BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048J21

Length=685
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU23123.1|  hypothetical protein MIMGU_mgv1a001829mg                268   8e-81   Erythranthe guttata [common monkey flower]
ref|XP_011083848.1|  PREDICTED: conserved oligomeric Golgi comple...    267   2e-80   Sesamum indicum [beniseed]
ref|XP_009602477.1|  PREDICTED: conserved oligomeric Golgi comple...    264   3e-79   Nicotiana tomentosiformis
ref|XP_007023396.1|  Golgi organization, COG2 isoform 1                 263   3e-79   
emb|CDP04651.1|  unnamed protein product                                261   4e-78   Coffea canephora [robusta coffee]
ref|XP_007155537.1|  hypothetical protein PHAVU_003G210200g             259   2e-77   Phaseolus vulgaris [French bean]
ref|XP_009769044.1|  PREDICTED: conserved oligomeric Golgi comple...    257   7e-77   Nicotiana sylvestris
gb|KHN14099.1|  Conserved oligomeric Golgi complex subunit 2            255   7e-77   Glycine soja [wild soybean]
ref|XP_004170101.1|  PREDICTED: conserved oligomeric Golgi comple...    243   1e-76   
gb|KDO52633.1|  hypothetical protein CISIN_1g004390mg                   249   1e-76   Citrus sinensis [apfelsine]
ref|XP_004244508.1|  PREDICTED: conserved oligomeric Golgi comple...    256   2e-76   Solanum lycopersicum
ref|XP_006477014.1|  PREDICTED: conserved oligomeric Golgi comple...    254   8e-76   Citrus sinensis [apfelsine]
ref|XP_006357074.1|  PREDICTED: conserved oligomeric Golgi comple...    254   8e-76   Solanum tuberosum [potatoes]
gb|EYU23122.1|  hypothetical protein MIMGU_mgv1a024704mg                254   9e-76   Erythranthe guttata [common monkey flower]
ref|XP_003549849.1|  PREDICTED: conserved oligomeric Golgi comple...    254   1e-75   Glycine max [soybeans]
gb|KDO52632.1|  hypothetical protein CISIN_1g004390mg                   249   1e-75   Citrus sinensis [apfelsine]
gb|KDO52631.1|  hypothetical protein CISIN_1g004390mg                   249   3e-75   Citrus sinensis [apfelsine]
gb|KHN34411.1|  Conserved oligomeric Golgi complex subunit 2            252   4e-75   Glycine soja [wild soybean]
ref|XP_003525701.1|  PREDICTED: conserved oligomeric Golgi comple...    252   5e-75   Glycine max [soybeans]
gb|KHG07418.1|  Conserved oligomeric Golgi complex subunit 2            252   6e-75   Gossypium arboreum [tree cotton]
ref|XP_010026586.1|  PREDICTED: conserved oligomeric Golgi comple...    252   6e-75   Eucalyptus grandis [rose gum]
ref|XP_010026579.1|  PREDICTED: conserved oligomeric Golgi comple...    253   7e-75   Eucalyptus grandis [rose gum]
ref|XP_010250762.1|  PREDICTED: conserved oligomeric Golgi comple...    252   7e-75   Nelumbo nucifera [Indian lotus]
ref|XP_004515820.1|  PREDICTED: conserved oligomeric Golgi comple...    251   1e-74   Cicer arietinum [garbanzo]
ref|XP_002279916.1|  PREDICTED: conserved oligomeric Golgi comple...    250   4e-74   Vitis vinifera
gb|KJB43171.1|  hypothetical protein B456_007G187600                    249   5e-74   Gossypium raimondii
gb|KJB43167.1|  hypothetical protein B456_007G187600                    249   6e-74   Gossypium raimondii
gb|KDO52630.1|  hypothetical protein CISIN_1g004390mg                   249   8e-74   Citrus sinensis [apfelsine]
ref|XP_006440092.1|  hypothetical protein CICLE_v10018979mg             249   9e-74   Citrus clementina [clementine]
ref|XP_010536632.1|  PREDICTED: conserved oligomeric Golgi comple...    246   1e-72   Tarenaya hassleriana [spider flower]
gb|KDO52629.1|  hypothetical protein CISIN_1g004390mg                   243   2e-71   Citrus sinensis [apfelsine]
ref|XP_002511204.1|  Conserved oligomeric Golgi complex component...    241   6e-71   Ricinus communis
ref|XP_004138387.1|  PREDICTED: conserved oligomeric Golgi comple...    241   7e-71   Cucumis sativus [cucumbers]
gb|KDP30933.1|  hypothetical protein JCGZ_11309                         241   1e-70   Jatropha curcas
ref|XP_008463108.1|  PREDICTED: conserved oligomeric Golgi comple...    240   2e-70   
ref|XP_009359449.1|  PREDICTED: conserved oligomeric Golgi comple...    238   9e-70   Pyrus x bretschneideri [bai li]
ref|XP_004297537.1|  PREDICTED: conserved oligomeric Golgi comple...    237   3e-69   Fragaria vesca subsp. vesca
ref|XP_009346519.1|  PREDICTED: conserved oligomeric Golgi comple...    232   2e-68   Pyrus x bretschneideri [bai li]
ref|XP_003608844.1|  Conserved oligomeric Golgi complex subunit         234   4e-68   Medicago truncatula
ref|XP_008374256.1|  PREDICTED: conserved oligomeric Golgi comple...    233   9e-68   Malus domestica [apple tree]
ref|XP_009375225.1|  PREDICTED: conserved oligomeric Golgi comple...    232   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_010433717.1|  PREDICTED: conserved oligomeric Golgi comple...    231   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010448510.1|  PREDICTED: conserved oligomeric Golgi comple...    231   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_008351743.1|  PREDICTED: conserved oligomeric Golgi comple...    231   7e-67   
ref|XP_010438959.1|  PREDICTED: conserved oligomeric Golgi comple...    230   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010927713.1|  PREDICTED: conserved oligomeric Golgi comple...    228   6e-66   Elaeis guineensis
ref|XP_008392829.1|  PREDICTED: conserved oligomeric Golgi comple...    228   7e-66   
ref|XP_006283181.1|  hypothetical protein CARUB_v10004211mg             228   9e-66   Capsella rubella
ref|XP_002867640.1|  hypothetical protein ARALYDRAFT_492352             228   9e-66   
gb|KFK29022.1|  hypothetical protein AALP_AA7G078500                    225   6e-65   Arabis alpina [alpine rockcress]
ref|NP_567710.1|  uncharacterized protein                               225   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926719.1|  PREDICTED: conserved oligomeric Golgi comple...    224   2e-64   Elaeis guineensis
gb|AAK32887.1|AF367300_1  AT4g24840/F6I7_50                             223   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677897.1|  PREDICTED: conserved oligomeric Golgi comple...    223   7e-64   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN71854.1|  hypothetical protein VITISV_007347                     222   1e-63   Vitis vinifera
ref|XP_008794572.1|  PREDICTED: conserved oligomeric Golgi comple...    218   2e-62   Phoenix dactylifera
ref|XP_011024042.1|  PREDICTED: conserved oligomeric Golgi comple...    216   2e-61   Populus euphratica
ref|XP_006296685.1|  hypothetical protein CARUB_v10013037mg             215   3e-61   Capsella rubella
ref|XP_002322242.1|  hypothetical protein POPTR_0015s10610g             214   5e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008239451.1|  PREDICTED: conserved oligomeric Golgi comple...    214   5e-61   Prunus mume [ume]
ref|XP_006413377.1|  hypothetical protein EUTSA_v10024490mg             214   9e-61   Eutrema salsugineum [saltwater cress]
ref|XP_011044173.1|  PREDICTED: conserved oligomeric Golgi comple...    213   1e-60   Populus euphratica
gb|EPS73270.1|  hypothetical protein M569_01480                         213   1e-60   Genlisea aurea
ref|XP_010105239.1|  Conserved oligomeric Golgi complex subunit 2       211   7e-60   
ref|XP_010485902.1|  PREDICTED: conserved oligomeric Golgi comple...    210   2e-59   Camelina sativa [gold-of-pleasure]
emb|CDX92658.1|  BnaC07g39160D                                          210   3e-59   
emb|CDY11039.1|  BnaA03g46980D                                          209   3e-59   Brassica napus [oilseed rape]
ref|XP_009137478.1|  PREDICTED: conserved oligomeric Golgi comple...    209   3e-59   Brassica rapa
dbj|BAK01513.1|  predicted protein                                      207   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010464008.1|  PREDICTED: conserved oligomeric Golgi comple...    206   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004981048.1|  PREDICTED: conserved oligomeric Golgi comple...    206   5e-58   Setaria italica
ref|XP_009138596.1|  PREDICTED: conserved oligomeric Golgi comple...    205   1e-57   Brassica rapa
emb|CDY34317.1|  BnaA01g14200D                                          205   1e-57   Brassica napus [oilseed rape]
ref|XP_009385489.1|  PREDICTED: conserved oligomeric Golgi comple...    205   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS58136.1|  Oligomeric Golgi complex subunit 2                      204   2e-57   Triticum urartu
ref|XP_003562360.1|  PREDICTED: conserved oligomeric Golgi comple...    204   2e-57   Brachypodium distachyon [annual false brome]
emb|CDY03412.1|  BnaC01g16700D                                          204   2e-57   
ref|XP_002463519.1|  hypothetical protein SORBIDRAFT_01g001270          204   3e-57   Sorghum bicolor [broomcorn]
ref|XP_006652018.1|  PREDICTED: conserved oligomeric Golgi comple...    203   5e-57   Oryza brachyantha
tpg|DAA52497.1|  TPA: hypothetical protein ZEAMMB73_788308              202   1e-56   
ref|XP_008645319.1|  PREDICTED: uncharacterized protein LOC100383...    202   2e-56   
ref|XP_008644331.1|  PREDICTED: conserved oligomeric Golgi comple...    202   2e-56   
gb|EEC76534.1|  hypothetical protein OsI_14326                          199   1e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001051898.1|  Os03g0849600                                       199   2e-55   
ref|XP_009131654.1|  PREDICTED: conserved oligomeric Golgi comple...    194   9e-54   Brassica rapa
gb|EMT13194.1|  Putative oligomeric Golgi complex subunit 2             193   1e-53   
ref|XP_002318717.1|  hypothetical protein POPTR_0012s09800g             194   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_003603203.1|  Conserved oligomeric Golgi complex subunit         192   4e-53   
emb|CDY51233.1|  BnaA03g07050D                                          191   8e-53   Brassica napus [oilseed rape]
emb|CDX70811.1|  BnaC03g08950D                                          189   6e-52   
ref|XP_006848427.1|  hypothetical protein AMTR_s00013p00234340          179   3e-48   
emb|CAB41124.1|  brefeldin A-sensitive Golgi protein-like               174   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385490.1|  PREDICTED: conserved oligomeric Golgi comple...    173   3e-46   
ref|XP_007210583.1|  hypothetical protein PRUPE_ppa015080mg             165   2e-43   
ref|XP_001764075.1|  predicted protein                                  165   3e-43   
ref|XP_002966110.1|  hypothetical protein SELMODRAFT_86129              131   2e-31   Selaginella moellendorffii
ref|XP_002982190.1|  hypothetical protein SELMODRAFT_115746             131   2e-31   Selaginella moellendorffii
ref|XP_005644140.1|  hypothetical protein COCSUDRAFT_48790              125   5e-29   Coccomyxa subellipsoidea C-169
ref|XP_007023397.1|  Golgi organization, COG2 isoform 2                 120   1e-27   
ref|XP_001416921.1|  predicted protein                                  116   7e-26   Ostreococcus lucimarinus CCE9901
gb|AES73454.2|  oligomeric subunit-like protein                         112   3e-25   Medicago truncatula
ref|XP_003078128.1|  Low density lipoprotein receptor (ISS)             112   2e-24   Ostreococcus tauri
ref|XP_005848758.1|  hypothetical protein CHLNCDRAFT_57543              111   4e-24   Chlorella variabilis
gb|KIZ07920.1|  Conserved oligomeric Golgi complex subunit 2            104   6e-22   Monoraphidium neglectum
ref|XP_007510910.1|  predicted protein                                  105   7e-22   Bathycoccus prasinos
ref|XP_002501700.1|  predicted protein                                  102   5e-21   Micromonas commoda
ref|XP_003062630.1|  predicted protein                                95.5    9e-19   Micromonas pusilla CCMP1545
ref|XP_002132051.1|  PREDICTED: conserved oligomeric Golgi comple...  93.6    4e-18   Ciona intestinalis [sea vase]
ref|XP_006817460.1|  PREDICTED: conserved oligomeric Golgi comple...  93.2    4e-18   Saccoglossus kowalevskii
emb|CBN77515.1|  weakly similar to brefeldin A-sensitive Golgi pr...  90.9    4e-17   Ectocarpus siliculosus
ref|XP_002947088.1|  component of oligomeric golgi complex 2          90.5    6e-17   Volvox carteri f. nagariensis
ref|XP_004367588.1|  hypothetical protein ACA1_252880                 84.3    4e-15   Acanthamoeba castellanii str. Neff
gb|EOB00851.1|  Conserved oligomeric Golgi complex subunit 2          83.6    8e-15   Anas platyrhynchos [duck]
ref|XP_005020290.1|  PREDICTED: conserved oligomeric Golgi comple...  83.6    8e-15   
gb|KFO53927.1|  Conserved oligomeric Golgi complex subunit 2          82.8    1e-14   Corvus brachyrhynchos
ref|XP_008641602.1|  PREDICTED: conserved oligomeric Golgi comple...  82.8    1e-14   
ref|XP_009944192.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    3e-14   Leptosomus discolor
ref|XP_003291862.1|  hypothetical protein DICPUDRAFT_50102            81.6    4e-14   Dictyostelium purpureum
ref|XP_002999266.1|  conserved oligomeric Golgi complex subunit, ...  80.9    6e-14   Phytophthora infestans T30-4
ref|XP_781715.3|  PREDICTED: conserved oligomeric Golgi complex s...  79.7    6e-14   Strongylocentrotus purpuratus [purple urchin]
ref|XP_009091144.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    8e-14   
dbj|BAE91354.1|  unnamed protein product                              77.0    9e-14   Macaca fascicularis [crab eating macaque]
ref|XP_005423302.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    9e-14   Geospiza fortis
gb|ETP19166.1|  hypothetical protein F441_06722                       80.5    1e-13   Phytophthora parasitica CJ01A1
gb|ETP47094.1|  hypothetical protein F442_06755                       80.5    1e-13   Phytophthora parasitica P10297
gb|ETO78126.1|  hypothetical protein F444_06786                       80.5    1e-13   Phytophthora parasitica P1976
gb|ETI49393.1|  hypothetical protein F443_06719                       80.5    1e-13   Phytophthora parasitica P1569
ref|XP_008892343.1|  hypothetical protein PPTG_02808                  80.1    1e-13   Phytophthora parasitica INRA-310
gb|ETL95872.1|  hypothetical protein L917_06400                       80.1    1e-13   Phytophthora parasitica
gb|ETK89268.1|  hypothetical protein L915_06592                       80.5    1e-13   Phytophthora parasitica
ref|XP_009870043.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Apaloderma vittatum
ref|XP_010284176.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    1e-13   Phaethon lepturus
ref|XP_009074061.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    1e-13   Acanthisitta chloris
ref|XP_010196213.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Colius striatus
gb|KFP90068.1|  Conserved oligomeric Golgi complex subunit 2          80.1    1e-13   Apaloderma vittatum
ref|XP_010196214.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    1e-13   Colius striatus
gb|KFP72142.1|  Conserved oligomeric Golgi complex subunit 2          79.0    1e-13   Acanthisitta chloris
ref|XP_010389860.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    1e-13   
ref|XP_005491190.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    2e-13   
gb|KFP64444.1|  Conserved oligomeric Golgi complex subunit 2          79.0    2e-13   Cariama cristata
ref|XP_009697273.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    2e-13   Cariama cristata
ref|XP_005518612.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    3e-13   
ref|XP_005518611.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    3e-13   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFQ55583.1|  Conserved oligomeric Golgi complex subunit 2          78.6    4e-13   Nestor notabilis
ref|XP_010560976.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    4e-13   Haliaeetus leucocephalus
ref|XP_010560978.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    4e-13   Haliaeetus leucocephalus
ref|XP_010019366.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    4e-13   Nestor notabilis
ref|XP_005043524.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    4e-13   Ficedula albicollis
gb|KFZ60054.1|  Conserved oligomeric Golgi complex subunit 2          78.2    4e-13   Podiceps cristatus
gb|KFP94737.1|  Conserved oligomeric Golgi complex subunit 2          78.2    4e-13   Haliaeetus albicilla
ref|XP_005440304.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   Falco cherrug
ref|XP_005239169.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   
ref|XP_010560975.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   Haliaeetus leucocephalus
ref|XP_010560974.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   Haliaeetus leucocephalus
ref|XP_005440305.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    5e-13   
gb|KFW80703.1|  Conserved oligomeric Golgi complex subunit 2          78.2    5e-13   Manacus vitellinus
ref|XP_008921823.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    6e-13   
ref|XP_009921343.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    6e-13   Haliaeetus albicilla
ref|XP_008921822.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    6e-13   
ref|XP_004898237.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    6e-13   
ref|XP_009829212.1|  hypothetical protein H257_05897                  77.8    6e-13   Aphanomyces astaci
gb|KFP07462.1|  Conserved oligomeric Golgi complex subunit 2          77.4    7e-13   Calypte anna
gb|KFR13493.1|  Conserved oligomeric Golgi complex subunit 2          77.8    7e-13   Opisthocomus hoazin [hoatzin]
ref|XP_009571302.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    7e-13   Fulmarus glacialis
ref|XP_010002540.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    7e-13   Chaetura pelagica
gb|KFU94611.1|  Conserved oligomeric Golgi complex subunit 2          77.4    7e-13   Chaetura pelagica
ref|XP_010147792.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    7e-13   Eurypyga helias
ref|XP_008500618.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    8e-13   Calypte anna
gb|KFW03254.1|  Conserved oligomeric Golgi complex subunit 2          77.4    8e-13   Eurypyga helias
gb|KFW00567.1|  Conserved oligomeric Golgi complex subunit 2          76.6    9e-13   Fulmarus glacialis
gb|KFQ91617.1|  Conserved oligomeric Golgi complex subunit 2          77.4    9e-13   Nipponia nippon
ref|XP_009936334.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    1e-12   Opisthocomus hoazin [hoatzin]
gb|ELT94120.1|  hypothetical protein CAPTEDRAFT_214095                77.0    1e-12   Capitella teleta
ref|XP_009469603.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   Nipponia nippon
ref|XP_009565362.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-12   Cuculus canorus
ref|XP_009565361.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Cuculus canorus
ref|XP_007987957.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Chlorocebus sabaeus
ref|XP_010372341.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    1e-12   Rhinopithecus roxellana
ref|XP_010372342.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    2e-12   Rhinopithecus roxellana
gb|KFP20406.1|  Conserved oligomeric Golgi complex subunit 2          76.6    2e-12   Egretta garzetta
ref|XP_002809356.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    2e-12   
ref|XP_009642480.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    2e-12   Egretta garzetta
ref|XP_009280091.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    2e-12   Aptenodytes forsteri
ref|XP_005539862.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   Macaca fascicularis [crab eating macaque]
ref|XP_003893831.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   Papio anubis [baboon]
gb|KFM09209.1|  Conserved oligomeric Golgi complex subunit 2          76.3    2e-12   Aptenodytes forsteri
ref|XP_005539859.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   Macaca fascicularis [crab eating macaque]
ref|XP_005539861.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   
ref|XP_002808309.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  76.3    2e-12   Macaca mulatta [rhesus macaque]
ref|XP_002158309.2|  PREDICTED: conserved oligomeric Golgi comple...  76.3    2e-12   
ref|XP_004088075.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12   
ref|XP_003267296.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_009499491.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    2e-12   Phalacrocorax carbo [common cormorant]
gb|KFW89140.1|  Conserved oligomeric Golgi complex subunit 2          75.9    3e-12   Phalacrocorax carbo [common cormorant]
ref|XP_009327513.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    3e-12   Pygoscelis adeliae
gb|KFW70739.1|  Conserved oligomeric Golgi complex subunit 2          75.9    3e-12   Pygoscelis adeliae
ref|XP_007662934.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    3e-12   
ref|XP_010137889.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    3e-12   Buceros rhinoceros silvestris
ref|XP_010705329.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   Meleagris gallopavo [common turkey]
ref|XP_010192959.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   Mesitornis unicolor
gb|KFO15367.1|  Conserved oligomeric Golgi complex subunit 2          75.5    3e-12   Balearica regulorum gibbericeps
ref|XP_010192960.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   Mesitornis unicolor
ref|XP_010309769.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    3e-12   Balearica regulorum gibbericeps
ref|XP_005106374.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    4e-12   
ref|XP_005715264.1|  unnamed protein product                          75.5    4e-12   Chondrus crispus [carageen]
dbj|BAH13668.1|  unnamed protein product                              74.7    4e-12   Homo sapiens [man]
ref|XP_794127.3|  PREDICTED: conserved oligomeric Golgi complex s...  75.5    4e-12   Strongylocentrotus purpuratus [purple urchin]
gb|KDD75489.1|  hypothetical protein H632_c659p0                      71.6    4e-12   Helicosporidium sp. ATCC 50920
ref|XP_005706755.1|  oligomeric Golgi complex component COG2-like...  75.1    5e-12   Galdieria sulphuraria
ref|XP_005148648.1|  PREDICTED: conserved oligomeric Golgi comple...  75.1    5e-12   Melopsittacus undulatus
ref|XP_005148647.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    5e-12   Melopsittacus undulatus
dbj|BAH13805.1|  unnamed protein product                              74.7    6e-12   Homo sapiens [man]
ref|XP_004028612.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    6e-12   
dbj|BAH12018.1|  unnamed protein product                              74.7    6e-12   Homo sapiens [man]
ref|XP_004028611.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    6e-12   
ref|XP_007127671.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    6e-12   
ref|NP_031383.1|  conserved oligomeric Golgi complex subunit 2 is...  74.7    6e-12   Homo sapiens [man]
ref|XP_004310291.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    7e-12   
ref|NP_001138508.1|  conserved oligomeric Golgi complex subunit 2...  74.7    7e-12   Homo sapiens [man]
ref|XP_009904610.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    7e-12   Picoides pubescens
ref|XP_004935547.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    8e-12   Gallus gallus [bantam]
ref|XP_001964533.1|  GF23234                                          74.3    8e-12   Drosophila ananassae
gb|KFV73661.1|  Conserved oligomeric Golgi complex subunit 2          74.3    9e-12   Struthio camelus australis
ref|XP_004935546.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    9e-12   
