTDVYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +      +    R+LSP++AAA +  K   ++ D
Sbjct  233  NIGEITELAGCDLLTIAPALLAELQST------EGELPRKLSPEAAAAMDIEK---ISID  283

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELF  144
            + +F    A    A + L+ G++G++   + +E+L 
Sbjct  284  KDTFDKMHAENRMATDKLSEGIDGFAKALETLEKLL  319



>ref|WP_007363108.1| MULTISPECIES: transaldolase [unclassified Opitutaceae]
 gb|EIQ00151.1| transaldolase [Opitutaceae bacterium TAV1]
 gb|AHF91885.1| transaldolase [Opitutaceae bacterium TAV5]
Length=314

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 76/157 (48%), Gaps = 16/157 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW + ++G           EDPG   VT+ Y Y  K+G+K+++M A+ RN
Sbjct  169  LISPFVGRILDWHKKNTGKDYAPA-----EDPGVQSVTQIYTYYKKFGYKTEVMGASFRN  223

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
            K ++  + G D +     +L  LK    P        R+L P  A + +  K   VT+D+
Sbjct  224  KGEILELAGCDLLTISPALLAELKAGDGP------VTRKLDPAKAPSADLEK---VTFDE  274

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEELFGK  138
             SF  A+     A E    G+  +S    ++E+L  K
Sbjct  275  KSFRFALNEDAMATEKTAEGIRLFSADIVKLEQLIAK  311



>ref|WP_038490793.1| transaldolase [Collimonas arenae]
 gb|AIY42486.1| Transaldolase [Collimonas arenae]
Length=311

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 80/154 (52%), Gaps = 16/154 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  SG  +  GA    +DPG   V + Y+Y  K+G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKSSG-HDYSGA----DDPGVLSVKQIYSYFRKFGYATEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +     +LQ+L ES TP        R+LSP+++   +  K   +  D+
Sbjct  222  TAQIVELAGCDLLTISPDLLQALAESDTP------VSRKLSPEASLQSDVKK---IDLDE  272

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL  147
             SF + +     A E L  G+  +S  A ++E++
Sbjct  273  TSFRTMLNDDAMATEKLAEGIRQFSADAVKLEKM  306



>ref|WP_002772050.1| transaldolase [Microcystis aeruginosa]
 emb|CCI04937.1| Transaldolase [Microcystis aeruginosa PCC 9443]
 emb|CCI16097.1| Transaldolase [Microcystis aeruginosa PCC 9807]
Length=391

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 77/147 (52%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+E+      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEIRELAGCDLLTISPKLLEQLQET------EADLPRKLDPALAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            + +F    A    A E L  G++G++ 
Sbjct  283  KATFEKMHAEDAMASEKLAEGIQGFTK  309



>gb|ABW30943.1| transaldolase [Acaryochloris marina MBIC11017]
Length=421

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 76/156 (49%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           +DPG   VT+ YNY  K+G+ +++M A+ R
Sbjct  200  TLISPFVGRILDWYKKETGQD-----YTPSDDPGVQSVTQIYNYYKKFGYTTEVMGASFR  254

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L+ S        +  R+L P  AA     K   +  D
Sbjct  255  NTCEILELAGCDLLTISPKLLAQLQASTD------NVPRKLDPSKAAGMEIEK---LAID  305

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELF  144
            Q +F    A  P A E L  G++G+S   + +E+L 
Sbjct  306  QATFLQMHADDPMASEKLEEGIKGFSKALETLEQLL  341



>ref|WP_041660622.1| transaldolase [Acaryochloris marina]
Length=398

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 76/156 (49%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           +DPG   VT+ YNY  K+G+ +++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGQD-----YTPSDDPGVQSVTQIYNYYKKFGYTTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L+ S        +  R+L P  AA     K   +  D
Sbjct  232  NTCEILELAGCDLLTISPKLLAQLQASTD------NVPRKLDPSKAAGMEIEK---LAID  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELF  144
            Q +F    A  P A E L  G++G+S   + +E+L 
Sbjct  283  QATFLQMHADDPMASEKLEEGIKGFSKALETLEQLL  318



>ref|WP_016874473.1| transaldolase [Chlorogloeopsis fritschii]
Length=331

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 78/158 (49%), Gaps = 16/158 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VT  YNY  K+G+++++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGRDYAPA-----EDPGVVSVTTVYNYYKKFGYQTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +V          R+L PQ AA  N  K   ++ D
Sbjct  232  NIGEITELAGCDLLTISPALLGELQATVG------ELPRKLDPQKAAGMNIEK---ISMD  282

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            + +F    A    A E L  G++G++   + +E+L  +
Sbjct  283  KATFDKMHASDRMASEKLDEGIKGFTKALETLEQLLAE  320



>ref|WP_002791990.1| transaldolase [Microcystis aeruginosa]
 emb|CCI21258.1| Transaldolase [Microcystis aeruginosa PCC 9808]
Length=391

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 76/147 (52%), Gaps = 16/147 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKDYV-GA----EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+ +      +    R+L P  AA  +  K   +  D
Sbjct  232  NIGEICELAGCDLLTISPKLLEQLQGT------EADLPRKLDPAQAATLDIVK---IAMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSN  171
            Q +F    A    A E L  G++G++ 
Sbjct  283  QATFEKMHAEDAMASEKLAEGIQGFTK  309



>gb|ERG86948.1| transaldolase [Ascaris suum]
Length=377

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 82/156 (53%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW  N++     + +  R  DPG   VTK YNY  K+G+K+++MAA+ R
Sbjct  231  TLISPFVGRILDWHVNNTD----KKSFDRHTDPGVLSVTKIYNYYKKFGYKTQVMAASFR  286

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N +++  + G D +     +L+ L E      +K +    LSPQ+AA     +   VT  
Sbjct  287  NTEEIKGLNGCDLLTISPSLLKQLSE------DKETIPVVLSPQTAATCELAR---VTVP  337

Query  245  QYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELF  144
            + +F   M     A + L+ G+  ++  A+ +E++ 
Sbjct  338  EATFRFEMNEDTMANDKLSEGIRKFAADARALEKMI  373



>ref|WP_014707663.1| transaldolase [Methylophaga nitratireducenticrescens]
 gb|AFI85299.1| Transaldolase [Methylophaga nitratireducenticrescens]
Length=327

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 83/157 (53%), Gaps = 15/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      +    EDPG   VT+ Y+Y  K+G+ +++M A+ R
Sbjct  176  TLISPFVGRILDWYKKDTG----RDSYPSNEDPGVLSVTEIYSYYKKFGYNTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + GVD +     +L  L+ +      + + ER+LSP+ AA  +  +   +  D
Sbjct  232  NVGEITELAGVDLLTISPALLDELQNT------EGTLERKLSPEVAAQSDVAE---LNLD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELFG  141
            + +F +  A    A E L+ G++G++   + +EEL  
Sbjct  283  KATFDAMHAENRMAAEKLSEGIDGFAKALESLEELLA  319



>ref|WP_015107738.1| transaldolase [Cyanobium gracile]
 gb|AFY27279.1| transaldolase [Cyanobium gracile PCC 6307]
Length=389

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 82/159 (52%), Gaps = 19/159 (12%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G     GA    EDPG   VT+ +NY   +G+ +++M A+ R
Sbjct  176  TLISPFVGRILDWYKKSTGRDSYPGA----EDPGVLSVTRIFNYFKTHGYGTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     ++  L++S      +   ERRL     AA+  T EE +  D
Sbjct  232  NIDEIVELAGCDLLTISPALMDQLRQS------EALLERRLD----AAHPGTSEERIHID  281

Query  245  QYSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELFGKI  135
            + +F + M   A+  E L  G+ G+S   K +E L G++
Sbjct  282  EATFRTMMAADAMASEKLDEGIRGFS---KAIETLEGQL  317



>ref|WP_003268474.1| transaldolase [Ralstonia solanacearum]
 emb|CCF96354.1| transaldolase [Ralstonia solanacearum K60-1]
Length=319

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 79/158 (50%), Gaps = 17/158 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G +    A     DPG   V + YNY  ++G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKDAGAAWDPVAQGGANDPGVQSVLRIYNYYKRFGYTTEVMGASFRN  226

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++L  L++S TP       ER+LSP+ A A N  +   +  D+
Sbjct  227  TSQIVELAGCDLLTISPELLAQLQQSDTP------VERKLSPEHAQATNLVR---LPADE  277

Query  242  YSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
             +F     A AMG    E L  G+  ++  A ++E L 
Sbjct  278  AAFRWHLNADAMG---TEKLAEGIRLFAADAVKLERLI  312



>ref|WP_020733902.1| transaldolase [Sorangium cellulosum]
 ref|YP_008148369.1| transaldolase [Sorangium cellulosum So0157-2]
 gb|AGP34743.1| transaldolase [Sorangium cellulosum So0157-2]
Length=329

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 80/156 (51%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW    +G +    A    EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYLKDTGRASYAPA----EDPGVVSVTKIYNYYKKHGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L  +      +    R+L P +A A +  K   +T D
Sbjct  233  NIDEIKELAGSDLLTISPKLLAELAAA------RGELPRKLDPDAARAMHIEK---ITMD  283

Query  245  QYSFASAMGP--AAVELLTAGMEGYSNQAKRVEELF  144
            + +F +  G    A + L+ G++G++    ++E L 
Sbjct  284  EATFRAMHGADRMASDKLSEGIDGFAKALAQLEVLL  319



>ref|WP_035347089.1| transaldolase [Edaphobacter aggregans]
Length=331

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 83/158 (53%), Gaps = 16/158 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    +DPG   VT  YNY  K+G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKDTGKDYV-GA----DDPGVKSVTTIYNYYKKFGYKTQVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTK--EEVVT  252
            N  ++  + G D +    K+L  L+       +  + ER+L P+ A + +  K   +  T
Sbjct  231  NIGEIEELAGSDLLTIAPKLLGELQA------KSGTLERKLDPEKAKSMSIEKIPMDKAT  284