ref|XP_419583.2|  PREDICTED: conserved oligomeric Golgi complex s...  74.3    9e-12   Gallus gallus [bantam]
ref|XP_001148147.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    9e-12   Pan troglodytes
ref|XP_009439912.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    1e-11   Pan troglodytes
ref|XP_005508688.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    1e-11   
ref|XP_005508687.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    1e-11   Columba livia [carrier pigeon]
ref|XP_009679359.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    1e-11   Struthio camelus australis
ref|XP_004281614.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    1e-11   Orcinus orca [Orca]
ref|XP_006937851.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   Felis catus [cat]
ref|XP_003473537.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
ref|XP_010233328.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  72.0    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_007450662.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   Lipotes vexillifer [baiji]
ref|XP_007450661.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   Lipotes vexillifer [baiji]
ref|XP_005005280.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   
ref|XP_003993981.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   Felis catus [cat]
gb|KFV07773.1|  Conserved oligomeric Golgi complex subunit 2          73.6    1e-11   Pterocles gutturalis
ref|XP_010072831.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    1e-11   Pterocles gutturalis
ref|XP_005005281.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11   
ref|XP_003410940.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11   Loxodonta africana [African bush elephant]
ref|XP_005405048.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11   Chinchilla lanigera
ref|XP_005405049.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11   
ref|XP_007086077.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11   Panthera tigris altaica
ref|XP_007173850.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   
ref|XP_007936688.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11   Orycteropus afer afer
ref|XP_008944103.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11   Merops nubicus
gb|KFQ34940.1|  Conserved oligomeric Golgi complex subunit 2          73.2    2e-11   Merops nubicus
ref|XP_009055731.1|  hypothetical protein LOTGIDRAFT_232605           73.2    2e-11   Lottia gigantea
ref|XP_004640874.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   Octodon degus
ref|XP_004640875.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    2e-11   Octodon degus
ref|XP_003940815.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    3e-11   Saimiri boliviensis boliviensis
ref|XP_007535190.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    3e-11   Erinaceus europaeus [common hedgehog]
ref|XP_007535189.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    3e-11   Erinaceus europaeus [common hedgehog]
ref|XP_006267974.1|  PREDICTED: conserved oligomeric Golgi comple...  72.8    3e-11   Alligator mississippiensis
ref|XP_007173849.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    3e-11   Balaenoptera acutorostrata scammoni
ref|XP_004372879.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    3e-11   Trichechus manatus latirostris
ref|XP_006017037.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    3e-11   Alligator sinensis
ref|XP_004350660.1|  oligomeric Golgi complex component               72.4    3e-11   Cavenderia fasciculata
ref|XP_008319765.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    3e-11   
ref|XP_006017038.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    3e-11   
ref|XP_005958561.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005958562.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   Pantholops hodgsonii [Tibetan antelope]
ref|XP_010620223.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    4e-11   Fukomys damarensis [Damara mole rat]
ref|XP_011379200.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    5e-11   
ref|XP_004776056.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    5e-11   Mustela putorius furo [black ferret]
ref|XP_004776055.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    5e-11   Mustela putorius furo [black ferret]
ref|XP_004776057.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    5e-11   Mustela putorius furo [black ferret]
ref|XP_005699448.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  72.0    5e-11   
gb|KFO34216.1|  Conserved oligomeric Golgi complex subunit 2          72.0    6e-11   Fukomys damarensis [Damara mole rat]
ref|XP_002760957.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    6e-11   Callithrix jacchus [common marmoset]
ref|XP_004819666.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  71.6    6e-11   
ref|XP_008984063.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    6e-11   Callithrix jacchus [common marmoset]
ref|XP_006065100.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    7e-11   Bubalus bubalis [domestic water buffalo]
ref|XP_004021628.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  71.2    7e-11   
ref|XP_006065101.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    7e-11   Bubalus bubalis [domestic water buffalo]
ref|XP_010114383.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    7e-11   Chlamydotis macqueenii
gb|KFP39907.1|  Conserved oligomeric Golgi complex subunit 2          70.9    7e-11   Chlamydotis macqueenii
ref|XP_006065102.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    7e-11   
ref|XP_002717435.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    7e-11   
ref|XP_546096.2|  PREDICTED: conserved oligomeric Golgi complex s...  71.2    8e-11   
ref|XP_004426945.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    8e-11   
ref|XP_002178952.1|  predicted protein                                71.2    8e-11   
ref|XP_005602673.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    9e-11   
ref|XP_005602674.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    9e-11   
ref|XP_001924673.5|  PREDICTED: conserved oligomeric Golgi comple...  70.9    9e-11   
ref|XP_001497419.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    9e-11   
ref|XP_011431284.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    9e-11   
ref|XP_005657434.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    9e-11   
ref|XP_005657433.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    9e-11   
ref|XP_008589656.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10   
ref|XP_005657432.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10   
ref|XP_002927656.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10   
ref|XP_011233523.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10   
ref|XP_008687757.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10   
ref|XP_009984752.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10   
ref|XP_008687758.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10   
gb|KFV18179.1|  Conserved oligomeric Golgi complex subunit 2          70.9    1e-10   
ref|XP_001994381.1|  GH16862                                          70.9    1e-10   
ref|XP_003215919.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    1e-10   
ref|XP_006992872.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10   
ref|XP_008976421.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    1e-10   
ref|XP_008976422.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    1e-10   
ref|XP_004914700.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    1e-10   
ref|XP_003230176.2|  PREDICTED: conserved oligomeric Golgi comple...  70.5    1e-10   
ref|XP_002103324.1|  GD20356                                          68.9    1e-10   
ref|XP_002931527.2|  PREDICTED: conserved oligomeric Golgi comple...  70.5    1e-10   
ref|XP_002069920.1|  GK11309                                          70.5    1e-10   
ref|XP_007071120.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    2e-10   
ref|XP_640854.1|  oligomeric Golgi complex component                  70.1    2e-10   
ref|XP_008072546.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    2e-10   
dbj|BAE42634.1|  unnamed protein product                              69.7    3e-10   
ref|NP_084022.2|  conserved oligomeric Golgi complex subunit 2        69.7    3e-10   
ref|XP_005291293.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10   
ref|XP_009490364.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10   
ref|XP_006920806.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10   
gb|KFQ57781.1|  Conserved oligomeric Golgi complex subunit 2          69.7    3e-10   
ref|XP_010219183.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10   
gb|EDL11770.1|  component of oligomeric golgi complex 2               69.7    3e-10   
gb|KGL81598.1|  Conserved oligomeric Golgi complex subunit 2          69.3    3e-10   
ref|XP_006146049.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    3e-10   
ref|XP_009811854.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    3e-10   
gb|KFV39876.1|  Conserved oligomeric Golgi complex subunit 2          69.3    3e-10   
gb|AAI04600.1|  COG2 protein                                          68.6    4e-10   
ref|XP_001980050.1|  GG20618                                          69.3    4e-10   
gb|AAH11435.1|  Component of oligomeric golgi complex 2               68.9    4e-10   
ref|XP_006183788.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    4e-10   
ref|XP_010996258.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    4e-10   
ref|XP_010961140.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10   
ref|XP_001369328.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10   
ref|XP_002097746.1|  GE26383                                          68.9    5e-10   
ref|NP_001103964.1|  conserved oligomeric Golgi complex subunit 2     68.6    5e-10   
ref|XP_006888781.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    5e-10   
ref|XP_004712259.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    5e-10   
ref|XP_010819003.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|XP_010852808.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|XP_010852807.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|XP_010819005.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
gb|ELR48452.1|  Conserved oligomeric Golgi complex subunit 2          68.6    6e-10   
ref|XP_006122076.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|XP_005226619.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|XP_005226618.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|XP_005906657.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|NP_001070307.2|  conserved oligomeric Golgi complex subunit 2     68.6    6e-10   
ref|XP_010852806.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|XP_004404911.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    6e-10   
ref|XP_010852805.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    7e-10   
ref|XP_002055957.1|  GJ10669                                          68.2    7e-10   
gb|EXX78374.1|  hypothetical protein RirG_015560                      68.2    7e-10   
ref|NP_524366.1|  ldlCp-related protein                               68.2    7e-10   
ref|XP_004456682.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    8e-10   
gb|AAL48584.1|  RE06205p                                              68.2    8e-10   
ref|XP_010741537.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    8e-10   
ref|XP_005320438.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    8e-10   
ref|XP_005766897.1|  component of oligomeric golgi complex 2          67.4    9e-10   
ref|XP_003791030.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09   
ref|XP_005064728.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09   
ref|XP_001695227.1|  component of oligomeric golgi complex 2          67.4    1e-09   
ref|XP_002294970.1|  predicted protein                                67.4    1e-09   
ref|XP_004659682.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09   
gb|EJK77627.1|  hypothetical protein THAOC_00531                      67.0    2e-09   
ref|XP_004690717.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    2e-09   
gb|EFA78448.1|  oligomeric Golgi complex component                    66.6    3e-09   
ref|XP_007903668.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09   
ref|XP_006212446.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  66.6    3e-09   
ref|XP_003767876.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    3e-09   
ref|XP_002031072.1|  GM25778                                          66.2    3e-09   
ref|XP_001357922.2|  GA19413                                          66.2    4e-09   
ref|XP_005474316.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    4e-09   
ref|XP_002020009.1|  GL13754                                          65.9    4e-09   
ref|XP_003438334.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    4e-09   
ref|XP_007256131.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    4e-09   
ref|XP_005345929.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    5e-09   
gb|AAD31443.1|  ldlCp-related protein                                 65.5    6e-09   
emb|CDS10439.1|  hypothetical protein LRAMOSA03115                    65.5    6e-09   
ref|NP_998519.1|  conserved oligomeric Golgi complex subunit 2        65.5    6e-09   
ref|XP_006874232.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    7e-09   
ref|XP_007423723.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    7e-09   
ref|XP_007423722.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    7e-09   
gb|KIL66239.1|  hypothetical protein M378DRAFT_75546                  65.5    7e-09   
ref|XP_004578933.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  65.1    8e-09   
ref|XP_008427500.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    9e-09   
ref|XP_005727466.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08   
ref|XP_008427499.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08   
ref|XP_007545451.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08   
ref|XP_004551557.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08   
ref|XP_005812226.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08   
ref|XP_005727467.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08   
gb|KIJ67824.1|  hypothetical protein HYDPIDRAFT_37422                 64.7    1e-08   
ref|XP_010787277.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08   
ref|XP_005994007.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08   
gb|ETE65446.1|  Conserved oligomeric Golgi complex subunit 2          64.3    1e-08   
ref|XP_005994005.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08   
ref|XP_006783764.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08   
ref|XP_005914260.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    1e-08   
ref|XP_004342492.2|  hypothetical protein CAOG_08237                  64.3    1e-08   
ref|XP_008289216.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08   
ref|XP_005856448.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08   
gb|AFW66982.1|  hypothetical protein ZEAMMB73_946461                  58.5    2e-08   
ref|XP_002402131.1|  conserved oligomeric golgi complex subunit, ...  62.8    4e-08   
ref|XP_006106578.1|  PREDICTED: conserved oligomeric Golgi comple...  62.8    4e-08   
ref|XP_007266642.1|  COG complex component                            62.4    6e-08   
ref|XP_005181173.2|  PREDICTED: conserved oligomeric Golgi comple...  62.4    6e-08   
ref|XP_003608845.1|  Conserved oligomeric Golgi complex subunit       62.0    8e-08   
gb|KIJ18679.1|  hypothetical protein PAXINDRAFT_71226                 62.0    9e-08   
gb|KIK67348.1|  hypothetical protein GYMLUDRAFT_37448                 62.0    1e-07   
gb|EFB20161.1|  hypothetical protein PANDA_017452                     61.6    1e-07   
ref|XP_006678760.1|  hypothetical protein BATDEDRAFT_88024            61.6    1e-07   
ref|XP_008875716.1|  hypothetical protein H310_10978                  61.6    1e-07   
ref|XP_011194794.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07   
ref|XP_003963810.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    1e-07   
ref|XP_008148073.1|  PREDICTED: conserved oligomeric Golgi comple...  60.8    1e-07   
ref|XP_008844006.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07   
ref|XP_002001325.1|  GI10726                                          60.8    2e-07   
gb|KIY46789.1|  COG complex component                                 60.8    2e-07   
gb|KFB36169.1|  AGAP003824-PA-like protein                            60.5    2e-07   
emb|CDH54964.1|  conserved oligomeric golgi complex subunit 2         60.5    2e-07   
ref|XP_006638516.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    3e-07   
emb|CDH54965.1|  conserved oligomeric golgi complex subunit 2         60.5    3e-07   
ref|XP_001640558.1|  predicted protein                                60.1    3e-07   
gb|EGW03359.1|  Conserved oligomeric Golgi complex subunit 2          57.8    4e-07   
ref|XP_011204482.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    4e-07   
gb|EWM27738.1|  component of oligomeric golgi complex 2               59.7    5e-07   
gb|ETN62215.1|  brefeldin A-sensitive peripheral golgi family pro...  59.7    5e-07   
gb|EPY81957.1|  hypothetical protein CB1_000692029                    58.9    5e-07   
ref|XP_004523208.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    7e-07   
ref|XP_006255878.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    7e-07   
ref|XP_006757736.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    8e-07   
gb|ELK34853.1|  Conserved oligomeric Golgi complex subunit 2          58.9    9e-07   
gb|KIK99406.1|  hypothetical protein PAXRUDRAFT_822754                58.9    9e-07   
ref|XP_006461130.1|  hypothetical protein AGABI2DRAFT_68876           58.5    1e-06   
gb|KDQ21263.1|  hypothetical protein BOTBODRAFT_197088                58.2    1e-06   
ref|XP_008605823.1|  hypothetical protein SDRG_02041                  58.2    1e-06   
gb|EGN99740.1|  hypothetical protein SERLA73DRAFT_72536               58.2    1e-06   
gb|EMP25136.1|  Conserved oligomeric Golgi complex subunit 2          58.2    1e-06   
emb|CDQ63736.1|  unnamed protein product                              58.2    2e-06   
gb|KIM69744.1|  hypothetical protein SCLCIDRAFT_19532                 58.2    2e-06   
emb|CCA15671.1|  conserved oligomeric Golgi complex subunit putative  58.2    2e-06   
ref|XP_007317427.1|  hypothetical protein SERLADRAFT_348146           57.8    2e-06   
gb|EJU04373.1|  COG complex component                                 57.8    2e-06   
ref|XP_007327986.1|  hypothetical protein AGABI1DRAFT_36770           57.4    2e-06   
ref|XP_010887016.1|  PREDICTED: conserved oligomeric Golgi comple...  57.4    2e-06   
ref|XP_003496865.1|  PREDICTED: conserved oligomeric Golgi comple...  57.0    3e-06   
gb|ERE80256.1|  conserved oligomeric Golgi complex subunit 2          57.0    3e-06   
gb|EGU12634.1|  hypothetical protein RTG_01184                        56.6    5e-06   
ref|XP_007864372.1|  hypothetical protein GLOTRDRAFT_137615           56.6    6e-06   
ref|XP_004619081.1|  PREDICTED: conserved oligomeric Golgi comple...  56.2    7e-06   
ref|XP_009025253.1|  hypothetical protein HELRODRAFT_95171            56.2    7e-06   
gb|KFM64146.1|  Conserved oligomeric Golgi complex subunit 2          55.8    8e-06   
ref|XP_007767118.1|  hypothetical protein CONPUDRAFT_164289           53.1    1e-05   
gb|KDO16977.1|  hypothetical protein SPRG_17579                       55.1    2e-05   
ref|XP_011401872.1|  Conserved oligomeric Golgi complex subunit 2     55.1    2e-05   
ref|XP_007767120.1|  COG complex component                            54.3    3e-05   
ref|XP_002113217.1|  hypothetical protein TRIADDRAFT_26404            54.3    3e-05   
ref|NP_001133098.1|  conserved oligomeric Golgi complex subunit 2     54.3    3e-05   
gb|EHJ70342.1|  putative brefeldin A-sensitive peripheral Golgi p...  53.9    4e-05   
emb|CCI39672.1|  unnamed protein product                              53.9    4e-05   
emb|CCI39666.1|  unnamed protein product                              53.9    4e-05   
emb|CCI39669.1|  unnamed protein product                              53.9    4e-05   
emb|CCI39667.1|  unnamed protein product                              53.9    4e-05   
emb|CCI39668.1|  unnamed protein product                              53.9    4e-05   
emb|CCI39671.1|  unnamed protein product                              53.9    4e-05   
emb|CCI39670.1|  unnamed protein product                              53.9    4e-05   
ref|XP_011505049.1|  PREDICTED: conserved oligomeric Golgi comple...  53.1    7e-05   
ref|XP_009547465.1|  hypothetical protein HETIRDRAFT_154913           53.1    7e-05   
gb|KIK01394.1|  hypothetical protein K443DRAFT_98669                  53.1    8e-05   
ref|XP_010926721.1|  PREDICTED: conserved oligomeric Golgi comple...  52.8    9e-05   
dbj|BAC40996.1|  unnamed protein product                              52.8    1e-04   
gb|KDO27791.1|  hypothetical protein SPRG_07390                       52.8    1e-04   
gb|KFH11611.1|  putative oligomeric subunit 2                         50.8    1e-04   
dbj|GAM21364.1|  hypothetical protein SAMD00019534_045390             52.4    1e-04   
gb|EMS25870.1|  component of oligomeric golgi complex 2               52.4    1e-04   
emb|CCC95633.1|  unnamed protein product                              52.4    1e-04   
dbj|GAN06528.1|  conserved oligomeric Golgi complex subunit 2         52.4    1e-04   
gb|KDR75857.1|  hypothetical protein GALMADRAFT_248589                52.4    2e-04   
gb|AAH91434.1|  Unknown (protein for MGC:109642)                      50.1    2e-04   
gb|ESA09317.1|  hypothetical protein GLOINDRAFT_97863                 51.6    2e-04   
emb|CCW70021.1|  unnamed protein product                              51.6    2e-04   
ref|XP_008551454.1|  PREDICTED: conserved oligomeric Golgi comple...  51.6    3e-04   
gb|KIM75524.1|  hypothetical protein PILCRDRAFT_827237                51.6    3e-04   
ref|XP_003029812.1|  hypothetical protein SCHCODRAFT_69641            51.2    3e-04   
ref|XP_003883653.1|  conserved hypothetical protein                   51.2    4e-04   
ref|XP_007308237.1|  COG complex component                            50.8    4e-04   
emb|CCL98683.1|  predicted protein                                    50.4    6e-04   
gb|KDR16768.1|  Conserved oligomeric Golgi complex subunit 2          50.4    7e-04   
ref|XP_007381453.1|  COG complex component                            50.1    7e-04   
gb|KFG64017.1|  hypothetical protein TGRUB_273580                     50.4    7e-04   
gb|KFH17102.1|  hypothetical protein TGMAS_273580                     50.4    7e-04   
gb|KFG51625.1|  hypothetical protein TGP89_273580                     50.1    8e-04   
gb|EPR64541.1|  hypothetical protein TGGT1_273580                     50.1    8e-04   
gb|KIK47123.1|  hypothetical protein CY34DRAFT_74560                  50.1    9e-04   
ref|XP_005833841.1|  component of oligomeric golgi complex 2          50.1    0.001   
gb|KDQ28122.1|  hypothetical protein PLEOSDRAFT_44979                 49.7    0.001   