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +D+   A  M   A + L  G+EG+S   + +E++  K
Sbjct  285  FDKMHAADRM---AHDKLKEGIEGFSKALEDLEKILAK  319



>ref|WP_017841577.1| transaldolase [Methylomicrobium buryatense]
Length=328

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 78/158 (49%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G    E A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYEPA----EDPGVISVTDVYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +      +    R+L P  AA     K   +T D
Sbjct  233  NIGEITELAGCDLLTISPSLLGELQST------EGDLPRKLDPAKAAGQAIEK---ITVD  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            + +F    A    A E L+ G++G++   + +E L  +
Sbjct  284  KATFDRMHADNRMATEKLSEGIDGFTKALETLETLLAE  321



>ref|WP_032519397.1| transaldolase [Prochlorococcus marinus]
Length=333

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 84/172 (49%), Gaps = 16/172 (9%)
 Frame = -3

Query  647  LQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIH  468
              FCQA   A A  ++I  FVGR+ DW +  +G +   G+    EDPG   VT+ YNY  
Sbjct  162  FNFCQAVTCANAKITLISPFVGRILDWHKAKTGKTSFVGS----EDPGVISVTQIYNYFK  217

Query  467  KYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRL--SPQ  294
            + G K+++M A+ RN  ++  + G D +    K L+ LK+      EK    R+L  S Q
Sbjct  218  EKGFKTEVMGASFRNLDEIKELAGCDLLTIAPKFLEELKK------EKGELVRKLDESTQ  271

Query  293  SAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
               + ++  EE      +  +      A E L+ G+ G+S   + +EEL  K
Sbjct  272  INNSIDYEFEE----KDFRLSMLEDQMASEKLSEGITGFSKAIEELEELLIK  319



>gb|KGG08009.1| Transaldolase [Prochlorococcus marinus str. SB]
Length=341

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 84/172 (49%), Gaps = 16/172 (9%)
 Frame = -3

Query  647  LQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIH  468
              FCQA   A A  ++I  FVGR+ DW +  +G +   G+    EDPG   VT+ YNY  
Sbjct  170  FNFCQAVTCANAKITLISPFVGRILDWHKAKTGKTSFVGS----EDPGVISVTQIYNYFK  225

Query  467  KYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRL--SPQ  294
            + G K+++M A+ RN  ++  + G D +    K L+ LK+      EK    R+L  S Q
Sbjct  226  EKGFKTEVMGASFRNLDEIKELAGCDLLTIAPKFLEELKK------EKGELVRKLDESTQ  279

Query  293  SAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
               + ++  EE      +  +      A E L+ G+ G+S   + +EEL  K
Sbjct  280  INNSIDYEFEE----KDFRLSMLEDQMASEKLSEGITGFSKAIEELEELLIK  327



>emb|CCQ69168.1| Transaldolase [Crocosphaera watsonii WH 0402]
Length=380

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 76/156 (49%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VT  YNY  K+GHK+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKETGKEYAPT-----EDPGVMSVTSIYNYYKKFGHKTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L  +      + +  R+L P++AA  +  K   +  D
Sbjct  231  NIGEICELAGCDLLTISPKLLDQLNST------EETLPRKLDPEAAAKMDIAK---IAMD  281

Query  245  QYSFASAM--GPAAVELLTAGMEGYSNQAKRVEELF  144
            +  F         A E L  G++G++   + +EE+ 
Sbjct  282  KAIFDKMHQEDKMAYEKLDEGIKGFTKALETLEEML  317



>gb|AIN39832.1| hypothetical protein [Zoysia matrella]
Length=280

 Score = 71.2 bits (173),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTK  486
            SV+QIFVGR+RDWARNHSGD E++ AL++GEDPG ALV K
Sbjct  234  SVVQIFVGRIRDWARNHSGDPEIDEALKKGEDPGLALVKK  273


 Score = 26.6 bits (57),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 1/17 (6%)
 Frame = -2

Query  696  ASRLLEAEGIQTH*LSF  646
            ASRLLE+EGI+TH L+F
Sbjct  203  ASRLLESEGIRTH-LTF  218



>ref|WP_015118125.1| transaldolase [Rivularia sp. PCC 7116]
 gb|AFY54550.1| transaldolase [Rivularia sp. PCC 7116]
Length=333

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGKDSYPAP----EDPGVLSVTKIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K L  L+ + +         R+L  + A+A N  K   ++ D
Sbjct  233  NLGEITELAGCDLLTIAPKFLAELQSNSS------ELPRKLDAKKASAMNIEK---ISMD  283

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            + +F    A    A + L  G++G+S   + +E+L  +
Sbjct  284  KATFEKMHAEDKMASDKLDEGIKGFSKALENLEQLLAE  321



>ref|XP_008868532.1| transaldolase [Aphanomyces invadans]
 gb|ETW03148.1| transaldolase [Aphanomyces invadans]
Length=320

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G +         EDPG   VT+ YN+  K+G+K+ +M A+ R
Sbjct  173  TLISPFVGRIMDWYKAKTGKT-----YTAVEDPGVQSVTRIYNHYKKHGYKTIVMGASFR  227

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVV-TW  249
            N  +V  + G D +     +L+ L  +  P        +RL  +S AA+N+   +V  T 
Sbjct  228  NTGEVLELAGCDRLTISPNLLEELANATGP------VVKRLDVES-AAHNYNHPKVTFTE  280

Query  248  DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
             +Y FA      A E L+ G+ G+     ++EE+ 
Sbjct  281  KEYRFAMNEDAMATEKLSEGIRGFVADIIKLEEIL  315



>ref|WP_020159800.1| MULTISPECIES: transaldolase [Methylobacter]
Length=328

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 78/156 (50%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYAPA----EDPGVLSVTDVYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +      +    R+L PQ AA     K   +T D
Sbjct  233  NIGEITELAGCDLLTIAPALLGELQAT------EGELVRKLDPQKAANAPIEK---ITMD  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            + +F    A    A E L+ G+EG++   + +E+L 
Sbjct  284  KATFDRMHAENRMASEKLSEGIEGFTKALETLEKLL  319



>ref|WP_025926158.1| transaldolase [Prochlorococcus sp. scB241_528J8]
Length=333

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 84/173 (49%), Gaps = 18/173 (10%)
 Frame = -3

Query  647  LQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIH  468
              FCQA   A+A  ++I  FVGR+ DW +  +G +   GA    EDPG   VT+ YNY  
Sbjct  162  FNFCQAVTCAKAKITLISPFVGRILDWHKAKTGKTSFIGA----EDPGVISVTQIYNYFK  217

Query  467  KYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSA  288
            + G K+++M A+ RN  ++  + G D +    K L+ LK+      EK    R+L     
Sbjct  218  EKGFKTEVMGASFRNLDEIKELAGCDLLTIAPKFLEELKK------EKGDLIRKLD----  267

Query  287  AAYNFTKEEV-VTWDQYSFASAM--GPAAVELLTAGMEGYSNQAKRVEELFGK  138
             A N     V   +D+  F   M     A E L+ G+ G+S   + +E+L  K
Sbjct  268  -ATNLRNNSVDYKFDEKDFRLNMLDDQMASEKLSEGITGFSKAIEELEQLLLK  319



>gb|EIE86885.1| transaldolase [Rhizopus delemar RA 99-880]
Length=322

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 80/160 (50%), Gaps = 22/160 (14%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G++   GA    EDPG   V+K Y Y  K+G+ + +M A+ R
Sbjct  173  TLISPFVGRILDWFKKSTGENYT-GA----EDPGVKSVSKIYEYYKKFGYNTIVMGASFR  227

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYN------FTKE  264
            N  ++  + G D++     +L  L+++  P       ER+LSP+ A A +      FT E
Sbjct  228  NTGEIEELAGCDFLTISPALLSELQKTEKP------LERKLSPEKANASSLEKVTFFTDE  281

Query  263  EVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +   W+    A      A E L+ G+  ++    ++E + 
Sbjct  282  KAFRWEMNQDA-----MATEKLSEGIRNFAKDGAKLESML  316



>ref|WP_016725840.1| transaldolase [Ralstonia solanacearum]
 gb|ESS47578.1| transaldolase B [Ralstonia solanacearum SD54]
Length=319

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 81/161 (50%), Gaps = 17/161 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G +    A     DPG   V + YNY  ++G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKDAGAAWDPIAQGGANDPGVQSVVRIYNYYKRFGYTTEVMGASFRN  226

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++L  L++S  P       ER+LSP+ A A N  +   +  D+
Sbjct  227  TSQIIELAGCDLLTISPELLAQLQQSDAP------VERKLSPEHAHATNLVR---LPADE  277

Query  242  YSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI  135
             +F     A+AM   A E L  G+  ++  A ++E L G +
Sbjct  278  AAFRWHMNANAM---ATEKLAEGIRLFAADAVKLEGLIGPL  315



>ref|WP_021832055.1| Transaldolase [Crocosphaera watsonii]
 emb|CCQ62430.1| Transaldolase [Crocosphaera watsonii WH 0401]
 emb|CCQ53528.1| Transaldolase [Crocosphaera watsonii WH 8502]
Length=390

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 76/156 (49%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VT  YNY  K+GHK+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKETGKE-----YAPTEDPGVMSVTSIYNYYKKFGHKTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L  +      + +  R+L P++AA  +  K   +  D
Sbjct  231  NIGEICELAGCDLLTISPKLLDQLNST------EETLPRKLDPEAAAKMDIAK---IAMD  281

Query  245  QYSFASAM--GPAAVELLTAGMEGYSNQAKRVEELF  144
            +  F         A E L  G++G++   + +EE+ 
Sbjct  282  KAIFDKMHQEDKMAYEKLDEGIKGFTKALETLEEML  317



>ref|WP_026387747.1| transaldolase [Acidobacteria bacterium KBS 146]
Length=331

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 79/158 (50%), Gaps = 16/158 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    EDPG   VTK YNY   +G+K+ +M A+ R
Sbjct  176  TLISPFVGRILDWYKKDTGKDYV-GA----EDPGVQSVTKIYNYYKHFGYKTVVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTK--EEVVT  252
            N  ++  + G D +    K+L  L+       E+ + ER+L P+ A      K   +  T
Sbjct  231  NIGEIKELAGCDLLTISPKLLGELEA------EQGTLERKLDPEKAKQQKIEKIPMDKAT  284

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +D+   A  M   A + L  G+EG+S   + +E    K
Sbjct  285  FDKMHAADRM---ASDKLKEGIEGFSKALEELEITLAK  319



>ref|WP_007305534.1| transaldolase [Crocosphaera watsonii]
 gb|EAM50787.1| Transaldolase AB [Crocosphaera watsonii WH 8501]
Length=390

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 76/156 (49%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VT  YNY  K+GHK+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKETGKE-----YAPTEDPGVMSVTTIYNYYKKFGHKTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L  +      + +  R+L P++AA  +  K   +  D
Sbjct  231  NIGEICELAGCDLLTISPKLLDQLNST------EETLPRKLDPEAAAKMDIAK---IAMD  281

Query  245  QYSFASAM--GPAAVELLTAGMEGYSNQAKRVEELF  144
            +  F         A E L  G++G++   + +EE+ 
Sbjct  282  KAIFDKMHQEDKMAYEKLDEGIKGFTKALETLEEML  317



>ref|WP_007310814.1| transaldolase [Crocosphaera watsonii]
 gb|EHJ12700.1| Transaldolase [Crocosphaera watsonii WH 0003]
 emb|CCQ55058.1| Transaldolase [Crocosphaera watsonii WH 0005]
Length=390

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 76/156 (49%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VT  YNY  K+GHK+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKETGKE-----YAPTEDPGVMSVTSIYNYYKKFGHKTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L  +      + +  R+L P++AA  +  K   +  D
Sbjct  231  NIGEICELAGCDLLTISPKLLDQLNST------EETLPRKLDPEAAAKMDIAK---IAMD  281

Query  245  QYSFASAM--GPAAVELLTAGMEGYSNQAKRVEELF  144
            +  F         A E L  G++G++   + +EE+ 
Sbjct  282  KAIFDKMHQEDKMAYEKLDEGIKGFTKALETLEEML  317



>ref|WP_005879412.1| transaldolase [Oxalobacter formigenes]
 gb|EEO29110.1| transaldolase [Oxalobacter formigenes OXCC13]
Length=311

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 81/155 (52%), Gaps = 16/155 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G ++  GA    +DPG   V + Y+Y  K+G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKQTG-TDYAGA----DDPGVQSVKRIYDYYRKFGYPTEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++LQ L ES  P        R+LSP+ A A      E V++D+
Sbjct  222  TSQIIELAGCDLLTISPELLQKLSESDAP------VTRKLSPELAKADPI---ERVSYDE  272

Query  242  YSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELF  144
             SF  A+   A+  E L+ G+  +     ++E++ 
Sbjct  273  KSFRLALNDEAMATEKLSEGIRLFCADTVKLEKMI  307



>ref|WP_006276405.1| transaldolase [Cylindrospermopsis raciborskii]
 gb|EFA70595.1| Transaldolase AB [Cylindrospermopsis raciborskii CS-505]
Length=334

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 78/156 (50%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G S    A    EDPG   VTK YNY  K+G+++++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRSSYPPA----EDPGVLSVTKIYNYYKKFGYQTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +V          R+L P + +  +  K   ++ D
Sbjct  233  NMGEITELAGCDLLTISPALLSELQNTVA------ELPRKLDPVTTSGLSIDK---ISVD  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            Q +F    A    A + L  G++G++     +EEL 
Sbjct  284  QATFERMHAADRMASDKLREGIDGFTKALISLEELL  319



>ref|WP_010316653.1| transaldolase [Synechococcus sp. CB0205]
Length=389

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 76/153 (50%), Gaps = 16/153 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G     G     EDPG   VTK +NY   +G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWFKKSTGRDSYPGH----EDPGVLSVTKIFNYFKTFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L  L+ +      +   +R+L+P   A    T E+ +  D
Sbjct  232  NIDEIVELAGCDLLTISPKLLDQLRNT------QGDLQRKLNPFDPA----TTEQQIHLD  281

Query  245  QYSFASAMGP--AAVELLTAGMEGYSNQAKRVE  153
               F + M     A E L  G++G++   + +E
Sbjct  282  AQGFKAMMAEDQMATEKLDEGIQGFTKAIETLE  314



>emb|CDH48653.1| transaldolase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=321

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 73/154 (47%), Gaps = 9/154 (6%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G S  E A    EDPG   VTK YNY  +YG+ + +M A+ R
Sbjct  173  TLISPFVGRIMDWYKKSTGKSSYEPA----EDPGVLSVTKIYNYYKQYGYNTIVMGASFR  228

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D++     +L  L +      +K S E+  +   +    F  E+   W+
Sbjct  229  NTGEIEELAGCDFLTISPALLGELNQDTKKISQKLSPEKAKTQTISKVSFFNNEKAFRWE  288

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
                A      A E L+ G+  ++    ++E + 
Sbjct  289  MNEDA-----MATEKLSEGIRNFAKDGIKLETML  317



>ref|WP_011870598.1| transaldolase [Herminiimonas arsenicoxydans]
 emb|CAL61261.1| transaldolase [Herminiimonas arsenicoxydans]
Length=311

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 80/155 (52%), Gaps = 16/155 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G ++  GA    +DPG   V + Y Y  K+G+++++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKSTG-TDYTGA----DDPGVQSVKRIYTYYRKFGYQTEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++LQ L ES        +  R+LSP++A   +  K   +T D+
Sbjct  222  TSQIIELAGCDLLTISPELLQKLAES------DATLTRKLSPEAAKNSDLEK---LTLDE  272

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEELF  144
             +F S +     A E L  G+  +   A ++++L 
Sbjct  273  KTFRSMLNDDAMATEKLAEGIRAFCVDAVKLDKLI  307



>ref|WP_013233125.1| transaldolase [Herbaspirillum seropedicae]
 gb|ADJ62613.1| transaldolase protein [Herbaspirillum seropedicae SmR1]
Length=311

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 79/154 (51%), Gaps = 16/154 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G  E  G+    +DPG   V   YNY  K+G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKSTG-QEYTGS----DDPGVQSVKAVYNYYRKFGYATEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +     +LQ L +S  P       ER+LS Q+A A +    E ++ D+
Sbjct  222  TSQIVELAGCDLLTISPDLLQKLADSDAP------VERKLSKQAADAADI---ERISLDE  272

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL  147
             +F  A+     A E L  G+  ++  A ++E++
Sbjct  273  KAFRLALNADAMATEKLAEGIRQFAADAVKLEQI  306



>ref|WP_035149652.1| transaldolase [Calothrix sp. 336/3]
 gb|KFB81897.1| transaldolase [Calothrix sp. 336/3]
Length=333

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 78/157 (50%), Gaps = 15/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGRDSYPSA----EDPGVLSVTQIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ ++          R+L P  AAA +  K  +   T
Sbjct  233  NVGEITELAGSDLLTISPALLAELQATIG------ELPRKLDPSKAAAMSMEKLHIDKAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFG  141
            +D+      M   A E L  G++G++   + +E+L  
Sbjct  287  FDKMHAEDRM---ASEKLDEGIKGFTKALETLEQLLA  320



>ref|WP_026100018.1| transaldolase [Microchaete sp. PCC 7126]
Length=334

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 76/158 (48%), Gaps = 16/158 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKETGKD-----YPATEDPGVLSVTKIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ +V          R+L P  AA     K  V    
Sbjct  232  NIGEIIELAGSDLLTISPALLAELQATVG------ELPRKLDPAKAATLEIEKINVDKAV  285

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +DQ   A  M   A + L+ G+EG++     +E+L  +
Sbjct  286  YDQLHAADRM---ASDKLSEGIEGFTKALVALEKLLAE  320



>ref|WP_028852939.1| transaldolase [Ralstonia solanacearum]
Length=319

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 80/161 (50%), Gaps = 17/161 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G +    A     DPG   V + YNY  ++G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKDAGAAWDPIAQGGANDPGVQSVVRIYNYYKRFGYTTEVMGASFRN  226

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++L  L++S  P       ER+LSP+ A A N  +   +  D+
Sbjct  227  TSQIIELAGCDLLTISPELLAQLQQSDAP------VERKLSPEHAHATNLVR---LPADE  277

Query  242  YSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI  135
             +F     A AM   A E L  G+  ++  A ++E L G +
Sbjct  278  AAFRWHMNADAM---ATEKLAEGIRLFAADAVKLEGLIGPL  315



>ref|WP_011001180.1| transaldolase [Ralstonia solanacearum]
 sp|Q8Y014.1|TAL_RALSO RecName: Full=Transaldolase [Ralstonia solanacearum GMI1000]
 emb|CAD14933.1| probable transaldolase protein [Ralstonia solanacearum GMI1000]
 gb|AGH83773.1| Transaldolase [Ralstonia solanacearum FQY_4]
Length=319

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 80/161 (50%), Gaps = 17/161 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G +    A     DPG   V + YNY  ++G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKDAGAAWDPIAQGGANDPGVQSVVRIYNYYKRFGYTTEVMGASFRN  226

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++L  L++S  P       ER+LSP+ A A N  +   +  D+
Sbjct  227  TSQIIELAGCDLLTISPELLAQLQQSDAP------VERKLSPEHAHATNLVR---LPADE  277