>gb|EYU23123.1| hypothetical protein MIMGU_mgv1a001829mg [Erythranthe guttata]
Length=753

 Score =   268 bits (685),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVS VLRPLK FL+ E+A TYLTK+LR EL+ GAAF+IT RYY
Sbjct  603  TATYRMTNKPLPVRHSPYVSAVLRPLKAFLEAEQAATYLTKDLRKELVHGAAFEITRRYY  662

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA+DLV+VARKTESSLQKIRLGAQRRAGASSDVSDHN+SDTDKICMQL LDIQEY RNL
Sbjct  663  ELASDLVSVARKTESSLQKIRLGAQRRAGASSDVSDHNVSDTDKICMQLLLDIQEYGRNL  722

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            +SLG+DAA IP+YRSLWQCVAP+++QN IS 
Sbjct  723  ASLGVDAADIPTYRSLWQCVAPSDKQNTISF  753



>ref|XP_011083848.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Sesamum 
indicum]
Length=757

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVS VLRPLK FLDGERA TYLT ELR EL+Q AA +IT RYY
Sbjct  607  TATYRMTNKPLPVRHSPYVSSVLRPLKAFLDGERAATYLTSELRKELVQSAANEITRRYY  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQKIRLGAQRRAGA+SDVSD N+SDTDK+CMQLFLDIQEY RNL
Sbjct  667  ELAADLVSVARKTESSLQKIRLGAQRRAGATSDVSDQNVSDTDKMCMQLFLDIQEYGRNL  726

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            +SLG+DAA IP+YRSLWQCVAP++RQN IS 
Sbjct  727  ASLGVDAADIPAYRSLWQCVAPSDRQNSISF  757



>ref|XP_009602477.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nicotiana 
tomentosiformis]
Length=751

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLK FLDGERA T LT E+R ELLQGAA +IT RY 
Sbjct  601  TATYRMTNKPLPVRHSPYVSGVLRPLKEFLDGERAATCLTNEIRNELLQGAALEITGRYN  660

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA DLVN++R+TESSLQK+RLGAQRRAGASSDVSD N+SDTDKICMQLFLDIQEYAR+L
Sbjct  661  ELATDLVNMSRRTESSLQKLRLGAQRRAGASSDVSDQNLSDTDKICMQLFLDIQEYARSL  720

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            SSLG+DAA+IP YRSLWQCVAP ERQN ++ 
Sbjct  721  SSLGVDAASIPPYRSLWQCVAPAERQNSLTF  751



>ref|XP_007023396.1| Golgi organization, COG2 isoform 1 [Theobroma cacao]
 gb|EOY26018.1| Golgi organization, COG2 isoform 1 [Theobroma cacao]
Length=754

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPLKTFLDGERATTYLT   R +LL GAA +IT RYY
Sbjct  604  TATYRMTNKPLPVRHSPYVAGVLRPLKTFLDGERATTYLTNAARNDLLLGAATEITGRYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQ+IR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY RNL
Sbjct  664  ELAADLVSVARKTESSLQRIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRNL  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+DAA I +YRSLWQCVAP +RQ++I+ 
Sbjct  724  ATLGVDAANITAYRSLWQCVAPADRQSVINF  754



>emb|CDP04651.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLP RHSPYVSGVLRP+KTFL+GERAT YLT+ ++ +LLQ  AF+IT  Y 
Sbjct  613  TATYRMTNKPLPTRHSPYVSGVLRPIKTFLEGERATAYLTEHIKNDLLQRTAFEITGHYN  672

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA DLV VARKTESSLQKIRLGAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY RNL
Sbjct  673  ELATDLVTVARKTESSLQKIRLGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRNL  732

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            +SLG++AA IP+YRSLWQCVAP +RQN IS 
Sbjct  733  ASLGVEAANIPAYRSLWQCVAPPDRQNSISF  763



>ref|XP_007155537.1| hypothetical protein PHAVU_003G210200g [Phaseolus vulgaris]
 gb|ESW27531.1| hypothetical protein PHAVU_003G210200g [Phaseolus vulgaris]
Length=755

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLK FLDGERAT YL  + R E+L  AA +ITDRYY
Sbjct  605  TATYRMTNKPLPVRHSPYVSGVLRPLKAFLDGERATRYLASDTRNEILLSAATEITDRYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQKIR  AQRRAGASSD+SD+N+SDTDKICMQLFLDIQEYARNL
Sbjct  665  ELAADLVSVARKTESSLQKIRQSAQRRAGASSDISDNNVSDTDKICMQLFLDIQEYARNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++AA I SYRSLWQCVAP +RQN I+L
Sbjct  725  SALGVEAANIASYRSLWQCVAPADRQNTINL  755



>ref|XP_009769044.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nicotiana 
sylvestris]
Length=751

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLK FLDGERATT LT E+R ELLQ AA +IT  Y 
Sbjct  601  TATYRMTNKPLPVRHSPYVSGVLRPLKEFLDGERATTCLTNEIRNELLQAAALEITGCYN  660

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA D+VN++R+TESSLQK+RLGAQRRAGASSDVSD N+SDTDKICMQLFLDIQEYAR+L
Sbjct  661  ELATDIVNMSRRTESSLQKLRLGAQRRAGASSDVSDQNLSDTDKICMQLFLDIQEYARSL  720

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            SSLG++AA+IP YRSLWQCVAP ERQN ++ 
Sbjct  721  SSLGVNAASIPPYRSLWQCVAPAERQNSLTF  751



>gb|KHN14099.1| Conserved oligomeric Golgi complex subunit 2 [Glycine soja]
Length=658

 Score =   255 bits (652),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPY+SGVLRPLK FL GERAT YL  E R E+L  AA +ITDRYY
Sbjct  508  TATYRMTNKPLPVRHSPYISGVLRPLKAFLGGERATRYLVSETRNEILLCAATEITDRYY  567

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQKIR  AQRRAGASSD+ D+N+SDTDKICMQLFLDIQEYARNL
Sbjct  568  ELAADLVSVARKTESSLQKIRQSAQRRAGASSDILDNNVSDTDKICMQLFLDIQEYARNL  627

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++AA I SYRSLWQCVAP +RQN I+L
Sbjct  628  SALGVEAANIASYRSLWQCVAPADRQNTINL  658



>ref|XP_004170101.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cucumis sativus]
Length=231

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSG+LRPLK  LDG+RA+T+LT E R  LL  A  +IT RYY
Sbjct  81   TATYRMTNKPLPVRHSPYVSGLLRPLKAILDGDRASTFLTTETRTALLTDAVTEITSRYY  140

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E AADLV++ARKT+SSLQKIR G QRRAGASSDVSDHNISDTDKICMQLFLDIQEY RNL
Sbjct  141  EQAADLVSLARKTDSSLQKIRQGVQRRAGASSDVSDHNISDTDKICMQLFLDIQEYGRNL  200

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++AA+IP+YRS W  VAP+++Q+ IS 
Sbjct  201  SALGVEAASIPTYRSFWHLVAPSDKQSSISF  231



>gb|KDO52633.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
 gb|KDO52634.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=432

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLKT L+GERA TYLT E + ELL  AA +IT RY+
Sbjct  282  TATYRMTNKPLPVRHSPYVSGVLRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYH  341

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+L++VARKTESSL KIR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY R+L
Sbjct  342  ELAAELISVARKTESSLLKIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRSL  401

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            ++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  402  AALGVQAADIPPYRSLWQCVAPSDRQSLI  430



>ref|XP_004244508.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Solanum 
lycopersicum]
Length=742

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLK FL+GERA T L  E R ELLQGAA +IT RYY
Sbjct  592  TATYRMTNKPLPVRHSPYVSGVLRPLKEFLEGERAATCLNNETRNELLQGAALEITQRYY  651

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +L ++LVN++R+TESSLQK+RLGAQRRAGASSDVSDHN+S+TDKICMQLFLDIQEYAR+L
Sbjct  652  DLTSELVNMSRRTESSLQKLRLGAQRRAGASSDVSDHNLSETDKICMQLFLDIQEYARSL  711

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S LG+DAA+IP Y+SLWQCVAP ER+N IS 
Sbjct  712  SLLGVDAASIPPYQSLWQCVAPAERKNTISF  742



>ref|XP_006477014.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Citrus sinensis]
Length=757

 Score =   254 bits (650),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLKT L+GERA TYLT E + ELL GAA +IT RY+
Sbjct  607  TATYRMTNKPLPVRHSPYVSGVLRPLKTLLEGERAMTYLTPEAKNELLLGAATQITSRYH  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+L++VARKTESSL KIR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY RNL
Sbjct  667  ELAAELISVARKTESSLLKIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRNL  726

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            ++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  727  AALGVQAADIPPYRSLWQCVAPSDRQSLI  755



>ref|XP_006357074.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Solanum tuberosum]
Length=742

 Score =   254 bits (649),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLK FL+GERA T LT E R ELLQGAA +IT RY 
Sbjct  592  TATYRMTNKPLPVRHSPYVSGVLRPLKEFLEGERAATCLTNETRNELLQGAALEITHRYN  651

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +L ++LVN++R+TESSLQK+RLGAQRRAGASSDVSDHN+S+TDKICMQLFLDIQEYAR+L
Sbjct  652  DLTSELVNMSRRTESSLQKLRLGAQRRAGASSDVSDHNLSETDKICMQLFLDIQEYARSL  711

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S LG+DAA+IP Y+SLWQCVAP ER+N IS 
Sbjct  712  SLLGVDAASIPPYQSLWQCVAPAERKNTISF  742



>gb|EYU23122.1| hypothetical protein MIMGU_mgv1a024704mg [Erythranthe guttata]
Length=739

 Score =   254 bits (649),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            ATYR+TNKPLPVRHSPYVS VLRPLK FL+ E+A TYLTKELR EL+ GAAF+IT RYYE
Sbjct  590  ATYRITNKPLPVRHSPYVSAVLRPLKAFLEAEQAATYLTKELRKELVHGAAFEITRRYYE  649

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
            LA+D+V+ ARK ESSLQK+RLGAQRR GASSDV+DHN+S+TDKICMQL LDIQEY RNL+
Sbjct  650  LASDIVSAARKMESSLQKMRLGAQRRGGASSDVTDHNVSETDKICMQLLLDIQEYGRNLA  709

Query  320  SLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            SLG+DAA IP+YRSLWQCVAP ++QN IS 
Sbjct  710  SLGVDAADIPTYRSLWQCVAPPDKQNTISF  739



>ref|XP_003549849.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Glycine max]
Length=755