Query  242  YSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI  135
             +F     A AM   A E L  G+  ++  A ++E L G +
Sbjct  278  AAFRWHMNADAM---ATEKLAEGIRLFAADAVKLEGLIGPL  315



>ref|WP_020749039.1| transaldolase [Ralstonia solanacearum]
 emb|CBJ38479.1| transaldolase [Ralstonia solanacearum CMR15]
Length=319

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 80/161 (50%), Gaps = 17/161 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G +    A     DPG   V + YNY  ++G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKDAGAAWDPIAQGGANDPGVQSVVRIYNYYKRFGYTTEVMGASFRN  226

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++L  L++S  P       ER+LSP+ A A N  +   +  D+
Sbjct  227  TSQIIELAGCDLLTISPELLAQLQQSDAP------VERKLSPEHAHATNLVR---LPADE  277

Query  242  YSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI  135
             +F     A AM   A E L  G+  ++  A ++E L G +
Sbjct  278  AAFRWHMNADAM---ATEKLAEGIRLFAADAVKLEGLIGPL  315



>gb|KHJ97379.1| transaldolase [Oesophagostomum dentatum]
Length=321

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 84/159 (53%), Gaps = 15/159 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW   ++     + +  R +DPG   VT+ +NY  KYG+K+++M A+ R
Sbjct  175  TLISPFVGRILDWNVKNTD----KKSFDRHDDPGVKSVTRIFNYYKKYGYKTQVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N +++  ++G D +    K+L+ L +      +K      L    AAA +  +   +T D
Sbjct  231  NTEEIKGLMGCDLLTISPKLLKELSQ------DKEVVPVALKSSDAAAKDIPR---ITVD  281

Query  245  QYSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELFGKI  135
            + +F  A+   A+  E L  G+  ++  A+ +E++  K+
Sbjct  282  EKTFRWALNEDAMGSEKLAEGIRNFAKDARTLEDIVKKM  320



>gb|EPB86724.1| transaldolase [Mucor circinelloides f. circinelloides 1006PhL]
Length=322

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 81/158 (51%), Gaps = 18/158 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G            DPG   V+K YNY  K+G+ + +M A+ R
Sbjct  173  TLISPFVGRILDWYKKSTGQD-----YSATSDPGVQSVSKIYNYYKKFGYNTIVMGASFR  227

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW-  249
            N  ++  + G D++     +L SL+E     D K + ER+LSP++A + N  K   VT+ 
Sbjct  228  NTGEIEELAGCDFLTISPALLGSLQE-----DNK-TLERKLSPEAAQSQNLEK---VTFF  278

Query  248  -DQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELF  144
             D+ +F   M     A E L+ G+  ++    ++E + 
Sbjct  279  KDEKAFRWEMNQDAMATEKLSEGIRNFAKDGLKLENML  316



>ref|WP_015897701.1| transaldolase [Acidobacterium capsulatum]
 sp|C1F2H6.1|TAL_ACIC5 RecName: Full=Transaldolase [Acidobacterium capsulatum ATCC 51196]
 gb|ACO31507.1| transaldolase [Acidobacterium capsulatum ATCC 51196]
Length=333

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 81/160 (51%), Gaps = 20/160 (13%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G   V GA    +DPG   VT+ YNY  K+G+K+ +M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGKDYV-GA----DDPGVQSVTRIYNYFKKFGYKTVVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSL--KESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVT  252
            N  ++  + G D +    K+L+ L  KE+  P        R+L  + A        E +T
Sbjct  232  NTGEIIELAGCDLLTISPKLLEELDAKEAELP--------RKLDAEKAKGMEI---ERIT  280

Query  251  WDQYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
             D+ +F    A    A + L  G+EG+S   + +E+L  K
Sbjct  281  VDKATFDKMHAEDRMAHDKLKEGIEGFSEALENLEKLLAK  320



>emb|CEG74923.1| Putative Transaldolase [Rhizopus microsporus]
 emb|CEG74924.1| Putative Transaldolase [Rhizopus microsporus]
Length=322

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 80/157 (51%), Gaps = 22/157 (14%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G++         EDPG   VTK YNY  K+G+K+ +M A+ R
Sbjct  173  TLISPFVGRILDWYKKSTGEN-----YTGSEDPGVQSVTKIYNYYKKFGYKTIVMGASFR  227

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYN------FTKE  264
            N  ++  + G D++     +L  LK++    D+K   ER+LSP++A A +      F  E
Sbjct  228  NTGEIEELAGCDFLTISPALLAELKKA----DKK--IERKLSPENAQAASLEKVTFFNNE  281

Query  263  EVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVE  153
            +   W+    A      A E L  G+  ++    ++E
Sbjct  282  KAFRWEMNQDA-----MASEKLGEGIRNFAKDGIKLE  313



>ref|WP_021154864.1| transaldolase B [Ralstonia solanacearum]
Length=360

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 81/161 (50%), Gaps = 17/161 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G +    A     DPG   V + YNY  ++G+ +++M A+ RN
Sbjct  208  LISPFVGRIYDWYKKDAGAAWDPIAQGGANDPGVQSVVRIYNYYKRFGYTTEVMGASFRN  267

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++L  L++S  P       ER+LSP+ A A N  +   +  D+
Sbjct  268  TSQIIELAGCDLLTISPELLAQLQQSDAP------VERKLSPEHAHATNLVR---LPADE  318

Query  242  YSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI  135
             +F     A+AM   A E L  G+  ++  A ++E L G +
Sbjct  319  AAFRWHMNANAM---ATEKLAEGIRLFAADAVKLEGLIGPL  356



>gb|EAQ74921.1| transaldolase [Synechococcus sp. WH 5701]
Length=396

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 77/153 (50%), Gaps = 16/153 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G     G     EDPG   VTK +NY   YG+++++M A+ R
Sbjct  180  TLISPFVGRILDWYKQDTGREYYPGP----EDPGVISVTKIFNYYKTYGYRTEVMGASFR  235

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N +++  + G D +    K+L  L+++  P        R+L P +      + E   + D
Sbjct  236  NIEEIIELAGCDLLTISPKLLDQLRQTEAP------LPRKLDPLNPG----STEAQFSLD  285

Query  245  QYSFASAMGP--AAVELLTAGMEGYSNQAKRVE  153
            + S+ +AM     A E L  G+ G+S   + +E
Sbjct  286  RSSYVTAMAADRMASEKLDEGIRGFSKAIETLE  318



>gb|KIJ58399.1| hypothetical protein HYDPIDRAFT_102724, partial [Hydnomerulius 
pinastri MD-312]
Length=240

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 78/154 (51%), Gaps = 9/154 (6%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G  E EG     EDPG   V K +NY  ++G+K+ +M A+ R
Sbjct  89   TLISPFVGRILDWYKKATG-REYEG----DEDPGVKSVKKIFNYYKQHGYKTIVMGASFR  143

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++ S+ GVD++    K+L+ LK+S  P  +K         +     +F   E     
Sbjct  144  NVGEIKSLAGVDFLTISPKLLEELKDSTEPVPKKLDSHTAAQSEPIPKVSFVNNE----P  199

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            ++ +A    P A + L  G++ ++   + ++ + 
Sbjct  200  EFRWALLQDPMAFDKLHEGIKKFAEDGEALKNVL  233



>ref|WP_037979690.1| transaldolase [Synechococcus sp. WH 5701]
Length=392

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 77/153 (50%), Gaps = 16/153 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G     G     EDPG   VTK +NY   YG+++++M A+ R
Sbjct  176  TLISPFVGRILDWYKQDTGREYYPGP----EDPGVISVTKIFNYYKTYGYRTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N +++  + G D +    K+L  L+++  P        R+L P +      + E   + D
Sbjct  232  NIEEIIELAGCDLLTISPKLLDQLRQTEAP------LPRKLDPLNPG----STEAQFSLD  281

Query  245  QYSFASAMGP--AAVELLTAGMEGYSNQAKRVE  153
            + S+ +AM     A E L  G+ G+S   + +E
Sbjct  282  RSSYVTAMAADRMASEKLDEGIRGFSKAIETLE  314



>ref|WP_016950095.1| transaldolase [Anabaena sp. PCC 7108]
Length=333

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 77/158 (49%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPAA----EDPGVLSVTTIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ +V          R+L P   A  +  K  V   T
Sbjct  233  NIGEITELAGCDLLTISPGLLTELQNTVA------ELPRKLDPAKVANLSIAKISVDKAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +DQ   A  M   A + L+ G++G++     +E+L  +
Sbjct  287  FDQMHNADRM---ASDKLSEGIDGFTKALISLEKLLSE  321



>emb|CAP22947.2| Protein CBG01674 [Caenorhabditis briggsae]
Length=338

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 83/163 (51%), Gaps = 13/163 (8%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW   ++     + A  R +DPG   VT+ +NY  KY +K+++MAA+ R
Sbjct  176  TLISPFVGRIMDWFVKNTD----QKAYTRKDDPGVVSVTRIFNYYKKYDYKTQVMAASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAA---YNFTKEEV-  258
            N +++  ++G D +     +L+ L           S     + + AA    YNF+ +E+ 
Sbjct  232  NTEEIKGLVGCDLLTISPALLKQLATETEAAPVVLSTSHVATHREAATRPRYNFSAKELD  291

Query  257  ---VTWDQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELF  144
               VT D+ +F  A+     A E L  G+  ++  A+ +E+L 
Sbjct  292  LPKVTIDEKTFRWALNEDAMATEKLAEGIRNFAKDARTLEKLI  334



>ref|WP_035357245.1| transaldolase [Edaphobacter aggregans]
Length=323

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 83/158 (53%), Gaps = 21/158 (13%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +   G +E+       +DPG A VT+ YNY  K+G+K+++M A+ R
Sbjct  172  TLISPFVGRIYDWYKKEHGGAEIPA----DQDPGVASVTRIYNYYKKFGYKTQIMGASFR  227

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N   +  + G D +    ++L+ L+++      +   ER+L    A A   +KEE +  D
Sbjct  228  NVNQIVRLAGSDLLTISPELLEQLEQT------EGVVERKLDSAKAQA---SKEERLHLD  278

Query  245  QYSF-----ASAMGPAAVELLTAGMEGYSNQAKRVEEL  147
            + +F       AM   A E L  G+  +++ A+ +E+ 
Sbjct  279  EKTFRWMHNEDAM---ATEKLAEGIRKFNSDARHLEDF  313



>dbj|BAO93703.1| transaldolase [Moniliella megachiliensis]
Length=322

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 81/157 (52%), Gaps = 13/157 (8%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G  E  G+    EDPG   V K Y Y  ++G+K+ +M A+ R
Sbjct  174  TLISPFVGRILDWYKAATG-KEYSGS----EDPGVQSVKKIYTYYKQHGYKTVVMGASFR  228

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + GVD++    K+L+ LK S        + ER+LSP+ A +     +     D
Sbjct  229  NVGEITELAGVDFLTIAPKLLEELKSS------NATIERKLSPEQAKSAEAIPKVSYIDD  282

Query  245  QYSFASAM--GPAAVELLTAGMEGYSNQAKRVEELFG  141
            + +F  A+     A + L  G+ G++  AK ++ L  
Sbjct  283  RAAFELALFEDQMAFDKLYGGIRGFAKDAKTLQGLIA  319



>ref|WP_015124775.1| transaldolase [Synechococcus sp. PCC 6312]
 gb|AFY61232.1| transaldolase [Synechococcus sp. PCC 6312]
Length=391

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 77/158 (49%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G +  E      EDPG   VT  YNY  K+G+ +++M A+ R
Sbjct  175  TLISPFVGRILDWHKKSTGRASYE----PHEDPGVVSVTTIYNYYKKFGYHTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  LK +      +    R+L P  A        E ++ D
Sbjct  231  NIGEITELAGCDLLTISPALLAQLKST------EAELPRKLDPSKAPGLEI---ERISLD  281

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            + +F    A  P A E L  G++G++   + +E+L  +
Sbjct  282  RATFDQMHAADPMASEKLDEGIKGFTKALETLEDLLAR  319



>ref|WP_015212754.1| transaldolase [Anabaena cylindrica]
 gb|AFZ56099.1| transaldolase [Anabaena cylindrica PCC 7122]
Length=333

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 78/158 (49%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDNYPAA----EDPGVLSVTKIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ +V          R+L P   +  +  K  V   T
Sbjct  233  NIGEITELAGCDLLTISPGLLTELQNTVA------ELPRKLDPAKVSDLSLEKISVDKAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +D+   A  M   A + L+ G++G++     +E+L  +
Sbjct  287  FDKMHAADRM---ASDKLSEGIDGFTKALIALEQLLAE  321



>ref|WP_009554366.1| transaldolase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ70077.1| transaldolase [Oscillatoriales cyanobacterium JSC-12]
Length=391

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 80/156 (51%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW    +G  + EGA    +DPG   VT+ YNY  K+G+ +++M A+ R
Sbjct  177  TLISPFVGRILDWYVKETG-KQYEGA----DDPGVQSVTRIYNYYKKFGYTTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +    K+L  L  +      +    R+L P+ A A    K  +   T
Sbjct  232  NIGEIIELAGCDLLTISPKLLAELDAT------EGELIRKLDPEKATALEMEKISIDKAT  285

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            ++Q   A  M   A E L+ G++G++   + +E+L 
Sbjct  286  FEQMHTADKM---ASEKLSEGIQGFTKALETLEQLL  318



>ref|WP_006530077.1| transaldolase [Gloeocapsa sp. PCC 73106]
 gb|ELR97059.1| transaldolase [Gloeocapsa sp. PCC 73106]
Length=389

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 78/157 (50%), Gaps = 16/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  +VGR+ DW   ++G  E EGA    EDPG   VT  YNY  K G+++++M A+ R
Sbjct  177  TIISPYVGRILDWYVKNTG-KEYEGA----EDPGVISVTNIYNYYKKLGYETEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
                +  + G D++      L  L+E+           R+L P  AA  +  K   +T D
Sbjct  232  KLSQITELAGCDFLTIGPVQLALLQETTG------ELTRKLDPAKAATMDIEK---ITMD  282

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELFG  141
            + +F    A    A E L+ G++G+S   + +E+  G
Sbjct  283  EATFVKMHAENVMATEKLSEGIQGFSKALESLEKFMG  319



>ref|WP_034756130.1| transaldolase [Janthinobacterium lividum]
 gb|EZP36955.1| Transaldolase [Janthinobacterium lividum]
Length=316

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 84/171 (49%), Gaps = 13/171 (8%)
 Frame = -3

Query  641  FCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKY  462
            FCQA A A A   +I  FVGR+ DW +   G +  E A     DPG   VT+ +NY  ++
Sbjct  154  FCQAVACADAKVRLISPFVGRIYDWHKKSMGAAWDEVARSLSNDPGVQSVTRIFNYYKQH  213

Query  461  GHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAA  282
            G  +++M A+ RN   + ++ G D +     +L  L+ S  P      FER L     AA
Sbjct  214  GIATQVMGASFRNVGQITALSGCDLLTISPDLLAKLEASDVP------FERALGADLGAA  267

Query  281  YNFTKEEVVTWDQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELFGKI  135
                 +  VT+D+ +F  A+     A E L  G+ G++  A +++ +  K+
Sbjct  268  -----QPAVTYDEAAFRYALNDDAMATEKLAEGIRGFAVDAGKLDAMIEKL  313



>ref|WP_017453810.1| MULTISPECIES: transaldolase [Herbaspirillum]
Length=311

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 79/154 (51%), Gaps = 16/154 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  SG  E  G+    +DPG   V   YNY  K+G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKSSG-QEYTGS----DDPGVQSVKAVYNYYRKFGYATEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +     +LQ L +S  P       ER+LS ++A A +  +   ++ D+
Sbjct  222  TSQIVELAGCDLLTISPDLLQKLADSDAP------VERKLSKEAAEAADIKR---ISLDE  272

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL  147
             +F  A+     A E L  G+  ++  A ++E++
Sbjct  273  KAFRLALNADAMATEKLAEGIRQFAADAVKLEQI  306



>dbj|GAN07874.1| transaldolase 1 [Mucor ambiguus]
Length=322

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 80/158 (51%), Gaps = 18/158 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G            DPG   V+K YNY  K+G+ + +M A+ R
Sbjct  173  TLISPFVGRILDWYKKSTGQD-----YSAASDPGVQSVSKIYNYYKKFGYNTIVMGASFR  227

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW-  249
            N  ++  + G D++     +L SL+E      +  + ER+LSP++A A +  K   VT+ 
Sbjct  228  NTGEIEELAGCDFLTISPALLGSLQE------DNKTLERKLSPEAAQAESLEK---VTYF  278

Query  248  -DQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELF  144
             D+ +F   M     A E L+ G+  ++    ++E + 
Sbjct  279  KDEKAFRWEMNQDAMATEKLSEGIRNFAKDGLKLENML  316



>ref|WP_012406860.1| transaldolase [Nostoc punctiforme]
 sp|B2J2D9.1|TAL_NOSP7 RecName: Full=Transaldolase [Nostoc punctiforme PCC 73102]
 gb|ACC78831.1| transaldolase [Nostoc punctiforme PCC 73102]
Length=334

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 78/157 (50%), Gaps = 15/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPAT----EDPGVLSVTKIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ +V          R+L P  AA+ +  K  +   +
Sbjct  233  NLGEITELAGSDLLTISPSLLAELQSTVA------ELPRKLDPAKAASLSIEKISIDKAS  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFG  141
            +D+   A  M   A + L  G++G++   + +E+L  
Sbjct  287  YDKMHAADRM---ATDKLDEGIKGFTKALEDLEKLLA  320



>ref|WP_014150353.1| transaldolase [Methylomicrobium alcaliphilum]
 ref|YP_004919187.1| transaldolase [Methylomicrobium alcaliphilum 20Z]
 emb|CCE25604.1| Transaldolase [Methylomicrobium alcaliphilum 20Z]
Length=328

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPPA----EDPGVVSVTTVYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +      +    R+L P  AA     K   +T D
Sbjct  233  NIGEITELAGCDLLTISPSLLGELQST------EGDLPRKLDPAKAAEQAIEK---ITID  283

Query  245  QYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            + +F S  A    A + L+ G++G++   + +E+L  +
Sbjct  284  KATFESMHADNRMATDKLSEGIDGFTKALETLEKLLAE  321



>gb|EYC18811.1| hypothetical protein Y032_0026g1380 [Ancylostoma ceylanicum]
Length=431

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 83/159 (52%), Gaps = 15/159 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW   ++   + +    R +DPG   VT+ +NY  KYG+K+++MAA+ R
Sbjct  285  TLISPFVGRIMDWFVKNTDKKKYD----RHDDPGVQSVTRIFNYYKKYGYKTQVMAASFR  340

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N +++  ++G D +     +L+ L E      +K      L    AAA    +   +T D
Sbjct  341  NTEEIKGLMGCDLLTISPALLKQLSE------DKEVVSVALKSSDAAAKEIPR---ITVD  391

Query  245  QYSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELFGKI  135
            + SF  A+   A+  E L  G+  ++  A+ +E++  K+
Sbjct  392  EKSFRWALNEDAMASEKLAEGIRNFAKDARTLEDIVRKM  430