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPY+SGVLRPLK FL GERAT YL  E R E+L  AA +ITDRYY
Sbjct  605  TATYRMTNKPLPVRHSPYISGVLRPLKAFLGGERATRYLVSETRNEILLCAATEITDRYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQKIR  AQRRAGASSD+ D+N+SDTDKICMQLFLDIQEYARNL
Sbjct  665  ELAADLVSVARKTESSLQKIRQSAQRRAGASSDILDNNVSDTDKICMQLFLDIQEYARNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++AA I SYRSLWQCVAP +RQN I+L
Sbjct  725  SALGVEAANIASYRSLWQCVAPADRQNTINL  755



>gb|KDO52632.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=527

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLKT L+GERA TYLT E + ELL  AA +IT RY+
Sbjct  377  TATYRMTNKPLPVRHSPYVSGVLRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYH  436

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+L++VARKTESSL KIR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY R+L
Sbjct  437  ELAAELISVARKTESSLLKIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRSL  496

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            ++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  497  AALGVQAADIPPYRSLWQCVAPSDRQSLI  525



>gb|KDO52631.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=558

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLKT L+GERA TYLT E + ELL  AA +IT RY+
Sbjct  408  TATYRMTNKPLPVRHSPYVSGVLRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYH  467

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+L++VARKTESSL KIR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY R+L
Sbjct  468  ELAAELISVARKTESSLLKIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRSL  527

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            ++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  528  AALGVQAADIPPYRSLWQCVAPSDRQSLI  556



>gb|KHN34411.1| Conserved oligomeric Golgi complex subunit 2 [Glycine soja]
Length=735

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVR SPYVSGVLRPLK FLDGERAT YL  E+R ++L  AA +ITDRYY
Sbjct  585  TATYRMTNKPLPVRPSPYVSGVLRPLKAFLDGERATRYLASEIRNKILLCAATEITDRYY  644

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA+DLV+VARKTESSLQKIR  AQRRAGASSD+SD+N+SDTDKICMQLFLDIQEYARNL
Sbjct  645  ELASDLVSVARKTESSLQKIRQSAQRRAGASSDISDNNVSDTDKICMQLFLDIQEYARNL  704

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++A  I SYRSLWQCVAP +RQN I+L
Sbjct  705  SALGVEAVNIASYRSLWQCVAPADRQNTINL  735



>ref|XP_003525701.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Glycine max]
Length=755

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVR SPYVSGVLRPLK FLDGERAT YL  E+R ++L  AA +ITDRYY
Sbjct  605  TATYRMTNKPLPVRPSPYVSGVLRPLKAFLDGERATRYLASEIRNKILLCAATEITDRYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA+DLV+VARKTESSLQKIR  AQRRAGASSD+SD+N+SDTDKICMQLFLDIQEYARNL
Sbjct  665  ELASDLVSVARKTESSLQKIRQSAQRRAGASSDISDNNVSDTDKICMQLFLDIQEYARNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++A  I SYRSLWQCVAP +RQN I+L
Sbjct  725  SALGVEAVNIASYRSLWQCVAPADRQNTINL  755



>gb|KHG07418.1| Conserved oligomeric Golgi complex subunit 2 [Gossypium arboreum]
Length=754

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPLKTFLDGE+AT YLT + R  LL GAA  IT RYY
Sbjct  604  TATYRMTNKPLPVRHSPYVAGVLRPLKTFLDGEQATKYLTNDARNNLLLGAATDITIRYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQ+IR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY RNL
Sbjct  664  ELAADLVSVARKTESSLQRIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRNL  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            + LG++AA I +YRSLWQCVAP +RQ+ I  
Sbjct  724  AVLGVEAADIDAYRSLWQCVAPADRQDEIKF  754



>ref|XP_010026586.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW83168.1| hypothetical protein EUGRSUZ_B00121 [Eucalyptus grandis]
Length=760

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPLKTFL+GERA  YLT ++R  LL  AA ++T RY 
Sbjct  610  TATYRMTNKPLPVRHSPYVAGVLRPLKTFLEGERANAYLTTDVRNALLLSAATEVTGRYN  669

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA+DLVNVARKTESSLQ+IR GAQRRAGASSDVS+ N+SDTDKICMQLFLDIQEY RNL
Sbjct  670  ELASDLVNVARKTESSLQRIRQGAQRRAGASSDVSEQNVSDTDKICMQLFLDIQEYGRNL  729

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S LG++AA IP+YRSLWQCVAP +RQN+IS 
Sbjct  730  SVLGVEAADIPAYRSLWQCVAPPDRQNVISF  760



>ref|XP_010026579.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Eucalyptus grandis]
Length=776

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPLKTFL+GERA  YLT ++R  LL  AA ++T RY 
Sbjct  626  TATYRMTNKPLPVRHSPYVAGVLRPLKTFLEGERANAYLTTDVRNALLLSAATEVTGRYN  685

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA+DLVNVARKTESSLQ+IR GAQRRAGASSDVS+ N+SDTDKICMQLFLDIQEY RNL
Sbjct  686  ELASDLVNVARKTESSLQRIRQGAQRRAGASSDVSEQNVSDTDKICMQLFLDIQEYGRNL  745

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S LG++AA IP+YRSLWQCVAP +RQN+IS 
Sbjct  746  SVLGVEAADIPAYRSLWQCVAPPDRQNVISF  776



>ref|XP_010250762.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nelumbo 
nucifera]
Length=747

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLP+RHSPYVSG+L PLKTFLDGERATTYLT E + +LL GAA +IT RYY
Sbjct  597  TATYRMTNKPLPIRHSPYVSGILYPLKTFLDGERATTYLTMEAKNKLLLGAAEEITGRYY  656

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            EL +++VNVARKTESSLQ+IR GAQRRAGASSDVS+ N+SDTDKICMQLFLD+QEY RNL
Sbjct  657  ELTSEVVNVARKTESSLQRIRQGAQRRAGASSDVSEQNVSDTDKICMQLFLDVQEYGRNL  716

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+ A  IP+YRSLWQCVAP++RQN I  
Sbjct  717  SALGVVATNIPTYRSLWQCVAPSDRQNTIEF  747



>ref|XP_004515820.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cicer arietinum]
Length=755

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLK FLDGER + YL  E + E+L  AA +ITDRYY
Sbjct  605  TATYRMTNKPLPVRHSPYVSGVLRPLKAFLDGERTSRYLASETKNEILLCAATEITDRYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQKIR  AQRRAGASSD+SD+N+SDTDK+CMQLFLDIQEYARNL
Sbjct  665  ELAADLVSVARKTESSLQKIRQSAQRRAGASSDISDNNVSDTDKMCMQLFLDIQEYARNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++A  I SYRSLWQCVAP ++QN I+L
Sbjct  725  SALGVEAVNIASYRSLWQCVAPADKQNKINL  755



>ref|XP_002279916.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Vitis 
vinifera]
 emb|CBI15649.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMT+KPLPVRHSPYVSGVLRP++ FL GERA TYLT E+R ELL+GAAF IT  YY
Sbjct  601  TATYRMTHKPLPVRHSPYVSGVLRPVQAFLYGERAATYLTGEIRNELLRGAAFAITGHYY  660

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLVNVARKTESSLQ+IR GAQRRAGASSDV D+N+SDTDKICMQLFLDIQEY RNL
Sbjct  661  ELAADLVNVARKTESSLQRIRQGAQRRAGASSDVMDNNVSDTDKICMQLFLDIQEYGRNL  720

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+ A  IP+Y SLW+CVAP ++QN I++
Sbjct  721  SALGVKAVEIPAYCSLWRCVAPPDQQNAINV  751



>gb|KJB43171.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
Length=748

 Score =   249 bits (637),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPLKTFLDGE+AT YLT + R  LL GAA  IT RYY
Sbjct  598  TATYRMTNKPLPVRHSPYVAGVLRPLKTFLDGEQATKYLTNDARNSLLLGAATDITIRYY  657

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQ+IR GAQRRAGASSDV DHN+SDTDKICMQLFLDIQEY RNL
Sbjct  658  ELAADLVSVARKTESSLQRIRQGAQRRAGASSDVLDHNVSDTDKICMQLFLDIQEYGRNL  717

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            + LG++AA I +YRSLWQCVAP +RQ+ I
Sbjct  718  AVLGVEAADIDAYRSLWQCVAPADRQDEI  746



>gb|KJB43167.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43168.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43169.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43170.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
Length=754

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPLKTFLDGE+AT YLT + R  LL GAA  IT RYY
Sbjct  604  TATYRMTNKPLPVRHSPYVAGVLRPLKTFLDGEQATKYLTNDARNSLLLGAATDITIRYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQ+IR GAQRRAGASSDV DHN+SDTDKICMQLFLDIQEY RNL
Sbjct  664  ELAADLVSVARKTESSLQRIRQGAQRRAGASSDVLDHNVSDTDKICMQLFLDIQEYGRNL  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            + LG++AA I +YRSLWQCVAP +RQ+ I
Sbjct  724  AVLGVEAADIDAYRSLWQCVAPADRQDEI  752



>gb|KDO52630.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=757

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLKT L+GERA TYLT E + ELL  AA +IT RY+
Sbjct  607  TATYRMTNKPLPVRHSPYVSGVLRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYH  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+L++VARKTESSL KIR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY R+L
Sbjct  667  ELAAELISVARKTESSLLKIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRSL  726

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            ++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  727  AALGVQAADIPPYRSLWQCVAPSDRQSLI  755



>ref|XP_006440092.1| hypothetical protein CICLE_v10018979mg [Citrus clementina]
 gb|ESR53332.1| hypothetical protein CICLE_v10018979mg [Citrus clementina]
Length=757

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLKT L+GERA TYLT E + ELL  AA +IT RY+
Sbjct  607  TATYRMTNKPLPVRHSPYVSGVLRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYH  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+L++VARKTESSL KIR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY R+L
Sbjct  667  ELAAELISVARKTESSLLKIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRSL  726

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            ++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  727  AALGVQAADIPPYRSLWQCVAPSDRQSLI  755



>ref|XP_010536632.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tarenaya 
hassleriana]
 ref|XP_010536633.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tarenaya 
hassleriana]
Length=757

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLP RHSPYV+G+LRPLK FLDG++A+ YLT E R ELL G   +IT RYY
Sbjct  606  TATYRMTNKPLPTRHSPYVTGILRPLKAFLDGDKASNYLTPETRQELLLGTVTEITRRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            EL +DLVNVARKTESSLQ+IR GAQRRAGASSDVSDHNISDTDK+CMQLFLDIQEY RNL
Sbjct  666  ELTSDLVNVARKTESSLQRIRQGAQRRAGASSDVSDHNISDTDKMCMQLFLDIQEYGRNL  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQN  243
            +++G+ AA IP+YRSLWQCVAP +++N
Sbjct  726  AAVGVKAADIPAYRSLWQCVAPADKRN  752



>gb|KDO52629.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=756

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLKT L+GERA TYLT E + ELL  AA +IT RY+
Sbjct  607  TATYRMTNKPLPVRHSPYVSGVLRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYH  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+L++ ARKTESSL KIR GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQEY R+L
Sbjct  667  ELAAELIS-ARKTESSLLKIRQGAQRRAGASSDVSDHNVSDTDKICMQLFLDIQEYGRSL  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            ++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  726  AALGVQAADIPPYRSLWQCVAPSDRQSLI  754



>ref|XP_002511204.1| Conserved oligomeric Golgi complex component, putative [Ricinus 
communis]
 gb|EEF51806.1| Conserved oligomeric Golgi complex component, putative [Ricinus 
communis]
Length=756

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            +ATYRMTNKPLPVRHSPYVSGVL PLK FLDGERA TYLTKE R ELL GAA ++T RYY
Sbjct  606  SATYRMTNKPLPVRHSPYVSGVLHPLKAFLDGERAITYLTKETRKELLVGAATELTSRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+ V+VARKTE SL +IR GAQRR GASSDVSD +++++DKICMQLFLDIQEY R+L
Sbjct  666  ELAAETVSVARKTEVSLLRIRQGAQRRGGASSDVSDQSVTNSDKICMQLFLDIQEYGRSL  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG++AA IP+Y SLWQCVAP +RQN+IS 
Sbjct  726  AALGVEAADIPAYYSLWQCVAPPDRQNVISF  756



>ref|XP_004138387.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cucumis sativus]
 gb|KGN45847.1| hypothetical protein Csa_6G014670 [Cucumis sativus]
Length=754

 Score =   241 bits (616),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSG+LRPLK  LDG+RA+T+LT E R  LL  A  +IT RYY
Sbjct  604  TATYRMTNKPLPVRHSPYVSGLLRPLKAILDGDRASTFLTTETRTALLTDAVTEITSRYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E AADLV++ARKT+SSLQKIR G QRRAGASSDVSDHNISDTDKICMQLFLDIQEY RNL
Sbjct  664  EQAADLVSLARKTDSSLQKIRQGVQRRAGASSDVSDHNISDTDKICMQLFLDIQEYGRNL  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++AA+IP+YRS W  VAP+++Q+ IS 
Sbjct  724  SALGVEAASIPTYRSFWHLVAPSDKQSSISF  754



>gb|KDP30933.1| hypothetical protein JCGZ_11309 [Jatropha curcas]
Length=756

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLK FLDG+RA TYLTKE R +LL GAA +IT RYY
Sbjct  606  TATYRMTNKPLPVRHSPYVSGVLRPLKVFLDGDRAVTYLTKETRNDLLLGAATEITGRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+LV+VARKTESSLQ+IR GAQRRAGASSDVSD ++SDTDKICMQLFLDIQEY RNL
Sbjct  666  ELAAELVSVARKTESSLQRIRQGAQRRAGASSDVSDQSVSDTDKICMQLFLDIQEYGRNL  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++AA IP+YRSLWQCVAP +RQ +ISL
Sbjct  726  SALGVEAANIPAYRSLWQCVAPPDRQTVISL  756



>ref|XP_008463108.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cucumis 
melo]
 ref|XP_008463109.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cucumis 
melo]
Length=754

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSG+LRPLK  LDG+RA+T+LT E R  LL  A  +IT RYY
Sbjct  604  TATYRMTNKPLPVRHSPYVSGLLRPLKVLLDGDRASTFLTMETRTALLTDAVTEITSRYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E AADLV++ARKT+SSLQKIR G QRRAGASSDVSDHNISDTDKICMQLFLDIQEY RNL
Sbjct  664  EQAADLVSLARKTDSSLQKIRQGVQRRAGASSDVSDHNISDTDKICMQLFLDIQEYGRNL  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            SSLG++AA+IP+Y S W  VAP+++Q+ IS 
Sbjct  724  SSLGVEAASIPTYLSFWHLVAPSDKQSSISF  754



>ref|XP_009359449.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
Length=755

 Score =   238 bits (608),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPL+ FL+GERAT YLT++   E+L  AA +IT RYY
Sbjct  605  TATYRMTNKPLPVRHSPYVAGVLRPLRAFLEGERATKYLTRDAINEVLLNAATEITGRYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E A+++V+VARKTE+SLQ+IR GAQRR GASSDVSDHN+SDTDKICMQ+FLDIQEY RNL
Sbjct  665  EQASNVVSVARKTETSLQRIRQGAQRRGGASSDVSDHNVSDTDKICMQIFLDIQEYGRNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+D + I +YRSLW+CVAP ER+++I L
Sbjct  725  AALGVDVSNIETYRSLWECVAPPERKSVIDL  755



>ref|XP_004297537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Fragaria 
vesca subsp. vesca]
Length=768

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSGVLRPLK FLDGERA+ YL ++ + EL+  AA +IT RYY
Sbjct  619  TATYRMTNKPLPVRHSPYVSGVLRPLKVFLDGERASRYLKEDAKNELVLSAATEITGRYY  678

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E AA+LV+VAR+TESSLQKIRLGAQRR GA  DVSD N+SDTDKICMQLFLDIQEY RNL
Sbjct  679  ESAAELVSVARRTESSLQKIRLGAQRRGGA-VDVSDSNVSDTDKICMQLFLDIQEYGRNL  737

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             +LG+DAA I SYRSLWQCVAP + Q +I+ 
Sbjct  738  RALGVDAANIESYRSLWQCVAPADNQGVINF  768



>ref|XP_009346519.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Pyrus x bretschneideri]
Length=599

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPL+ FL+GERAT YLT++   E+L  AA +IT RY 
Sbjct  449  TATYRMTNKPLPVRHSPYVAGVLRPLRAFLEGERATQYLTRDTINEVLLNAATEITGRYN  508

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E AA++V+VARKTE+SLQ+IR GAQRR GASSDVSDHN+SDTDKICMQ+FLDIQEY RNL
Sbjct  509  EQAANVVSVARKTETSLQRIRQGAQRRGGASSDVSDHNVSDTDKICMQIFLDIQEYGRNL  568

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+D + I +YRSLW CVAP +R+++I  
Sbjct  569  AALGVDVSNIEAYRSLWDCVAPPDRKSVIDF  599



>ref|XP_003608844.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES91041.1| oligomeric subunit-like protein [Medicago truncatula]
Length=754

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPLK FLDGER  +YL  E + E+L  AA  ITDRYY
Sbjct  605  TATYRMTNKPLPVRHSPYVAGVLRPLKMFLDGER-ISYLASETKNEILLCAATDITDRYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV  +R+TESSLQKIR  AQRRAG SS +SD+N+SDTD++CMQ FLDIQEYARNL
Sbjct  664  ELAADLVTTSRRTESSLQKIRQSAQRRAGTSSGISDNNVSDTDRMCMQFFLDIQEYARNL  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LGI+A+ I SYRSLWQCVAP +RQN I+ 
Sbjct  724  SALGIEASNIASYRSLWQCVAPADRQNNINF  754