>ref|WP_028205749.1| transaldolase [Burkholderia nodosa]
Length=319

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 80/161 (50%), Gaps = 17/161 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSG---DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAA  432
            +I  FVGR+ DW +   G   D   +G      DPG   V K Y Y  K+GH +++M A+
Sbjct  168  LISPFVGRIYDWYKKAKGADWDDAKDGG---ANDPGVQSVRKIYAYYKKFGHNTEVMGAS  224

Query  431  IRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVT  252
             RN   +  + G D +     +LQ L +S    +EK   ER+LSP+   A+  TK E V 
Sbjct  225  FRNTSQIVELAGCDLLTISPDLLQKLHDS----NEK--VERKLSPE---AFKDTKIERVA  275

Query  251  WDQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELFGKI  135
             D+ SF   +     A E L  G+  ++  A ++E++  ++
Sbjct  276  VDEPSFRFQLNDDAMATEKLAEGIRAFAADAIKLEKMIEEL  316



>gb|EYC18812.1| hypothetical protein Y032_0026g1380 [Ancylostoma ceylanicum]
Length=452

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 83/159 (52%), Gaps = 15/159 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW   ++   + +    R +DPG   VT+ +NY  KYG+K+++MAA+ R
Sbjct  306  TLISPFVGRIMDWFVKNTDKKKYD----RHDDPGVQSVTRIFNYYKKYGYKTQVMAASFR  361

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N +++  ++G D +     +L+ L E      +K      L    AAA    +   +T D
Sbjct  362  NTEEIKGLMGCDLLTISPALLKQLSE------DKEVVSVALKSSDAAAKEIPR---ITVD  412

Query  245  QYSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELFGKI  135
            + SF  A+   A+  E L  G+  ++  A+ +E++  K+
Sbjct  413  EKSFRWALNEDAMASEKLAEGIRNFAKDARTLEDIVRKM  451



>ref|WP_011823313.1| transaldolase [Prochlorococcus marinus]
 sp|A2C0X8.1|TAL_PROM1 RecName: Full=Transaldolase [Prochlorococcus marinus str. NATL1A]
 gb|ABM75138.1| Transaldolase [Prochlorococcus marinus str. NATL1A]
Length=332

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 74/153 (48%), Gaps = 16/153 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW ++ +G           EDPG   VTK +NY    G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKSATGRDSYPAT----EDPGVVSVTKIFNYFKSNGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N +++  + G D +    K+LQ L E+ T    K + ++ L            EE +  D
Sbjct  232  NIEEITELAGCDLLTISPKLLQQLNETHTDLPIKLNAQKPL----------VIEEKIHLD  281

Query  245  QYSFASAMG--PAAVELLTAGMEGYSNQAKRVE  153
            Q SF   M     A E L  G+ G+S    ++E
Sbjct  282  QTSFELMMAGDKMATEKLDDGISGFSKAIDKLE  314



>ref|WP_011429619.1| transaldolase [Synechococcus sp. JA-3-3Ab]
 gb|ABC98937.1| transaldolase [Synechococcus sp. JA-3-3Ab]
Length=392

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 79/156 (51%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + H+G      A    EDPG   VT+ YNY+ KY + +++M A+ R
Sbjct  177  TLISPFVGRILDWYKKHTGRESYPPA----EDPGVQSVTQIYNYLRKYDYPTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTK--EEVVT  252
            N  ++  + G D +     +L  L+ +      +   ER+L P+ A   +  +   +  T
Sbjct  233  NIGEIIELAGCDLLTISPALLAELQNT------EGHLERKLDPEKAKKMDIPRLVMDRAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +DQ    + M   A E L  G++G+S   + +E+L 
Sbjct  287  FDQMHRENRM---ASEKLEEGIQGFSKALEVLEKLL  319



>ref|WP_011141596.1| transaldolase [Gloeobacter violaceus]
 ref|NP_924543.1| transaldolase/EF-hand domain-containing protein [Gloeobacter 
violaceus PCC 7421]
 sp|Q7NK81.1|TAL_GLOVI RecName: Full=Transaldolase [Gloeobacter violaceus PCC 7421]
 dbj|BAC89538.1| transaldolase [Gloeobacter violaceus PCC 7421]
Length=389

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 77/157 (49%), Gaps = 18/157 (11%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSG-DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAI  429
            ++I  FVGR+ DW +  +G D E        EDPG   VT  YNY  K+G+++++M A+ 
Sbjct  177  TLISPFVGRILDWYKKETGRDYEPH------EDPGVVSVTTIYNYYKKFGYQTQVMGASF  230

Query  428  RNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW  249
            RN  ++  + G D +    K+L+ L+ +           R+L P  AA     K   +  
Sbjct  231  RNIGEIVELAGCDLLTISPKLLEQLQAT------DAELVRKLDPDQAAGLEIEK---IDM  281

Query  248  DQYSFAS--AMGPAAVELLTAGMEGYSNQAKRVEELF  144
            DQ +F    A    A E L  G++G++N    +E+L 
Sbjct  282  DQATFEKRHAEDRMASEKLDEGIKGFTNALVALEKLL  318



>ref|WP_036531081.1| transaldolase [Neosynechococcus sphagnicola]
 gb|KGF73651.1| transaldolase [Neosynechococcus sphagnicola sy1]
Length=393

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 79/158 (50%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKSTGRDSYPPA----EDPGVLSVTQIYNYFKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ ++          R+L P  AA  +  +  +   T
Sbjct  233  NIDEIIQLAGCDLLTISPALLAELQANLG------DLPRQLDPAQAATLDLKQISIDKAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +DQ   +  M   A E L  G++G++   + +E+L  +
Sbjct  287  FDQMHASDRM---AFEKLDEGIKGFTKALETLEKLLAE  321



>gb|EGG99594.1| Transaldolase [gamma proteobacterium IMCC2047]
Length=331

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 12/154 (8%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + ++G      A    EDPG   V++ YNY  ++GH + +M A+ R
Sbjct  175  TLISPFVGRILDWYKKNTGRDHYPAA----EDPGVLSVSRIYNYYKQFGHSTIVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    +++Q L+E         + E +LSP+SA   +  K   +T +
Sbjct  231  NAGEIEQLAGCDRLTISPELMQELQEDTG------TLECQLSPESAPEQD--KHPEITEN  282

Query  245  QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
             + +     P A E L  G+  ++    ++E+  
Sbjct  283  SFRWLLNEDPMATEKLAEGIRNFAADQGKLEQFI  316



>ref|WP_025914337.1| transaldolase [Prochlorococcus sp. scB245a_520K10]
Length=333

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 84/176 (48%), Gaps = 24/176 (14%)
 Frame = -3

Query  647  LQFCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIH  468
              FCQA   A+A  ++I  FVGR+ DW +  +G +   GA    EDPG   VT+ YNY  
Sbjct  162  FNFCQAVTCAKAKITLISPFVGRILDWHKAKTGKTSFIGA----EDPGVISVTQIYNYFK  217

Query  467  KYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSP---  297
            + G K+++M A+ RN  ++  + G D +    K L+ LK+      EK    R+L     
Sbjct  218  EKGFKTEVMGASFRNLDEIKELAGCDLLTIAPKFLEELKK------EKGDLIRKLDATNQ  271

Query  296  -QSAAAYNFTKEEVVTWDQYSFASAM--GPAAVELLTAGMEGYSNQAKRVEELFGK  138
              ++  Y F        D+  F   M     A E L+ G+ G+S   + +E+L  K
Sbjct  272  RNNSVDYKF--------DEKDFRLNMLDDQMASEKLSEGITGFSKAIEELEQLLLK  319



>gb|KFM82043.1| Transaldolase, partial [Stegodyphus mimosarum]
Length=319

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW   ++     E      +DPG   VTK YNY  K+G+K+ +M A+ R
Sbjct  173  TLISPFVGRIFDWYVANTDKKSFEPK----DDPGVQSVTKIYNYYKKFGYKTVVMGASFR  228

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N   + ++ G D +    K+LQ L +S    DE + F   LSP  A   N  K   V++D
Sbjct  229  NVGQIKALAGCDLLTISPKLLQELADS---NDEIHRF---LSPDYAKNMNIEK---VSYD  279

Query  245  QYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELF  144
            +  F   +   P A + L  G+  ++  A ++E L 
Sbjct  280  EAKFRWELNDDPMACDKLADGIRKFAADAVKLENLM  315



>ref|WP_044530293.1| transaldolase [Herbaspirillum sp. B65]
Length=311

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 79/154 (51%), Gaps = 16/154 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  SG  E  G+    +DPG   V   YNY  K+G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKSSG-QEYTGS----DDPGVQSVKAVYNYYRKFGYATEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +     +LQ L +S  P       ER+LS ++A A +  +   ++ D+
Sbjct  222  TSQIVELAGCDLLTISPDLLQKLADSDAP------VERKLSKEAADAADIKR---ISLDE  272

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL  147
             +F  A+     A E L  G+  ++  A ++E++
Sbjct  273  KAFRLALNADAMATEKLAEGIRQFAADAVKLEQI  306



>ref|WP_040039767.1| transaldolase [Herbaspirillum sp. TSA66]
 gb|KIF80944.1| transaldolase [Herbaspirillum sp. TSA66]
Length=311

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 78/158 (49%), Gaps = 16/158 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G  E  GA    +DPG   V + Y+Y  K+G+K+++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKSTG-QEYSGA----DDPGVQSVKRIYDYYRKFGYKTEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++LQ L ES  P        R+LSP+ A      K   +  D+
Sbjct  222  TSQITELAGCDLLTISPELLQKLSESDAP------VARKLSPEQAQGAGLQK---LDLDE  272

Query  242  YSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELFGKI  135
             SF   +   A+  E L  G+  +   A ++E++   +
Sbjct  273  KSFRFMLNEDAMGTEKLAEGIRLFCADAVKLEKMIAAL  310



>ref|WP_005796850.1| transaldolase [Acidovorax delafieldii]
 gb|EER60032.1| transaldolase [Acidovorax delafieldii 2AN]
Length=315