>ref|XP_008374256.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   233 bits (594),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPL+ FL+GERAT YLT++   E+L  AA +IT RY 
Sbjct  605  TATYRMTNKPLPVRHSPYVAGVLRPLRAFLEGERATQYLTRDAINEVLLNAATEITGRYN  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E AA++V+VARKTE+SLQ+IR GAQRR GASSDVSDHN+SDTDKICMQ+FLDIQEY RNL
Sbjct  665  EQAANVVSVARKTETSLQRIRQGAQRRGGASSDVSDHNVSDTDKICMQIFLDIQEYGRNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+D + I +YRSLW+CVAP +R+++I  
Sbjct  725  AALGVDVSNIEAYRSLWECVAPPDRKSVIDF  755



>ref|XP_009375225.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
 ref|XP_009375233.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
Length=755

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPL+ FL+GERAT YLT++   E+L  AA +IT RY 
Sbjct  605  TATYRMTNKPLPVRHSPYVAGVLRPLRAFLEGERATQYLTRDTINEVLLNAATEITGRYN  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E AA++V+VARKTE+SLQ+IR GAQRR GASSDVSDHN+SDTDKICMQ+FLDIQEY RNL
Sbjct  665  EQAANVVSVARKTETSLQRIRQGAQRRGGASSDVSDHNVSDTDKICMQIFLDIQEYGRNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+D + I +YRSLW CVAP +R+ +I  
Sbjct  725  AALGVDVSNIEAYRSLWDCVAPPDRKTVIDF  755



>ref|XP_010433717.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=757

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV G+LRP+K FL+G++A  YLT+++R ELL G   +IT RYY
Sbjct  607  TATYRMTNKPLPVRHSPYVVGLLRPVKVFLEGDKARQYLTEKIREELLHGTVTEITRRYY  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+LV+VARKTESSLQK+R  AQRRAGA+S VSD N+S+TDK+CMQLFLDIQEY RN+
Sbjct  667  ELAAELVSVARKTESSLQKLRQNAQRRAGAASGVSDQNVSETDKMCMQLFLDIQEYGRNI  726

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP+Y S WQCVAP +RQN IS+
Sbjct  727  SALGLKPADIPAYCSFWQCVAPADRQNTISV  757



>ref|XP_010448510.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=756

 Score =   231 bits (589),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV G+LRP+K FL+G++A  YLTK++R ELL G   +IT RYY
Sbjct  606  TATYRMTNKPLPVRHSPYVVGLLRPVKAFLEGDKARQYLTKKIREELLHGTVTEITRRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+LV+VARKTESSLQK+R  AQRRAGA+S VSD N+S+TDK+CMQLFLDIQEY RN+
Sbjct  666  ELAAELVSVARKTESSLQKLRQNAQRRAGAASGVSDQNVSETDKMCMQLFLDIQEYGRNI  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+    IP+Y S WQCVAP +RQN IS+
Sbjct  726  SALGLKPTDIPAYCSFWQCVAPADRQNTISV  756



>ref|XP_008351743.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPL+ FL+GERAT YLT++   E+L  AA +IT RYY
Sbjct  605  TATYRMTNKPLPVRHSPYVAGVLRPLRAFLEGERATKYLTRDAINEVLLNAATEITGRYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E A+++V+V RK E+SLQ+IR GAQRR GASSDVSD N+SDTDKICMQ+FLDIQEY RNL
Sbjct  665  EQASNVVSVTRKMETSLQRIRQGAQRRGGASSDVSDXNVSDTDKICMQIFLDIQEYGRNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+D + I +YRSLW+CVAP ER+++I L
Sbjct  725  AALGVDVSNIEAYRSLWECVAPPERKSVIDL  755



>ref|XP_010438959.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=756

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV G+LRP+K FL+G++A  YLT+++R ELL G   +IT RYY
Sbjct  606  TATYRMTNKPLPVRHSPYVVGLLRPVKAFLEGDKARHYLTEKIREELLHGTVTEITRRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+LV+VARKTESSLQK+R  AQRRAGA+S VSD N+S+TDK+CMQLFLDIQEY RN+
Sbjct  666  ELAAELVSVARKTESSLQKLRQNAQRRAGAASGVSDQNVSETDKMCMQLFLDIQEYGRNI  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP+Y S WQCVAP ++QN IS+
Sbjct  726  SALGLKPADIPAYCSFWQCVAPADKQNTISV  756



>ref|XP_010927713.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Elaeis guineensis]
Length=751

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+LRPLK FLDGE    YLT   R ELL GA  +IT RYY
Sbjct  603  TATYRMTNK-LPVRHSPYVSGILRPLKAFLDGEH-VAYLTHNARNELLHGATIRITSRYY  660

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA+DLVNVARKTESSL ++R GAQRR GASSD  D+NISDT+KICMQLFLDIQEY RNL
Sbjct  661  ELASDLVNVARKTESSLLRLRQGAQRRVGASSDALDNNISDTEKICMQLFLDIQEYGRNL  720

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            +++GI AA IP+YRSLWQCVAP ++Q  I
Sbjct  721  AAIGIKAADIPAYRSLWQCVAPEDKQTQI  749



>ref|XP_008392829.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYR TNKPLPVRHSPYV+GVLRPL+ FL+GERAT YLT++   E+L  AA +IT RYY
Sbjct  605  TATYRXTNKPLPVRHSPYVAGVLRPLRAFLEGERATKYLTRDAINEVLLNAATEITGRYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E A+++V+V RK E+SLQ+IR GAQRR GASSDVSD N+SDTDKICMQ+FLDIQEY RNL
Sbjct  665  EQASNVVSVTRKMETSLQRIRQGAQRRGGASSDVSDXNVSDTDKICMQIFLDIQEYGRNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+D + I +YRSLW+CVAP ER+++I L
Sbjct  725  AALGVDVSNIEAYRSLWECVAPPERKSVIDL  755



>ref|XP_006283181.1| hypothetical protein CARUB_v10004211mg [Capsella rubella]
 gb|EOA16079.1| hypothetical protein CARUB_v10004211mg [Capsella rubella]
Length=754

 Score =   228 bits (580),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV G+LRP+K FL+G++A  YLT++ R ELL G   +IT RYY
Sbjct  604  TATYRMTNKPLPVRHSPYVVGLLRPVKAFLEGDKARHYLTEKTREELLHGTVTEITRRYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+LV+VARKTESSLQK+R  AQRRAGA+S VSD N+S+TDK+CMQLFLDIQEY RN+
Sbjct  664  ELAAELVSVARKTESSLQKLRQNAQRRAGAASGVSDQNVSETDKMCMQLFLDIQEYGRNV  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+  A IP+Y S WQCVAP +RQN IS+
Sbjct  724  TALGLIPADIPAYCSFWQCVAPADRQNTISV  754



>ref|XP_002867640.1| hypothetical protein ARALYDRAFT_492352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43899.1| hypothetical protein ARALYDRAFT_492352 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   228 bits (580),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV G+LRP+K FL+G++A  YLT E R  LL G   +IT RYY
Sbjct  606  TATYRMTNKPLPVRHSPYVVGLLRPIKAFLEGDKARHYLTHETREALLLGTVTEITRRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+LV+VARKTESSLQK+R  AQRRAGA+S VSD N+S+TDK+CMQLFLDIQEY RN+
Sbjct  666  ELAAELVSVARKTESSLQKLRQNAQRRAGAASGVSDQNVSETDKMCMQLFLDIQEYGRNI  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP+Y S WQCVAP +RQN IS+
Sbjct  726  SALGLKPADIPAYCSFWQCVAPADRQNTISV  756



>gb|KFK29022.1| hypothetical protein AALP_AA7G078500 [Arabis alpina]
Length=756

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRM+NKPLPVRHSPYV G+LRPLK FL+G++A  YLT + R ELL G A +IT RYY
Sbjct  604  TATYRMSNKPLPVRHSPYVVGILRPLKAFLEGDKARHYLTDKTREELLLGTATEITRRYY  663

Query  503  ELAADLVNVARKTESSLQKIRLG--AQRRAGASSDVSDHNISDTDKICMQLFLDIQEYAR  330
            EL A+LV+ ARKTESSLQK+R    AQ+R GA+S VSDHN+S+TDK+CMQLFLDIQEY R
Sbjct  664  ELVAELVSAARKTESSLQKLRQSARAQKRGGAASGVSDHNVSETDKMCMQLFLDIQEYGR  723

Query  329  NLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            N+S+LG+  A IP+Y SLWQCVAP +RQN+IS+
Sbjct  724  NISALGLKPADIPAYCSLWQCVAPADRQNVISV  756



>ref|NP_567710.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84970.1| uncharacterized protein AT4G24840 [Arabidopsis thaliana]
Length=756

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+RMTNKPLPVRHSPYV G+LRP+K FL+G++A  YLT++ + ELL G+  +IT RYY
Sbjct  606  TATFRMTNKPLPVRHSPYVVGLLRPVKAFLEGDKARNYLTQKTKEELLHGSVSEITRRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAAD+V+VARKT+SSLQK+R  AQRR GA+S VSD N+S+TDK+CMQLFLDIQEY RN+
Sbjct  666  ELAADVVSVARKTQSSLQKLRQNAQRRGGAASGVSDQNVSETDKMCMQLFLDIQEYGRNV  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP Y S WQCVAP +RQN IS+
Sbjct  726  SALGLKPADIPEYCSFWQCVAPADRQNSISV  756



>ref|XP_010926719.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010926720.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X1 [Elaeis guineensis]
Length=753

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVS +LRPLK FLDGER  +YLT + R ELL GA  +IT+RYY
Sbjct  605  TATYRMTNK-LPVRHSPYVSAILRPLKAFLDGER-VSYLTVDARNELLHGATERITNRYY  662

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA+DLV+VARKTESSL ++R GAQRR GASSD  D+NISDT+KICMQLFLDIQEY RNL
Sbjct  663  ELASDLVSVARKTESSLLRLRQGAQRRVGASSDALDNNISDTEKICMQLFLDIQEYGRNL  722

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            +++GI A  IP+YRSLWQCVAP ++Q  I
Sbjct  723  AAIGIKAVDIPAYRSLWQCVAPEDKQTQI  751



>gb|AAK32887.1|AF367300_1 AT4g24840/F6I7_50 [Arabidopsis thaliana]
 gb|AAM10288.1| AT4g24840/F6I7_50 [Arabidopsis thaliana]
Length=756

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+RMTNKPLPVRHSPYV G+LRP+K FL+G++A  YLT++ + ELL G+  +IT RYY
Sbjct  606  TATFRMTNKPLPVRHSPYVVGLLRPVKAFLEGDKARNYLTQKTKEELLHGSVSEITRRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAAD+V+VARKT+SS QK+R  AQRR GA+S VSD N+S+TDK+CMQLFLDIQEY RN+
Sbjct  666  ELAADVVSVARKTQSSFQKLRQNAQRRGGAASGVSDQNVSETDKMCMQLFLDIQEYGRNV  725

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP Y S WQCVAP +RQN IS+
Sbjct  726  SALGLKPADIPEYCSFWQCVAPADRQNSISV  756



>ref|XP_010677897.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Beta 
vulgaris subsp. vulgaris]
Length=759

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            +ATYRMTNKPLPVRH PYVS +L PLK FL+GE A  YL    + ELL+G A +IT  Y 
Sbjct  610  SATYRMTNKPLPVRHCPYVSAILHPLKAFLEGETAI-YLDDATKKELLRGTALEITKSYN  668

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
             +A++LVNVARKTESSLQ+IR GAQRRAGASSDVSDHN+S+TDKICMQLFLDIQEY RNL
Sbjct  669  AMASELVNVARKTESSLQRIRQGAQRRAGASSDVSDHNVSNTDKICMQLFLDIQEYGRNL  728

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
            ++LG+DAA    YRSLWQCVAP ++Q+ I
Sbjct  729  AALGVDAAEFEDYRSLWQCVAPADKQSTI  757



>emb|CAN71854.1| hypothetical protein VITISV_007347 [Vitis vinifera]
Length=777

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 130/177 (73%), Gaps = 26/177 (15%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVS------------GVLRPLK--------------TFLDGER  582
            TATYRMT+KPLPVRHSPYVS             VL+                  FL GER
Sbjct  601  TATYRMTHKPLPVRHSPYVSRGITSCAGIQYSSVLKQSHLFSRSNIIFSLLSLAFLYGER  660

Query  581  ATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRLGAQRRAGASSDV  402
            A TYLT E+R ELL+GAAF IT  YYELAADLVNVARKTESSLQ+IR GAQRRAGASSDV
Sbjct  661  AATYLTGEIRNELLRGAAFAITGHYYELAADLVNVARKTESSLQRIRQGAQRRAGASSDV  720

Query  401  SDHNISDTDKICMQLFLDIQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             D+N+SDTDKICMQLFLDIQEY RNLS+LG+ A  IP+Y SLW+CVAP ++QN I++
Sbjct  721  MDNNVSDTDKICMQLFLDIQEYGRNLSALGVKAVEIPAYCSLWRCVAPPDQQNAINV  777



>ref|XP_008794572.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Phoenix 
dactylifera]
 ref|XP_008794573.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Phoenix 
dactylifera]
Length=751

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+LRPLK FLDGE     LT + R ELL G   +IT RYY
Sbjct  603  TATYRMTNK-LPVRHSPYVSGILRPLKAFLDGEHVAC-LTHDARNELLYGTTKRITSRYY  660

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA+DLV+VARKTESSL ++R GAQRR GASSD  D+NISDT+KICMQLFLDIQEY RNL
Sbjct  661  ELASDLVSVARKTESSLLRLRQGAQRRVGASSDALDNNISDTEKICMQLFLDIQEYGRNL  720

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQ  246
            +++GI AA IP+YRSLWQCVAP ++Q
Sbjct  721  AAIGIKAADIPAYRSLWQCVAPEDKQ  746



>ref|XP_011024042.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Populus euphratica]
Length=757

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -3

Query  677  TYRMTNKPLPVRHSPYVSGVLRPLKT-FLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            T+RMTNKP+P RHS YVSG+L PLK  FLD E+ + YLTKE   EL  GAA  IT RYY+
Sbjct  608  TFRMTNKPIPTRHSLYVSGLLTPLKKDFLDTEKHSPYLTKETMNELRHGAATAITGRYYD  667

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
            + A++VNVARKTESSLQ+++ GAQRR G SSDVSD  +SDTDK+CMQ FLDIQEY RNLS
Sbjct  668  MVAEIVNVARKTESSLQRLKKGAQRRTGVSSDVSDPTVSDTDKLCMQYFLDIQEYGRNLS  727

Query  320  SLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            +LG+DA  IP+++SLWQCVAP +RQN+I+L
Sbjct  728  TLGVDAKEIPAFQSLWQCVAPLDRQNVINL  757



>ref|XP_006296685.1| hypothetical protein CARUB_v10013037mg [Capsella rubella]
 gb|EOA29583.1| hypothetical protein CARUB_v10013037mg [Capsella rubella]
Length=760

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            AT+ M NKPLPVRHSPYV G+LRPLK FL+GE+A  YLT+E R ELL G   +I+ RYYE
Sbjct  611  ATFMMPNKPLPVRHSPYVIGLLRPLKAFLEGEKARHYLTQETREELLLGTVTEISRRYYE  670

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
            LAA+LV+ ARK E+ LQK R  AQRRAGA+S VSD N+S+T+K+CMQLFLD+QEY RN+S
Sbjct  671  LAAELVSEARKRETVLQKHRQNAQRRAGAASGVSDQNVSETEKMCMQLFLDLQEYGRNIS  730

Query  320  SLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            +LG++ A IP YRSLWQCVAP +RQN IS+
Sbjct  731  ALGLNPADIPPYRSLWQCVAPADRQNTISV  760



>ref|XP_002322242.1| hypothetical protein POPTR_0015s10610g [Populus trichocarpa]
 gb|EEF06369.1| hypothetical protein POPTR_0015s10610g [Populus trichocarpa]
Length=757

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -3

Query  677  TYRMTNKPLPVRHSPYVSGVLRPLKT-FLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            T+RMTNKP+P RHS YVSG+L PLK  FLD E+ + YLTKE   EL  GAA  IT RYY+
Sbjct  608  TFRMTNKPIPTRHSLYVSGLLTPLKKDFLDTEKHSPYLTKETMNELRHGAATAITGRYYD  667

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
            + A++V+VARKTESSLQ+++ GAQRR G SSDVSD  +SDTDK+CMQ FLDIQEY RNLS
Sbjct  668  MVAEIVSVARKTESSLQRLKKGAQRRTGVSSDVSDPTVSDTDKLCMQYFLDIQEYGRNLS  727

Query  320  SLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            +LG+DA  IP+Y+SLWQCVAP +RQN+I+L
Sbjct  728  TLGVDAKEIPAYQSLWQCVAPLDRQNVINL  757



>ref|XP_008239451.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Prunus 
mume]
Length=755

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKP PVRHSPYV+ V+RPLK F +GERAT YLT + + E+L  AA +IT  YY
Sbjct  605  TATYRMTNKPRPVRHSPYVAAVVRPLKAFWEGERATKYLTSDTKHEVLISAATEITGHYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E A +++++AR+T SSLQ+IR GAQRR GASSDVSD N+SDTDKI MQ+FLDIQEY RNL
Sbjct  665  ETADNVISMARRTASSLQRIRQGAQRRGGASSDVSDQNVSDTDKISMQIFLDIQEYGRNL  724

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+D A I ++RSLWQ VAP ERQ+ IS 
Sbjct  725  AALGVDVANIETFRSLWQSVAPAERQSEISF  755