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 81/168 (48%), Gaps = 11/168 (7%)
 Frame = -3

Query  641  FCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKY  462
            FCQA A  QA   +I  FVGR+ DW +  +G    E A     DPG   VT+ YN+  ++
Sbjct  154  FCQAVACGQAKVQLISPFVGRIYDWHKKQAGTQWDEAARSGANDPGVQSVTQIYNHYKRF  213

Query  461  GHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAA  282
            G  +++M A+ RN   + ++ G D +    ++L  L  S  P       +R LS  +A A
Sbjct  214  GIATEVMGASFRNVGQITALAGCDLLTIAPELLAQLAASEAP------LQRALSADAAQA  267

Query  281  YNFTKEEVVTWDQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELF  144
             +      V +D+  F  A+     A E L  G+  ++  A ++E+L 
Sbjct  268  MDL---PAVNYDEAGFRYALNEDAMATEKLAEGIRAFAADAIKLEKLI  312



>ref|WP_015220282.1| transaldolase [Cyanobacterium aponinum]
 gb|AFZ54559.1| transaldolase [Cyanobacterium aponinum PCC 10605]
Length=392

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 80/157 (51%), Gaps = 15/157 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G  +  GA    EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKETGREDFPGA----EDPGVQSVTEIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +    K+L+ L+ +      +     +LS + A   +  K   +T D
Sbjct  232  NISEICELAGCDLLTISPKLLEQLQNT------EEELPLKLSVEKAQKMDIEK---ITVD  282

Query  245  QYSFASAMGP--AAVELLTAGMEGYSNQAKRVEELFG  141
            + +F         A E L  G++G++   + +E+L  
Sbjct  283  KATFDKMHSEDRMANEKLDEGIKGFTKALETLEQLLA  319



>ref|WP_015208766.1| transaldolase [Cylindrospermum stagnale]
 gb|AFZ25518.1| transaldolase [Cylindrospermum stagnale PCC 7417]
Length=334

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 77/158 (49%), Gaps = 16/158 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           EDPG   VTK YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGKD-----YTATEDPGVLSVTKIYNYYKKFGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  LK +V          R+L P   A+ +  K  V   T
Sbjct  232  NIGEITELAGCDLLTISPGLLTELKSTVG------ELPRKLDPAKVASLSIEKISVDKAT  285

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +D+   A  M   A + L  G++G++     +E+L  +
Sbjct  286  FDKMHAADRM---AYDKLAEGIDGFTKALVALEKLLAE  320



>ref|WP_027400588.1| transaldolase [Aphanizomenon flos-aquae]
Length=333

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 76/158 (48%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPAA----EDPGVLSVTTIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ +V          R+L P  AA  +  K  V   T
Sbjct  233  NIGEITELAGCDLLTISPGLLTELQNTVA------ELPRKLDPAKAAGLSTAKISVDKAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK  138
            +DQ      M   A + L  G++G++     +E+L  +
Sbjct  287  FDQMHNGDRM---ASDKLAEGIDGFTKALISLEKLLAE  321



>ref|WP_042271099.1| transaldolase [Burkholderia heleia]
Length=319

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 80/161 (50%), Gaps = 17/161 (11%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSG---DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAA  432
            +I  FVGR+ DW +   G   D   +G      DPG   V K Y Y  K+GHK+++M A+
Sbjct  168  LISPFVGRIYDWYKKAKGADWDDAKDGG---ANDPGVQSVRKIYAYYKKFGHKTEVMGAS  224

Query  431  IRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVT  252
             RN   +  + G D +     +LQ L +S    +EK   ER+LSP+   A+   K E V 
Sbjct  225  FRNTSQIVELAGCDLLTISPDLLQKLHDS----NEK--VERKLSPE---AFEGAKIERVA  275

Query  251  WDQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELFGKI  135
             D+ SF   +     A E L  G+  ++  A ++E++  ++
Sbjct  276  VDEPSFRFQLNEDAMATEKLAEGIRAFAADAVKLEKMIEEL  316



>ref|WP_031386061.1| transaldolase [Desulfonatronum thiodismutans]
Length=319

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 81/159 (51%), Gaps = 23/159 (14%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRG----EDPGSALVTKAYNYIHKYGHKSKLMAA  435
            +I  FVGR+ DW + H G        R G    +DPG   VT+ YNY  K+G+ +++M A
Sbjct  174  LISPFVGRIMDWYKKHEG--------RDGYAPQDDPGVHSVTRIYNYYKKHGYPTEVMGA  225

Query  434  AIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVV  255
            + RN  ++  + G D +     +L+ L       D + + ER+LSP+SA +     EE +
Sbjct  226  SFRNAGEILELAGCDLLTISPDLLRELH------DGQGTLERKLSPESAQSLG---EEKL  276

Query  254  TWDQYSFASAMGP--AAVELLTAGMEGYSNQAKRVEELF  144
            + D+ +F   +     A E L+ G+  ++  A ++E + 
Sbjct  277  SLDEKAFRWMLNEDQMATEKLSDGIRLFAADAVKLERMI  315



>ref|WP_034111665.1| transaldolase [Comamonadaceae bacterium BICA1-1]
Length=318

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 79/168 (47%), Gaps = 11/168 (7%)
 Frame = -3

Query  641  FCqaaaaaqagASVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKY  462
            FCQA A AQA   +I  FVGR+ DW +  +G    E A     DPG   V + + Y  ++
Sbjct  154  FCQALACAQARVQLISPFVGRIYDWHKKQAGPHWDEAARAGAHDPGVQSVRRIFEYYKRF  213

Query  461  GHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAA  282
            G  +++M A+ RN   + ++ G D +    ++L  L  S  P        R L P +A A
Sbjct  214  GIATEIMGASFRNTGQIVALAGCDLLTISPELLAQLAASTAP------VPRALDPDAARA  267

Query  281  YNFTKEEVVTWDQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELF  144
             +    + V  DQ SF  A+     A E L  G+  +   + R+E+L 
Sbjct  268  LDL---QAVQHDQASFRLALNEDAMATEKLAEGIRAFCADSLRLEQLI  312



>ref|WP_039199424.1| transaldolase [Aphanizomenon flos-aquae]
 gb|KHG43139.1| transaldolase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=333

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 75/156 (48%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPAA----EDPGVLSVTTIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++  + G D +     +L  L+ +V          R+L P  AA  +  K  V   T
Sbjct  233  NIGEITELAGCDLLTISPGLLTELQNTVA------ELPRKLDPAKAAGLSTAKISVDKAT  286

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +DQ      M   A + L  G++G++     +E+L 
Sbjct  287  FDQMHNGDRM---ASDKLAEGIDGFTKALISLEKLL  319



>ref|WP_029969983.1| transaldolase [Burkholderia sp. URHA0054]
Length=317

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 76/155 (49%), Gaps = 11/155 (7%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW + ++G +  E       DPG   V + Y Y  K+G+K+++M A+ R 
Sbjct  168  LISPFVGRIYDWYKKNAGSAWDEAKDGGANDPGVQSVRRIYGYYKKFGYKTEVMGASFRT  227

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +     +LQ L ES          ER+LSP+S+   N    E V  D+
Sbjct  228  TGQILELAGCDLLTISPDLLQKLHESTD------KVERKLSPESSQDANI---ERVPVDE  278

Query  242  YSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELF  144
             SF   +   A+  E L  G+  ++  A ++E+L 
Sbjct  279  SSFRFLVNDEAMATEKLAEGIRAFAADAVKLEKLI  313



>ref|WP_026611930.1| transaldolase [Methylocaldum szegediense]
Length=328

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 81/156 (52%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + ++G    E  L   EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKNTGR---ESYLPH-EDPGVQSVTQIYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +      +    R+L P  AA  +  K   +T D
Sbjct  233  NIGEITELAGCDLLTIAPSLLAELQST------EGDLPRKLDPAKAAEASIEK---ITMD  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            + +F    A    A E L+ G++G++   + +E+L 
Sbjct  284  KETFDRMHAENRMASEKLSEGIDGFTKALETLEQLL  319



>ref|WP_012373527.1| transaldolase [Opitutus terrae]
 ref|YP_001817589.1| transaldolase A [Opitutus terrae PB90-1]
 sp|B1ZUE6.1|TAL_OPITP RecName: Full=Transaldolase [Opitutus terrae PB90-1]
 gb|ACB73989.1| transaldolase [Opitutus terrae PB90-1]
Length=315

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 78/155 (50%), Gaps = 16/155 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G           +DPG   V + Y Y  ++G+++++M A+ RN
Sbjct  170  LISPFVGRILDWYKKSTGQDYAPA-----DDPGVNSVREIYTYYKRFGYETEVMGASFRN  224

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
            K ++  + G D +    K+L  L  S  P       ER+L P++A      +   V++D+
Sbjct  225  KDEILELAGCDLLTIAPKLLGELAASTDP------VERKLEPEAARKAKVKR---VSFDE  275

Query  242  YSFASAMGP--AAVELLTAGMEGYSNQAKRVEELF  144
             SF  A+     A E L+ G+  ++   +++E+L 
Sbjct  276  KSFRWALNEDQMATEKLSDGIRSFAADVRKLEQLI  310



>ref|WP_009342587.1| transaldolase [Raphidiopsis brookii]
 gb|EFA73409.1| Transaldolase AB [Raphidiopsis brookii D9]
Length=334

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 77/156 (49%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G S    A    EDPG   VTK YNY  K+G+++++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRSSYPPA----EDPGVLSVTKIYNYYKKFGYQTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + G D +     +L  L+ +V          R+L P + +  +  K   ++ D
Sbjct  233  NMGEITELAGCDLLTISPALLSELQNTVA------DLPRKLDPVTTSGLSIDK---ISVD  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            Q +F         A + L  G++G++     +EEL 
Sbjct  284  QSTFERMHTADRMASDKLREGIDGFTKALISLEELL  319