>ref|XP_006413377.1| hypothetical protein EUTSA_v10024490mg [Eutrema salsugineum]
 gb|ESQ54830.1| hypothetical protein EUTSA_v10024490mg [Eutrema salsugineum]
Length=759

 Score =   214 bits (544),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKP PVRHSPYV G+LRP+K FL+G++AT YLT+E R ELL G   +IT RYY
Sbjct  609  TATYRMTNKPPPVRHSPYVVGILRPVKAFLEGDKATHYLTEETREELLLGTVTEITRRYY  668

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA ++V+VARKTESSLQ+ R  AQ+R GA+S VSD  +S+TDK+CMQLFLD QEY RN+
Sbjct  669  ELADEVVSVARKTESSLQQFRKKAQKRVGAASGVSDDYVSETDKMCMQLFLDTQEYGRNI  728

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP Y SLW+CVAP +RQN IS+
Sbjct  729  SALGLKPADIPVYCSLWRCVAPADRQNTISV  759



>ref|XP_011044173.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Populus euphratica]
Length=755

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -3

Query  677  TYRMTNKPLPVRHSPYVSGVLRPLKT-FLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            T+RMTNKP+P RHS YVSG+L PLK  FLD E+   YLT+E   EL  GAA +IT RYY+
Sbjct  606  TFRMTNKPIPSRHSLYVSGLLSPLKKDFLDMEKHNPYLTRETIKELRHGAATEITGRYYD  665

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
            +  ++V+VARKTESSLQ+++ GAQRRAG +SDVSD ++SDTDK+CMQ FLDIQEY RNLS
Sbjct  666  MVVEIVSVARKTESSLQRLKKGAQRRAGVNSDVSDPSVSDTDKLCMQYFLDIQEYGRNLS  725

Query  320  SLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            SLG+DA  IP+YRSLWQCVAP +RQN+I L
Sbjct  726  SLGVDAKGIPAYRSLWQCVAPPDRQNVIDL  755



>gb|EPS73270.1| hypothetical protein M569_01480, partial [Genlisea aurea]
Length=757

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYVSG+LRPLK FL+GERA+ YL++E+R E+L+GA  +IT RYY
Sbjct  606  TATYRMTNKPLPVRHSPYVSGILRPLKVFLEGERASKYLSREVRREVLKGACLEITRRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGA-QRRAGASSDVSDHNISDTDKICMQLFLDIQ--EYA  333
            +L ++LV++ARKTESSLQKIRLGA QRR G SS+VSD  +S+ DK+C QL LDIQ  EY 
Sbjct  666  DLGSELVSMARKTESSLQKIRLGAQQRRGGGSSEVSDSGVSEIDKLCTQLLLDIQALEYG  725

Query  332  RNLSSLGIDAATIPSYRSLWQCVAPTERQNII  237
            RNL S+GI+A +IP+Y S W CVAP +    I
Sbjct  726  RNLGSVGIEARSIPAYVSFWHCVAPPDTHQTI  757



>ref|XP_010105239.1| Conserved oligomeric Golgi complex subunit 2 [Morus notabilis]
 gb|EXC04126.1| Conserved oligomeric Golgi complex subunit 2 [Morus notabilis]
Length=708

 Score =   211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKP+P RHSPYV+ VLRPL+ FL G+RA TYLT E++ ELL  AA +IT RYY
Sbjct  564  TATYRMTNKPIPTRHSPYVAAVLRPLEAFLRGDRAATYLTSEVKKELLDSAAKEITSRYY  623

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAADLV+VARKTESSLQ+IR GAQRRAGASSD+SD+N+SDT KIC QL LDIQEY RNL
Sbjct  624  ELAADLVSVARKTESSLQRIRQGAQRRAGASSDISDNNVSDTYKICQQLKLDIQEYGRNL  683

Query  323  SSLGIDAATIPSYRSLWQCVAPTE  252
              LGID   I +YRSL +CV+ ++
Sbjct  684  KELGIDPEDISAYRSLLECVSQSK  707



>ref|XP_010485902.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=760

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+ M NKPLPVRHSPYV G+LRPLK FL+G++A  YLT E R ELL G   +I+ RYY
Sbjct  610  TATFMMPNKPLPVRHSPYVIGLLRPLKAFLEGDKAKHYLTHETREELLLGTVTEISRRYY  669

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+LV+ ARK E+ LQK R  AQ+RAGA+S V D N+S+TDK+CMQLFLD+QEY RN+
Sbjct  670  ELAAELVSEARKRETVLQKHRQNAQKRAGAASGVPDQNVSETDKMCMQLFLDLQEYGRNI  729

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++ A IP Y SLWQCVAP +RQN IS+
Sbjct  730  SALGLNPADIPPYCSLWQCVAPADRQNTISV  760



>emb|CDX92658.1| BnaC07g39160D [Brassica napus]
Length=757

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYR+TNKP PVRHSPYV G+LR +K FL+GE+AT YLT+  R ELL     +IT RYY
Sbjct  607  TATYRLTNKPPPVRHSPYVVGILRHVKAFLEGEKATRYLTQATREELLLRTVTEITRRYY  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA ++V+VAR+TESSLQ+ R  AQ+RAGA+S VSD N+S+TDK+CMQLFLD QEY RN+
Sbjct  667  ELADEVVSVARRTESSLQQFRRKAQKRAGAASGVSDDNVSETDKMCMQLFLDTQEYGRNI  726

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  727  SALGLKPAEIPVYCSLWQCVAPADRQNTISV  757



>emb|CDY11039.1| BnaA03g46980D [Brassica napus]
Length=757

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYR+TNKP PVRHSPYV G+LR +K FL+GE+AT YLT+  R ELL     +IT RYY
Sbjct  607  TATYRLTNKPPPVRHSPYVVGILRHVKAFLEGEKATRYLTQATREELLLRTVTEITRRYY  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA ++V+VAR+TESSLQ+ R  AQ+RAGA+S VSD N+S+TDK+CMQLFLD QEY RN+
Sbjct  667  ELADEVVSVARRTESSLQQFRRKAQKRAGAASGVSDDNVSETDKMCMQLFLDTQEYGRNI  726

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  727  SALGLKPAEIPVYCSLWQCVAPADRQNTISV  757



>ref|XP_009137478.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Brassica rapa]
Length=757

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYR+TNKP PVRHSPYV G+LR +K FL+GE+AT YLT+  R ELL     +IT RYY
Sbjct  607  TATYRLTNKPPPVRHSPYVVGILRHVKAFLEGEKATRYLTQATREELLLRTVTEITRRYY  666

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA ++V+VAR+TESSLQ+ R  AQ+RAGA+S VSD N+S+TDK+CMQLFLD QEY RN+
Sbjct  667  ELADEVVSVARRTESSLQQFRRKAQKRAGAASGVSDDNVSETDKMCMQLFLDTQEYGRNI  726

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  727  SALGLKPAEIPVYCSLWQCVAPADRQNTISV  757



>dbj|BAK01513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+  KIT  YY
Sbjct  619  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGDR-VHYLSEDDKTKLRRGSTDKITATYY  676

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ++ +++VNVARKTESSLQ++R G Q+R G S+D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  677  DMVSEVVNVARKTESSLQRLRQGQQKRIGGSTDASDNIISDTDKICMQLFLDIQEYARNL  736

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             +LGIDA  I SYRSLWQCVAP ++Q+II  
Sbjct  737  RTLGIDAKEIESYRSLWQCVAPKDKQDIIQF  767



>ref|XP_010464008.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=764

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+ M NKPLPVRHSPYV G+LRPLK FL+G++A  YLT E + ELL G   +I+ RYY
Sbjct  614  TATFMMPNKPLPVRHSPYVIGLLRPLKDFLEGDKARHYLTHETKEELLLGTVTEISRRYY  673

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAA+LV+ ARK E+ LQK R  AQ+RAGA+S +SD N+S+TDK+CMQLFLD+QEY RN+
Sbjct  674  ELAAELVSEARKRETVLQKHRQNAQKRAGAASSLSDQNVSETDKMCMQLFLDLQEYGRNI  733

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S LG++ A IP Y SLWQCVAP +RQN  S+
Sbjct  734  SELGLNPADIPPYCSLWQCVAPADRQNTTSV  764



>ref|XP_004981048.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Setaria italica]
Length=751

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+GER  +YL+++ + +L +G+  KIT  YY
Sbjct  603  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGER-VSYLSEDDKTKLCRGSTDKITAIYY  660

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +L +++V VARKTESSLQ++R GAQRR GAS+D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  661  DLVSEVVTVARKTESSLQRLRQGAQRRVGASTDASDNIISDTDKICMQLFLDIQEYARNL  720

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             ++GIDA  I SYR+LWQCVAP ++Q  I  
Sbjct  721  RTIGIDAREIDSYRALWQCVAPKDKQENIQF  751



>ref|XP_009138596.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Brassica 
rapa]
Length=758

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            T TYRMTNKP PVRHSPYV G+LR +K FL+G++AT YLT+E R E+L G    IT RYY
Sbjct  608  TTTYRMTNKPPPVRHSPYVVGILRHVKAFLEGDKATHYLTQETREEILLGTVTDITRRYY  667

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E A ++V++AR+TESSLQ+ R  AQ+RAGA+S  SD N+S+TDK+CMQLFLD QEY RN+
Sbjct  668  ESADEVVSLARRTESSLQQFRRKAQKRAGAASGASDDNVSETDKMCMQLFLDAQEYGRNI  727

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  728  AALGLKPADIPVYCSLWQCVAPADRQNTISV  758



>emb|CDY34317.1| BnaA01g14200D [Brassica napus]
Length=758

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            T TYRMTNKP PVRHSPYV G+LR +K FL+G++AT YLT+E R E+L G    IT RYY
Sbjct  608  TTTYRMTNKPPPVRHSPYVVGILRHVKAFLEGDKATHYLTQETREEILLGTVTDITRRYY  667

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E A ++V++AR+TESSLQ+ R  AQ+RAGA+S  SD N+S+TDK+CMQLFLD QEY RN+
Sbjct  668  ESADEVVSLARRTESSLQQFRRKAQKRAGAASGASDDNVSETDKMCMQLFLDAQEYGRNI  727

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            ++LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  728  AALGLKPADIPVYCSLWQCVAPADRQNTISV  758



>ref|XP_009385489.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=750

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 121/151 (80%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYR+TNK LPV  S YVS +LRPLK FLDGE     L K+ R ELL G   KIT RYY
Sbjct  602  TATYRLTNK-LPVIPSQYVSLILRPLKAFLDGEH-IKLLMKDARNELLHGVTEKITTRYY  659

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELAAD VNVARKTESSL ++R GAQRR GA+SD  D+NISDT+KICMQLFLD+QEY RNL
Sbjct  660  ELAADTVNVARKTESSLLRLRQGAQRRVGATSDSVDNNISDTEKICMQLFLDVQEYGRNL  719

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S++GI+A+ I +YRSLWQCVAP +RQ+ I+L
Sbjct  720  SAMGIEASEISAYRSLWQCVAPEDRQSQITL  750



>gb|EMS58136.1| Oligomeric Golgi complex subunit 2 [Triticum urartu]
Length=656

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 123/151 (81%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+  KIT  YY
Sbjct  508  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGDR-VHYLSEDDKTKLRRGSTDKITATYY  565

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ++ +++VNVARKTESSLQ++R G Q+R G S+D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  566  DMVSEVVNVARKTESSLQRLRQGQQKRIGGSTDASDNIISDTDKICMQLFLDIQEYARNL  625

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             +LGIDA  I SYRSLWQCVAP ++Q+ I  
Sbjct  626  RTLGIDAREIESYRSLWQCVAPKDKQDSIQF  656



>ref|XP_003562360.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Brachypodium 
distachyon]
Length=759

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L  G+  KIT  Y+
Sbjct  611  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGDR-VHYLSEDDKTKLRCGSTDKITAIYF  668

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ++ +++VNVARKTESSLQ++R GAQRR GAS+D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  669  DMVSEVVNVARKTESSLQRLRQGAQRRVGASTDASDNVISDTDKICMQLFLDIQEYARNL  728

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
              LGIDA  I SYR+LWQCVAP ++Q++I  
Sbjct  729  RLLGIDAREIESYRALWQCVAPKDKQDLIQF  759



>emb|CDY03412.1| BnaC01g16700D [Brassica napus]
Length=760

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            T TYRMTNKP PVRHSPYV G+LR +K FL+G++AT YLT+E R E+L      IT RYY
Sbjct  610  TTTYRMTNKPPPVRHSPYVVGILRHVKAFLEGDKATHYLTQETREEILLRTVTDITRRYY  669

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E A ++V++AR+TESSLQ+ R  AQ+RAGA+S VSD N+S+TDK+CMQLFLD QEY RN+
Sbjct  670  ESADEVVSLARRTESSLQQFRRKAQKRAGAASGVSDDNVSETDKMCMQLFLDAQEYGRNI  729

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  730  SALGLKPADIPVYCSLWQCVAPADRQNTISV  760



>ref|XP_002463519.1| hypothetical protein SORBIDRAFT_01g001270 [Sorghum bicolor]
 gb|EER90517.1| hypothetical protein SORBIDRAFT_01g001270 [Sorghum bicolor]
Length=748

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+GER   YL+++ +  L +G+  KIT  YY
Sbjct  600  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGER-IHYLSEDDKTRLCRGSTDKITAIYY  657

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +L +++V VARKTESSLQ++R GAQRR GAS+D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  658  DLVSEVVTVARKTESSLQRLRQGAQRRVGASTDASDNIISDTDKICMQLFLDIQEYARNL  717

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             ++GIDA  I SYR+LWQCVAP ++Q  I  
Sbjct  718  RAIGIDAREIDSYRALWQCVAPKDKQENIQF  748



>ref|XP_006652018.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Oryza brachyantha]
Length=693

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+  KIT  YY
Sbjct  545  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGDR-IHYLSEDDKTKLRRGSTDKITSIYY  602

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ++ +++V VARKTESSLQ++R GAQRR GAS+D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  603  DMVSEVVTVARKTESSLQRLRQGAQRRVGASTDASDNIISDTDKICMQLFLDIQEYARNL  662

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             ++GIDA  I S+R+LWQCVAP E+Q+ I  
Sbjct  663  RAIGIDAREIESFRALWQCVAPREKQDNIQF  693



>tpg|DAA52497.1| TPA: hypothetical protein ZEAMMB73_788308 [Zea mays]
Length=691

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMT+K LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+A KIT  YY
Sbjct  543  TATYRMTSK-LPVRHSPYVSGILHPLKVFLEGDR-MHYLSEDDKTKLCRGSANKITATYY  600

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +L +++V VARKTESSLQ++R GAQRR GAS+D SD  ISDTDKICMQLFLDIQEYARNL
Sbjct  601  DLVSEVVTVARKTESSLQRLRQGAQRRVGASTDASDSIISDTDKICMQLFLDIQEYARNL  660

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             ++GIDA  I SYR+LWQCVAP +R   I  
Sbjct  661  RAIGIDAREIDSYRALWQCVAPKDRHENIQF  691



>ref|XP_008645319.1| PREDICTED: uncharacterized protein LOC100383630 isoform X1 [Zea 
mays]
 tpg|DAA52498.1| TPA: hypothetical protein ZEAMMB73_788308 [Zea mays]
Length=745

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMT+K LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+A KIT  YY
Sbjct  597  TATYRMTSK-LPVRHSPYVSGILHPLKVFLEGDR-MHYLSEDDKTKLCRGSANKITATYY  654

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +L +++V VARKTESSLQ++R GAQRR GAS+D SD  ISDTDKICMQLFLDIQEYARNL
Sbjct  655  DLVSEVVTVARKTESSLQRLRQGAQRRVGASTDASDSIISDTDKICMQLFLDIQEYARNL  714

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             ++GIDA  I SYR+LWQCVAP +R   I  
Sbjct  715  RAIGIDAREIDSYRALWQCVAPKDRHENIQF  745



>ref|XP_008644331.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Zea mays]
 gb|AFW66981.1| hypothetical protein ZEAMMB73_946461 [Zea mays]
Length=739

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 123/151 (81%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMT+K LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+  KIT  YY
Sbjct  591  TATYRMTSK-LPVRHSPYVSGILHPLKVFLEGDR-IRYLSEDDKTKLCRGSTDKITAIYY  648

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +L +++V VARKTESSLQ++R GAQRR GAS+D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  649  DLVSEVVTVARKTESSLQRLRQGAQRRVGASTDASDNIISDTDKICMQLFLDIQEYARNL  708

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             ++GIDA  I SYR+LWQCVAP +RQ  I  
Sbjct  709  RAIGIDAREIDSYRALWQCVAPKDRQENIQF  739



>gb|EEC76534.1| hypothetical protein OsI_14326 [Oryza sativa Indica Group]
Length=754

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+  KIT  YY
Sbjct  606  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGDR-IHYLSEDDKAKLRRGSTDKITSIYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ++ +++V VARKTESSLQ++R GAQRR GA++D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  664  DMVSEVVTVARKTESSLQRLRQGAQRRVGANTDTSDNIISDTDKICMQLFLDIQEYARNL  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             ++GIDA  I ++R+LWQCVAP ++Q+ I  
Sbjct  724  RAIGIDAREIETFRALWQCVAPRDKQDNIQF  754



>ref|NP_001051898.1| Os03g0849600 [Oryza sativa Japonica Group]
 gb|AAO37946.1| putative conserved oligomeric Golgi complex component [Oryza 
sativa Japonica Group]
 gb|ABF99909.1| brefeldin A-sensitive Golgi protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13812.1| Os03g0849600 [Oryza sativa Japonica Group]
 gb|EAZ29309.1| hypothetical protein OsJ_13370 [Oryza sativa Japonica Group]
Length=754