>ref|WP_044106696.1| transaldolase [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP17906.1| transaldolase AB family [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=327

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 78/156 (50%), Gaps = 16/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW    +G           EDPG   VT+ YNY  K+G+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYTKETGKEYAPA-----EDPGVLSVTQIYNYYKKFGYKTEVMGASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VT  252
            N  ++Y + G D +    K+L+ L+ +      +    R+L P+ AA     K  V    
Sbjct  231  NIGEIYELAGCDLLTISPKLLEQLQLT------EAELPRKLDPEVAAKMKIEKIFVDRAN  284

Query  251  WDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            +D+    + M   A + L  G++G++   + +EEL 
Sbjct  285  FDKMHQKNKM---AFDKLDEGIKGFTKALETLEELL  317



>ref|WP_005875605.1| transaldolase [Oxalobacter formigenes]
 gb|EEO26902.1| transaldolase [Oxalobacter formigenes HOxBLS]
Length=311

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 16/158 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G  E  G      DPG   V K YNY  K+G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKQTG-QEYTGE----SDPGVQSVKKIYNYYRKFGYPTEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +    ++LQ L +S  P        R+LSP+ A   +    E V++D+
Sbjct  222  TSQIVELAGCDLLTISPELLQKLSDSDAP------VTRKLSPEQAKQDSV---ERVSYDE  272

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEELFGKI  135
             +F  A+     A E L+ G+  +     ++E++  ++
Sbjct  273  KTFRLALNDDAMATEKLSEGIRLFCADTVKLEKMIDEL  310



>ref|WP_023494155.1| transaldolase Tal [Methyloglobulus morosus]
 gb|ESS72782.1| transaldolase Tal [Methyloglobulus morosus KoM1]
Length=334

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 77/156 (49%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ R
Sbjct  177  TLISPFVGRILDWYKKDTGRDSYPAA----EDPGVVSVTDVYNYYKKFGYKTEVMGASFR  232

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++  + GVD +     +L  L+ +      +    R+L PQ+AA  +  K   ++ D
Sbjct  233  NIGEITELAGVDLLTIAPSLLSELQST------EGELPRKLDPQTAAQKSIEK---ISMD  283

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            + +F         A + L  G+ G+    + +EEL 
Sbjct  284  KATFDRMHQENRMANDKLAEGILGFEKALEALEELL  319



>ref|XP_006643322.1| PREDICTED: transaldolase-like [Lepisosteus oculatus]
Length=332

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 15/156 (10%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW + ++     E A    EDPG   VTK YNY  K+G+K+ +M A+ R
Sbjct  179  TLISPFVGRILDWYKENTDRKSYEPA----EDPGVVSVTKIYNYYKKFGYKTVVMGASFR  234

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  +V ++ G DY+     +L  L    +P          LS Q+A A    +   VT D
Sbjct  235  NTGEVKALSGCDYLTISPALLAELSRDHSP------LAPALSEQAAQACELQR---VTLD  285

Query  245  QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEELF  144
            + +F         AVE L+ G+  ++  A R+E + 
Sbjct  286  EKAFRWLHNEDRMAVEKLSDGIRRFAADAVRLETMI  321



>ref|WP_006048374.1| transaldolase [Burkholderia graminis]
 gb|EDT11290.1| transaldolase [Burkholderia graminis C4D1M]
Length=317

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 76/155 (49%), Gaps = 11/155 (7%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW + ++G +  E       DPG   V + Y Y  K+G+K+++M A+ R 
Sbjct  168  LISPFVGRIYDWYKKNAGSAWDEAKDGGANDPGVQSVRRIYGYYKKFGYKTEVMGASFRT  227

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +     +LQ L ES          ER+LSP+S+   N    E V  D+
Sbjct  228  TGQILELAGCDLLTISPDLLQKLHESTD------KVERKLSPESSQDANI---ERVPVDE  278

Query  242  YSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELF  144
             SF   +   A+  E L  G+  ++  A ++E+L 
Sbjct  279  SSFRFLVNDEAMATEKLAEGIRAFAADAVKLEKLI  313



>ref|XP_002185708.1| transaldolase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65178.1| transaldolase [Phaeodactylum tricornutum CCAP 1055/1]
Length=316

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 73/158 (46%), Gaps = 15/158 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +   G   V+G     EDPG   VTK YNY  KYG  + +M A+ R
Sbjct  170  TLISPFVGRIMDWYKKDQG---VDG-FEPKEDPGVISVTKIYNYYKKYGFNTIVMGASFR  225

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N   +  + G D +     +L  L  S          E++L   +AA  +  K   V  D
Sbjct  226  NAGQITELAGCDRLTISPPLLNELIASAD------KLEKKLDASNAATLDIAK---VDMD  276

Query  245  QYSFASAMG--PAAVELLTAGMEGYSNQAKRVEELFGK  138
            + +F   M   P A E L  G+  ++    ++EE+  K
Sbjct  277  EKTFRWMMNEDPMATEKLADGIRNFAADVVKLEEIVKK  314



>gb|KIH67069.1| transaldolase [Ancylostoma duodenale]
Length=321

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 82/159 (52%), Gaps = 15/159 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW   ++   + +    R +DPG   VT+ +NY  KYG+K+++MAA+ R
Sbjct  175  TLISPFVGRIMDWFVKNTDKKKYD----RHDDPGVQSVTRIFNYYKKYGYKTQVMAASFR  230

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N +++  ++G D +     +L+ L E      +K      L    AA     +   +T D
Sbjct  231  NTEEIKGLMGCDLLTISPALLKQLAE------DKEVVSVALKSSDAAGKEIPR---ITVD  281

Query  245  QYSFASAMGPAAV--ELLTAGMEGYSNQAKRVEELFGKI  135
            + SF  A+   A+  E L  G+  ++  A+ +E++  K+
Sbjct  282  EKSFRWALNEDAMASEKLAEGIRNFAKDARTLEDIVKKM  320



>ref|WP_006463829.1| transaldolase B [Herbaspirillum frisingense]
 gb|EOA04418.1| transaldolase B [Herbaspirillum frisingense GSF30]
Length=311

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 79/154 (51%), Gaps = 16/154 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  +G  E  G+    +DPG   V   YNY  K+G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKSTG-QEYTGS----DDPGVQSVKAVYNYYRKFGYATEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +     +LQ L +S  P       ER+LS ++A A +    E ++ D+
Sbjct  222  TSQIVELAGCDLLTISPDLLQKLADSDAP------VERKLSKEAADAADI---ERISLDE  272

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL  147
             +F  A+     A E L  G+  ++  A ++E++
Sbjct  273  KAFRLALNADAMATEKLAEGIRQFAADAVKLEQI  306



>gb|EJT50936.1| TAL1 protein [Trichosporon asahii var. asahii CBS 2479]
 gb|EKC98678.1| TAL1 protein [Trichosporon asahii var. asahii CBS 8904]
Length=163

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 78/160 (49%), Gaps = 14/160 (9%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G           +DPG   V + Y Y  ++G+ + +M A+ R
Sbjct  13   TLISPFVGRILDWYKKATGKE-----YTAEDDPGVVSVREIYTYYKQHGYPTIVMGASFR  67

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD  246
            N  ++ ++ G D++    K+L+ LK S  P        + LSP+ A A    ++     D
Sbjct  68   NTGEIKALAGCDFLTISPKLLEELKNSTDP------VPQVLSPEKAKAAKPLQKVSYIND  121

Query  245  QYSFASAM--GPAAVELLTAGMEGYSNQAKRVEELF-GKI  135
            Q  FA  +     A E LT G+ G++     ++EL  GKI
Sbjct  122  QPKFAWDLFENQMAFEKLTEGIRGFAKDGNTLKELLKGKI  161



>ref|WP_008113630.1| transaldolase [Herbaspirillum sp. YR522]
 gb|EJN08015.1| transaldolase [Herbaspirillum sp. YR522]
Length=311

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 78/154 (51%), Gaps = 16/154 (10%)
 Frame = -3

Query  602  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN  423
            +I  FVGR+ DW +  SG  +  GA    +DPG   V   YNY  K+G+ +++M A+ RN
Sbjct  167  LISPFVGRIYDWYKKSSG-QDYTGA----DDPGVQSVKAVYNYYRKFGYATEVMGASFRN  221

Query  422  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ  243
               +  + G D +     +LQ L ES  P       +R+LS ++A A +  +   ++ D+
Sbjct  222  TSQIVELAGCDLLTISPDLLQKLAESDAP------VQRKLSVEAAKAADIAR---ISLDE  272

Query  242  YSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL  147
             +F  A+     A E L  G+  +   A ++E++
Sbjct  273  KAFRLALNGDAMATEKLAEGIRQFCADAVKLEQI  306



>ref|WP_010307265.1| transaldolase [Synechococcus sp. CB0101]
Length=390

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 76/154 (49%), Gaps = 18/154 (12%)
 Frame = -3

Query  605  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR  426
            ++I  FVGR+ DW +  +G     G     EDPG   VT+ +NY   YG+K+++M A+ R
Sbjct  176  TLISPFVGRILDWYKKSTGRDSYPGP----EDPGVVSVTQIFNYFKTYGYKTEVMGASFR  231

Query  425  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYN-FTKEEVVTW  249
            N  ++  + G D +    K+L  L+ S      +    R+L+     A+N    EE +  
Sbjct  232  NVDEIIELAGCDLLTISPKLLDQLRHS------EGELTRKLN-----AFNPGPTEEQLHL  280

Query  248  DQYSFASAM--GPAAVELLTAGMEGYSNQAKRVE  153
            D+  F + M   P A E L  G+ G+S   + +E
Sbjct  281  DRQGFEAMMHKDPMATEKLQEGITGFSRAIETLE  314



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160