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+  KIT  YY
Sbjct  606  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGDR-IHYLSEDDKAKLRRGSTDKITSIYY  663

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ++ +++V VARKTESSLQ++R GAQRR GA++D SD+ ISDTDKICMQLFLDIQEYARNL
Sbjct  664  DMVSEVVTVARKTESSLQRLRQGAQRRVGANTDTSDNIISDTDKICMQLFLDIQEYARNL  723

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             ++GIDA  I ++R+LWQCVAP ++Q+ I  
Sbjct  724  RAIGIDAREIETFRALWQCVAPRDKQDNIQF  754



>ref|XP_009131654.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Brassica rapa]
Length=724

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            AT  M+NKPLP+RHSPYV G+LRPLK FL+G++A  YLT E R ELL G   ++T RYYE
Sbjct  574  ATCMMSNKPLPIRHSPYVVGLLRPLKAFLEGDKARHYLTHETREELLLGTLTEMTRRYYE  633

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAG-ASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            LAA  ++ ARKTE+ LQK R  AQ+RAG A+S V+DHN+S T+K+CMQLFLD+QEY RN+
Sbjct  634  LAAGRLSDARKTETYLQKSRQNAQKRAGAAASGVTDHNVSGTEKMCMQLFLDLQEYGRNI  693

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++ A I  Y SLW+CVAP +RQN IS+
Sbjct  694  SALGLNPADIEPYCSLWKCVAPPDRQNTISV  724



>gb|EMT13194.1| Putative oligomeric Golgi complex subunit 2 [Aegilops tauschii]
Length=621

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 123/168 (73%), Gaps = 19/168 (11%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNK LPVRHSPYVSG+L PLK FL+G+R   YL+++ + +L +G+  KIT  YY
Sbjct  456  TATYRMTNK-LPVRHSPYVSGILHPLKVFLEGDRVH-YLSEDDKTKLRRGSTDKITATYY  513

Query  503  ELAADLVNV-----------------ARKTESSLQKIRLGAQRRAGASSDVSDHNISDTD  375
            ++ +++VNV                 ARKTESSLQ++R G Q+R G S+D SD+ ISDTD
Sbjct  514  DMVSEVVNVFYLSTYELLRLYLFNMKARKTESSLQRLRQGQQKRIGGSTDASDNIISDTD  573

Query  374  KICMQLFLDIQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            KICMQLFLDIQEYARNL +LGIDA  I SYRSLWQCVAP ++Q+ I  
Sbjct  574  KICMQLFLDIQEYARNLRTLGIDAREIESYRSLWQCVAPKDKQDSIQF  621



>ref|XP_002318717.1| hypothetical protein POPTR_0012s09800g [Populus trichocarpa]
 gb|EEE96937.1| hypothetical protein POPTR_0012s09800g [Populus trichocarpa]
Length=755

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -3

Query  677  TYRMTNKPLPVRHSPYVSGVLRPLKT-FLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            T+RMTNKP+P RHS YVSG+L PLK  FLD E+   YLT+E   EL  GAA +IT RYY+
Sbjct  606  TFRMTNKPIPSRHSLYVSGLLSPLKKDFLDMEKHNPYLTRETVKELRHGAATEITGRYYD  665

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
            +  ++V+VARKTESSLQ+++ GAQRRAG SSDVSD ++SDTDK+CMQ FLDIQEY RNLS
Sbjct  666  MVVEIVSVARKTESSLQRLKKGAQRRAGVSSDVSDPSVSDTDKLCMQYFLDIQEYGRNLS  725

Query  320  SLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            +LG+DA  IP+YRSLWQCVAP +RQN+I L
Sbjct  726  TLGVDAKEIPAYRSLWQCVAPPDRQNVIDL  755



>ref|XP_003603203.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
Length=798

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            ATY MTNKPLPV HSPYV+GVLRPLK FL GE+  +YL  E + E+L  AA +ITDRYYE
Sbjct  641  ATYMMTNKPLPVGHSPYVAGVLRPLKAFLGGEK-ISYLASETKNEILLYAATEITDRYYE  699

Query  500  LAADLVNVARKTESSLQKIRLG----------AQRRAGASSDVSDHNISDTDKICMQLFL  351
            LAADLV V R  +++L K + G           QRRAGASS + D+N+SDTD++CMQLFL
Sbjct  700  LAADLVIVVR-IQTTLMKFQEGKNIHFRKLDRVQRRAGASSGIYDNNVSDTDRMCMQLFL  758

Query  350  DIQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            DIQEYARNLS+LG++A  I S+ SLWQ VAP ++QN I L
Sbjct  759  DIQEYARNLSALGVEAVNIASFSSLWQSVAPADKQNTIKL  798



>emb|CDY51233.1| BnaA03g07050D [Brassica napus]
Length=724

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            AT  M+NKPLP+ HSPYV G+LRPLK FL+G++A  YLT E R ELL G   ++T RYYE
Sbjct  574  ATCMMSNKPLPITHSPYVVGLLRPLKAFLEGDKARHYLTHETREELLLGTLTEMTRRYYE  633

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAG-ASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            LAA  ++ ARKTE+ LQK R  AQ+RAG A+S V+DHN+S T+K+CMQLFLD+QEY RN+
Sbjct  634  LAAGRLSDARKTETYLQKSRQNAQKRAGAAASGVTDHNVSGTEKMCMQLFLDLQEYGRNI  693

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
            S+LG++ A I  Y SLW+CVAP +RQN IS+
Sbjct  694  SALGLNPADIEPYCSLWKCVAPPDRQNTISV  724



>emb|CDX70811.1| BnaC03g08950D [Brassica napus]
Length=725

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            AT  M+NKP+P+RHSPYV G+LRPLK FL+G++A  YLT E R ELL G   ++T RYYE
Sbjct  575  ATCMMSNKPVPIRHSPYVVGLLRPLKAFLEGDKARHYLTHETREELLLGTLTEMTRRYYE  634

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAG-ASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            LAA  ++ ARKTE+ LQK R  AQ+RAG A+S V+DHN S T+K+CMQLFLD+QEY RN+
Sbjct  635  LAAGRLSDARKTETYLQKSRQNAQKRAGAAASGVTDHNESGTEKMCMQLFLDLQEYGRNI  694

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNIISL  231
             +LG++ A I  Y SLW+CVAP +RQN IS+
Sbjct  695  CALGLNPADIEPYCSLWKCVAPPDRQNTISV  725



>ref|XP_006848427.1| hypothetical protein AMTR_s00013p00234340 [Amborella trichopoda]
 gb|ERN10008.1| hypothetical protein AMTR_s00013p00234340 [Amborella trichopoda]
Length=805

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = -3

Query  677  TYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYEL  498
            TYRMTNKP PVRHSPYVSGVLRPLK FL+GERA  YL  E + +L+ GAA +IT  YYE+
Sbjct  623  TYRMTNKPPPVRHSPYVSGVLRPLKAFLEGERAA-YLASETKSKLIHGAAERITGHYYEI  681

Query  497  AADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  342
            A D+VNV R+TESSLQ++R GAQRR GASSD SDHNISDTDKICMQLFLDIQ
Sbjct  682  AWDVVNVQRRTESSLQRLRQGAQRRGGASSDASDHNISDTDKICMQLFLDIQ  733



>emb|CAB41124.1| brefeldin A-sensitive Golgi protein-like [Arabidopsis thaliana]
 emb|CAB79394.1| brefeldin A-sensitive Golgi protein-like [Arabidopsis thaliana]
Length=724

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+RMTNKPLPVRHSPYV G+LRP+K FL+G++A  YLT++ + ELL G+  +IT RYY
Sbjct  606  TATFRMTNKPLPVRHSPYVVGLLRPVKAFLEGDKARNYLTQKTKEELLHGSVSEITRRYY  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  342
            ELAAD+V+VARKT+SSLQK+R  AQRR GA+S VSD N+S+TDK+CMQLFLDIQ
Sbjct  666  ELAADVVSVARKTQSSLQKLRQNAQRRGGAASGVSDQNVSETDKMCMQLFLDIQ  719



>ref|XP_009385490.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=716

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = -3

Query  653  LPVRHSPYVSGVL-RPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNV  477
            LP      V  ++ + ++ FLDGE     L K+ R ELL G   KIT RYYELAAD VNV
Sbjct  576  LPAIMDTMVEAIVEKSVEAFLDGEH-IKLLMKDARNELLHGVTEKITTRYYELAADTVNV  634

Query  476  ARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSLGIDAAT  297
            ARKTESSL ++R GAQRR GA+SD  D+NISDT+KICMQLFLD+QEY RNLS++GI+A+ 
Sbjct  635  ARKTESSLLRLRQGAQRRVGATSDSVDNNISDTEKICMQLFLDVQEYGRNLSAMGIEASE  694

Query  296  IPSYRSLWQCVAPTERQNIISL  231
            I +YRSLWQCVAP +RQ+ I+L
Sbjct  695  ISAYRSLWQCVAPEDRQSQITL  716



>ref|XP_007210583.1| hypothetical protein PRUPE_ppa015080mg, partial [Prunus persica]
 gb|EMJ11782.1| hypothetical protein PRUPE_ppa015080mg, partial [Prunus persica]
Length=718

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKP PVRHSPYV+ V+RPLK F +GERAT YLT + + E+L  AA +IT  YY
Sbjct  605  TATYRMTNKPRPVRHSPYVAAVVRPLKAFWEGERATKYLTSDTKHEVLLSAATEITGHYY  664

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  342
            E A +++++AR+T SSLQ+IR GAQRR GASSDVSD N+SDTDKI MQ+FLDIQ
Sbjct  665  ETADNVISMARRTASSLQRIRQGAQRRGGASSDVSDQNVSDTDKISMQIFLDIQ  718



>ref|XP_001764075.1| predicted protein [Physcomitrella patens]
 gb|EDQ71214.1| predicted protein [Physcomitrella patens]
Length=761

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
             ATYRMTN+PLP RHSPYV+ +L+PLKTFL+ +R   ++T E+  EL+   + KIT +Y 
Sbjct  613  VATYRMTNRPLPSRHSPYVTSILQPLKTFLEDDR-YAHVTNEMHAELIASVSEKITSQYD  671

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISD--TDKICMQLFLDIQEYAR  330
             LA D+V++AR+TE+SL  +R GA++R   S+D +D N+SD  +DKIC QLFLD+QEY R
Sbjct  672  VLARDMVSMARQTEASLLLLRRGARQRGAGSADTTD-NVSDNLSDKICAQLFLDVQEYGR  730

Query  329  NLSSLGIDAATIPSYRSLWQCVAP  258
             L++LGI AA +P+Y SLWQCVAP
Sbjct  731  RLAALGITAADLPAYTSLWQCVAP  754



>ref|XP_002966110.1| hypothetical protein SELMODRAFT_86129 [Selaginella moellendorffii]
 gb|EFJ32137.1| hypothetical protein SELMODRAFT_86129 [Selaginella moellendorffii]
Length=714

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 93/145 (64%), Gaps = 2/145 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            T TYR+T KPLP  HS   + +L+ L+ FL G+    Y++   R E+L   A K+T  Y 
Sbjct  569  TTTYRLTIKPLPTHHSHVATNLLQALRAFLQGDH-NAYMSDACRLEILNSVAKKVTKNYD  627

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +   DLV   RKTESSL + R  A++R GA  D +D NIS+TDK+C QL LD+QE+ R L
Sbjct  628  QQIRDLVEGLRKTESSLLRFR-QARQRTGAGPDANDANISNTDKVCAQLLLDVQEHGRKL  686

Query  323  SSLGIDAATIPSYRSLWQCVAPTER  249
              LG+D++ +P ++SLW+ V+  E+
Sbjct  687  DELGVDSSKLPEFQSLWEFVSLQEK  711



>ref|XP_002982190.1| hypothetical protein SELMODRAFT_115746 [Selaginella moellendorffii]
 gb|EFJ16858.1| hypothetical protein SELMODRAFT_115746 [Selaginella moellendorffii]
Length=714

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 93/145 (64%), Gaps = 2/145 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            T TYR+T KPLP  HS   + +L+ L+ FL G+    Y++   R E+L   A K+T  Y 
Sbjct  569  TTTYRLTIKPLPTHHSHVATNLLQALRAFLQGDH-NAYMSDACRLEILNSVAKKVTKNYD  627

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            +   DLV   RKTESSL + R  A++R GA  D +D NIS+TDK+C QL LD+QE+ R L
Sbjct  628  QQIRDLVEGLRKTESSLLRFR-QARQRTGAGPDANDANISNTDKVCAQLLLDVQEHGRKL  686

Query  323  SSLGIDAATIPSYRSLWQCVAPTER  249
              LG+D++ +P ++SLW+ V+  E+
Sbjct  687  DELGVDSSKLPEFQSLWEFVSLQEK  711



>ref|XP_005644140.1| hypothetical protein COCSUDRAFT_48790 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19596.1| hypothetical protein COCSUDRAFT_48790 [Coccomyxa subellipsoidea 
C-169]
Length=752

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 94/149 (63%), Gaps = 4/149 (3%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMT +P P + S YV+G+L  L++FLDG+ A   L+ + R E+ QG    +T R+ 
Sbjct  607  TATYRMTTRPAPTKASHYVAGILSGLRSFLDGQ-AAGRLSPDARAEIAQGVIAGVTQRFA  665

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
              A +L+   RKTESSL++++   + RAG ++      +SD DK+ +QLFLD QEY  ++
Sbjct  666  NQAGELLENLRKTESSLKRLK---KSRAGDAAADGPGALSDADKVNVQLFLDAQEYGTHV  722

Query  323  SSLGIDAATIPSYRSLWQCVAPTERQNII  237
               G+D   +P+Y  LW  VAP ER++ +
Sbjct  723  KKFGVDPTGLPAYLELWNAVAPPERRDAV  751



>ref|XP_007023397.1| Golgi organization, COG2 isoform 2 [Theobroma cacao]
 gb|EOY26019.1| Golgi organization, COG2 isoform 2 [Theobroma cacao]
Length=674

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMTNKPLPVRHSPYV+GVLRPLKTFLDGERATTYLT   R +LL GAA +IT RYY
Sbjct  604  TATYRMTNKPLPVRHSPYVAGVLRPLKTFLDGERATTYLTNAARNDLLLGAATEITGRYY  663

Query  503  ELAADLVNV  477
            ELAADLV+V
Sbjct  664  ELAADLVSV  672



>ref|XP_001416921.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95214.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=766

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 86/141 (61%), Gaps = 8/141 (6%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+RMTNKP+P RHS +V  +L PL+ FLD ER T   +K  R E++      +++RY 
Sbjct  628  TATFRMTNKPMPTRHSHFVPTILAPLQAFLDNER-TKMFSKTSRQEIVDKVVDSVSERYA  686

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            E+A+DLV   +KTE+SL +++     R G +S      + DTDKIC QL+LD +EYA  +
Sbjct  687  EMASDLVATVKKTEASLNRLK----DRQGKTSST---GVGDTDKICRQLYLDAKEYAVQM  739

Query  323  SSLGIDAATIPSYRSLWQCVA  261
               G+ +    ++  LW  VA
Sbjct  740  EKFGVVSTNSDAFNELWSNVA  760



>gb|AES73454.2| oligomeric subunit-like protein [Medicago truncatula]
Length=468

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            ATY MTNKPLPV HSPYV+GVLRPLK FL GE+  +YL  E + E+L  AA +ITDRYYE
Sbjct  377  ATYMMTNKPLPVGHSPYVAGVLRPLKAFLGGEK-ISYLASETKNEILLYAATEITDRYYE  435

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAG  417
            LAADLV V+R+ E SLQKIR  A+   G
Sbjct  436  LAADLVIVSRRKEYSLQKIRQSAETSRG  463



>ref|XP_003078128.1| Low density lipoprotein receptor (ISS) [Ostreococcus tauri]
 emb|CAL52868.1| Conserved oligomeric Golgi complex, subunit 2,N-terminal [Ostreococcus 
tauri]
Length=799

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 86/140 (61%), Gaps = 8/140 (6%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+RMTNKP+P RHS +V  +L PL+TF+D ER T  L+K    E++      + ++Y 
Sbjct  659  TATFRMTNKPMPTRHSHFVPSILAPLQTFVDNER-TKALSKTSTHEIVTQVVETVCEKYG  717

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ELA DL+   +KTE+SL +++     R G +S+       D+DKIC QL+LD +E+   +
Sbjct  718  ELARDLLETVKKTEASLNRLK----DRQGKASNA---GTGDSDKICRQLYLDAKEFETQM  770

Query  323  SSLGIDAATIPSYRSLWQCV  264
               G+D     ++R+LW+ V
Sbjct  771  KKFGVDPRDSNAFRALWEAV  790



>ref|XP_005848758.1| hypothetical protein CHLNCDRAFT_57543 [Chlorella variabilis]
 gb|EFN56656.1| hypothetical protein CHLNCDRAFT_57543 [Chlorella variabilis]
Length=767

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 89/148 (60%), Gaps = 9/148 (6%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
             AT+RMT++ LP R S YVS +L PL  FL  + A+  L+ E R +L       ++ RY 
Sbjct  625  VATFRMTSRSLPSRPSHYVSMILAPLHQFLQADVASK-LSPEARQQLAVAVVTGVSGRYL  683

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDK-ICMQLFLDIQEYARN  327
             LAAD ++  RKTESSL++++   Q   G ++        DTDK I  QL LD+QE+ R 
Sbjct  684  HLAADTLSTVRKTESSLKRLKARQQGGEGGAA-------PDTDKMIGQQLLLDVQEFGRQ  736

Query  326  LSSLGIDAATIPSYRSLWQCVAPTERQN  243
             +  G+DAA + SYR LWQ VAP E+++
Sbjct  737  ATQAGVDAAQLDSYRQLWQMVAPEEQKD  764



>gb|KIZ07920.1| Conserved oligomeric Golgi complex subunit 2 [Monoraphidium neglectum]
Length=787

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TATYRMT+K  P RHS YVSGVL PL+  LD   A   L   ++  L       +  RY 
Sbjct  560  TATYRMTSKGPPTRHSHYVSGVLAPLRQALDAPGAPQRLPPGVKLALAAAVFDSVNRRYA  619

Query  503  ELAADLVNVARKTESSLQKIRLG--AQRRAGASSDVSDHNISDTDKICMQLFLDIQEYAR  330
            +LA +L+   RKTESSL++++ G       GA +      ++D+DKIC+QL+LD QE+ R
Sbjct  620  QLAEELLGSVRKTESSLKRLKKGRAPDGGGGADAGGGAAEMNDSDKICLQLYLDAQEHGR  679

Query  329  NLSSLGIDAATIPSYRSLWQCVAPTER  249
              +  G+ A   PS+ +L   V P ++
Sbjct  680  LATRFGLQAEAAPSFSALLAAVTPQQQ  706



>ref|XP_007510910.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66470.1| predicted protein [Bathycoccus prasinos]
Length=955

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 91/150 (61%), Gaps = 10/150 (7%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLT----KELRFELLQGAAFKIT  516
            TAT+RMTNKP P +HS +V  +L+PL  F +  + T  L+    KEL  E+ +G    +T
Sbjct  805  TATFRMTNKPTPSKHSHFVPMLLQPLSKFCEESQRTRRLSPIAAKELTREVCEG----VT  860

Query  515  DRYYELAADLVNVARKTESSLQKI--RLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  342
             +Y E+A+DLV    KTE+SL ++  R G    A A +  +   +SDTDKI  QL LD+ 
Sbjct  861  KKYAEMASDLVATVLKTEASLNRLKDRQGKGTAASADATKTGGKLSDTDKILKQLHLDVA  920

Query  341  EYARNLSSLGIDAATIPSYRSLWQCVAPTE  252
            EYA  L S+ +  +++ ++ +LW+ +AP +
Sbjct  921  EYASRLISVNVQPSSLEAFPALWKALAPED  950



>ref|XP_002501700.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62958.1| predicted protein [Micromonas sp. RCC299]
Length=779

 Score =   102 bits (254),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 56/152 (37%), Positives = 82/152 (54%), Gaps = 4/152 (3%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+RMTNKPLP RHS +V G + PLK F++       L+ E   ++       +  +Y 
Sbjct  622  TATFRMTNKPLPTRHSHFVPGAVAPLKLFVEQTARKKILSAESATQVAMAVGEYVAGKYA  681

Query  503  ELAADLVNVARKTESSLQKIR----LGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEY  336
            E+A++LV   +KTE+SL +++          A    D  +   SDTDKIC QL LD+ E+
Sbjct  682  EMASELVAGVKKTEASLNRLKDRRAAKDGGSAAGGGDDGEKGPSDTDKICKQLLLDVVEF  741

Query  335  ARNLSSLGIDAATIPSYRSLWQCVAPTERQNI  240
               L+ LG D A    ++ LW  VAP   + +
Sbjct  742  GTQLTKLGTDPARSEKFKELWSLVAPEGEKQV  773



>ref|XP_003062630.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53449.1| predicted protein [Micromonas pusilla CCMP1545]
Length=774

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 87/157 (55%), Gaps = 20/157 (13%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
            TAT+RMTNKP P RHS +V  +L P +TFL+   +TT L+K+ R  L    A  +  +Y 
Sbjct  618  TATFRMTNKPTPTRHSHFVPNILAPARTFLESP-STTSLSKQTRRALACAVADGVCAKYS  676

Query  503  ELAADLVNVARKTESSLQKIR---------------LGAQRRAGASSDVSDHNISDTDKI  369
             LA++L+   +KTE+SL K++                    +AG++        +D +KI
Sbjct  677  ALASELLATVKKTEASLNKLKDRKAAAAKEGAGASASATTTKAGSAQ----QGPTDAEKI  732

Query  368  CMQLFLDIQEYARNLSSLGIDAATIPSYRSLWQCVAP  258
              Q+ LD++E+   L+++G+D A+  +++ LW   AP
Sbjct  733  VAQVTLDVREFGAQLAAMGVDPASRDAFKELWAVAAP  769



>ref|XP_002132051.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Ciona intestinalis]
Length=705

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 84/145 (58%), Gaps = 5/145 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            +R TN+P P   S YV+ +++P+  F  G+  T+Y+  EL    L   A  I+DR++ + 
Sbjct  560  FRKTNRPTPTEQSTYVTNLMKPIVAFHGGQ--TSYINDELLSHWLTQVAIPISDRFHSVV  617

Query  494  ADLVNVARKTESSL---QKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNL  324
            ++++   RK E SL   QK+R G +  +   + ++  ++SD DKI +QLF+D+  + + +
Sbjct  618  SEVLTSVRKMEESLLRLQKMRSGGKSSSSNLAALAGSSLSDDDKIRLQLFIDVTSFGKQM  677

Query  323  SSLGIDAATIPSYRSLWQCVAPTER  249
            S+ G    TIP Y+ L+Q V   ++
Sbjct  678  SACGGKMDTIPVYQKLFQLVEEAKK  702



>ref|XP_006817460.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Saccoglossus kowalevskii]
Length=672

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 87/139 (63%), Gaps = 9/139 (6%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLD--GERATTYLTKELRFELLQGAAFKITDRYYE  501
            YR TN+ +P + S YV  +++PL+ FL+  GE+  T    + R ELL G    +T  Y+ 
Sbjct  534  YRRTNREIPSKASVYVDNIIKPLQLFLEENGEKIKT----DRRGELLSGILTLLTQEYFG  589

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
            + +D+++  RK E SL+K+++   R+  + S+ S + +SD DKI +QL LD++++A  + 
Sbjct  590  VTSDVLDSVRKMEESLKKLKM---RKVTSVSNFSANGMSDDDKIRLQLALDVRQFAEEMD  646

Query  320  SLGIDAATIPSYRSLWQCV  264
            +LGI ++ IP Y SL + V
Sbjct  647  NLGIKSSDIPKYDSLSELV  665



>emb|CBN77515.1| weakly similar to brefeldin A-sensitive Golgi protein-like [Ectocarpus 
siliculosus]
Length=932

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 56/146 (38%), Positives = 81/146 (55%), Gaps = 11/146 (8%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFK------  522
            TATYRMTNKP P R SP+V  VLR L+ F D     +    E   E   GA +K      
Sbjct  775  TATYRMTNKPPPQRPSPFVPNVLRALREF-DSRWGASASGNER--EGGGGAGWKDRVVMS  831

Query  521  ITDRYYELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  342
            +  RY E+ ++L+   R+ E++L K R+ A+R  G+ +   D   SD DKI MQL  D++
Sbjct  832  VCSRYLEIVSELLLTVRQMENTLNKRRVTARR--GSRAGAGDQGPSDKDKIMMQLRFDVR  889

Query  341  EYARNLSSLGIDAATIPSYRSLWQCV  264
            E+ +  + LG+D ++ P Y  L + V
Sbjct  890  EFGKEAARLGVDVSSFPPYEGLLEVV  915



>ref|XP_002947088.1| component of oligomeric golgi complex 2 [Volvox carteri f. nagariensis]
 gb|EFJ51678.1| component of oligomeric golgi complex 2 [Volvox carteri f. nagariensis]
Length=1174

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 9/147 (6%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFEL-LQGAAFKITDRY  507
            TATYR+T+K  PVR S YVSGVL PL+  L+       L  EL+ EL +   A  +  RY
Sbjct  719  TATYRVTSKAPPVRASHYVSGVLTPLRQLLEAG-PVKRLAPELQQELVVVPVAEGVCSRY  777

Query  506  YELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARN  327
              LA +L+   RKTESSL++++  A+  AG   D S   +SD+DKI +QL LD++E    
Sbjct  778  AALADELLVSVRKTESSLKRLK-KAKGGAGGEED-SAAGLSDSDKITLQLHLDVEELGVQ  835

Query  326  LSSL----GID-AATIPSYRSLWQCVA  261
            L+ L    G D AA +P++R L + VA
Sbjct  836  LNQLLLPPGSDPAALLPAFRRLKEVVA  862



>ref|XP_004367588.1| hypothetical protein ACA1_252880 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22332.1| hypothetical protein ACA1_252880 [Acanthamoeba castellanii str. 
Neff]
Length=654

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 77/146 (53%), Gaps = 11/146 (8%)
 Frame = -3

Query  677  TYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYEL  498
            TYR+TNKP+P RHS YV  VL+PL+TFLD +RA  +++   R    +     I+ +Y+E+
Sbjct  511  TYRLTNKPVPTRHSYYVPNVLKPLQTFLDEKRA--HISPAARRLWAETVLTAISQKYHEM  568

Query  497  AADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSS  318
            + +L+    K ES L+K           ++      ++D DKI  QL LD+QE+ R  S 
Sbjct  569  STELLETVDKAESYLKKY------SPSKATQTEPGEMTDKDKIVRQLLLDVQEFGRQFSH  622

Query  317  LGIDAATIPS---YRSLWQCVAPTER  249
                 + +     Y  L Q +  T+R
Sbjct  623  FSDVVSNVHGFGPYSRLLQYITSTDR  648



>gb|EOB00851.1| Conserved oligomeric Golgi complex subunit 2, partial [Anas platyrhynchos]
Length=717

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R    L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYR--DILKQPMIHQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+  AS+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  630  SDVLNSVKKMEESLK--RLKQARKTAASNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G+D + I S+ +L + V   + Q
Sbjct  688  MGLDTSNIKSFSALTELVLTAKDQ  711



>ref|XP_005020290.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Anas 
platyrhynchos]
Length=735

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R    L + +  + L+GA  + T +YYE  
Sbjct  590  YRRTNKEVPTKASPYVDSALKPFYRLQNEYR--DILKQPMIHQWLEGALSESTQKYYETV  647

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+  AS+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  648  SDVLNSVKKMEESLK--RLKQARKTAASNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  705

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G+D + I S+ +L + V   + Q
Sbjct  706  MGLDTSNIKSFSALTELVLTAKDQ  729



>gb|KFO53927.1| Conserved oligomeric Golgi complex subunit 2, partial [Corvus 
brachyrhynchos]
Length=714

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 83/144 (58%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +G R T  L + +  + L+GA  + T +YYE  
Sbjct  569  YRRTNKEVPTKASPYVDSALKPFHRLQNGYRDT--LKQPMIHQWLEGALSESTQKYYETV  626

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  627  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQVQK  684

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  685  MGLETSSIKSFSALAELVLTAKDQ  708



>ref|XP_008641602.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Corvus 
brachyrhynchos]
Length=761

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 83/144 (58%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +G R T  L + +  + L+GA  + T +YYE  
Sbjct  616  YRRTNKEVPTKASPYVDSALKPFHRLQNGYRDT--LKQPMIHQWLEGALSESTQKYYETV  673

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  674  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQVQK  731

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  732  MGLETSSIKSFSALAELVLTAKDQ  755



>ref|XP_009944192.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Leptosomus 
discolor]
Length=206

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +    L+GA  + T +YYE  
Sbjct  61   YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDT--LKQPMIHHWLEGALSESTQKYYETV  118

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  119  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  176

Query  317  LGIDAATIPSYRSLWQCV  264
            +G++ ++I S+ +L + V
Sbjct  177  MGLETSSIKSFSALTELV  194



>ref|XP_003291862.1| hypothetical protein DICPUDRAFT_50102 [Dictyostelium purpureum]
 gb|EGC31604.1| hypothetical protein DICPUDRAFT_50102 [Dictyostelium purpureum]
Length=912

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 46/144 (32%), Positives = 80/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            +TYRMTNKP P + S YVS ++ PL+ FL  + A +++  +++          IT+ +  
Sbjct  767  STYRMTNKPPPTQASAYVSRIIEPLQLFLKNKAAPSHIPSDIKLNWAILVLTPITEGFKN  826

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
             A++++    ++   L K+    +R    SS  S + +SD DKI +QLFLD++++   + 
Sbjct  827  EASNVIQSVTQSNDILNKM---VKRNKPTSS--STNEMSDIDKISIQLFLDVEKFGNCIK  881

Query  320  SLGIDAATIPSYRSLWQCVAPTER  249
             LGID  +   Y SL + V P ++
Sbjct  882  DLGIDLLSFSQYLSLKELVEPFKK  905



>ref|XP_002999266.1| conserved oligomeric Golgi complex subunit, putative [Phytophthora 
infestans T30-4]
 gb|EEY69412.1| conserved oligomeric Golgi complex subunit, putative [Phytophthora 
infestans T30-4]
Length=750

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP P   S YVS ++RP++ FL  E+   +     R +LLQ     + D Y  L+
Sbjct  613  YQMTNKPPPTAPSTYVSNIIRPMQEFL--EKWGVHFDAAKRQQLLQAIVEDVCDVYSSLS  670

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            ++L+  A + E SL+  +L  QR +G+SS ++++ +SDT+K+ MQL LD+Q+  R  ++L
Sbjct  671  SELLRSALELEESLKSRKL--QRHSGSSSTLTNNAVSDTEKMRMQLLLDLQKIQREAAAL  728

Query  314  GIDA  303
            G+D 
Sbjct  729  GLDV  732



>ref|XP_781715.3| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Strongylocentrotus purpuratus]
Length=397

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 82/145 (57%), Gaps = 5/145 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TN+ +P + S YVS  L+PL+TF++  RA   L+   R E        IT  Y  ++
Sbjct  254  YRRTNREVPSKPSSYVSSTLKPLQTFVEDHRAI--LSDSRRQEWTLAVISNITKEYLAIS  311

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDH-NISDTDKICMQLFLDIQEYARNLSS  318
             +L+   +K E SL+  RL A ++ GA++  + H  +SD DKI +QL LD++ +A+ + +
Sbjct  312  TELLTSVKKMEDSLK--RLKALKKTGAAAGSTPHQGMSDDDKIRLQLALDVRFFAQQIDA  369

Query  317  LGIDAATIPSYRSLWQCVAPTERQN  243
            LG+ +  I  ++ L   V  T  Q+
Sbjct  370  LGLVSIEISVFQELSTLVESTVNQS  394



>ref|XP_009091144.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Serinus canaria]
Length=724

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R T  L + +  + L+GA  + T +YYE  
Sbjct  579  YRRTNKEVPTKASPYVDSALKPFYRLQNDYRDT--LKQPMIHQWLEGALSESTQKYYETV  636

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LDI+ +   +  
Sbjct  637  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDIEYFGEQMRK  694

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  695  MGLETSSIKSFSALAELVLTAKDQ  718



>dbj|BAE91354.1| unnamed protein product [Macaca fascicularis]
Length=199

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  54   YRRTNKEVPTTASSYVDSALKPLFQLQNGHK--DKLKQAIIQQWLEGALSESTHKYYETV  111

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+   ++ V     +SD DKI +QL LD++     +  
Sbjct  112  SDVLNSVKKMEESLK--RLKQARKTTPTNPVGPSGGMSDDDKIRLQLALDVEYLGEQIQK  169

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            LG+ A+ I S+ +L + VA  + Q
Sbjct  170  LGLQASDIKSFPALAELVAAAKDQ  193



>ref|XP_005423302.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Geospiza 
fortis]
Length=726

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R T  L + +  + L+GA  + T +YYE  
Sbjct  581  YRRTNKEVPTKASPYVDSALKPFYRLQNDYRDT--LKQPMIHQWLEGALSESTQKYYETV  638

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LDI+ +   +  
Sbjct  639  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDIEYFGEQIRK  696

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  697  MGLETSSIKSFSALAELVLTAKDQ  720



>gb|ETP19166.1| hypothetical protein F441_06722 [Phytophthora parasitica CJ01A1]
Length=1166

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP P   S YV  +++P++ FL  E+   +     + +LLQ    ++ D Y  L+
Sbjct  618  YQMTNKPPPTNPSTYVVSIIQPMQEFL--EKWGMHFDAAKKQQLLQAIVEEVCDVYSSLS  675

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            ++L+  A + E SL+  +L  QR +G+SS ++++ +SDT+K+ MQL LD+QE  R +++L
Sbjct  676  SELLRSALELEESLKSRKL--QRHSGSSSTLANNTVSDTEKMRMQLLLDLQEIQREVAAL  733

Query  314  GID  306
            G+D
Sbjct  734  GLD  736



>gb|ETP47094.1| hypothetical protein F442_06755 [Phytophthora parasitica P10297]
Length=1166

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP P   S YV  +++P++ FL  E+   +     + +LLQ    ++ D Y  L+
Sbjct  618  YQMTNKPPPTNPSTYVVSIIQPMQEFL--EKWGMHFDAAKKQQLLQAIVEEVCDVYSSLS  675

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            ++L+  A + E SL+  +L  QR +G+SS ++++ +SDT+K+ MQL LD+QE  R +++L
Sbjct  676  SELLRSALELEESLKSRKL--QRHSGSSSTLANNTVSDTEKMRMQLLLDLQEIQREVAAL  733

Query  314  GID  306
            G+D
Sbjct  734  GLD  736



>gb|ETO78126.1| hypothetical protein F444_06786 [Phytophthora parasitica P1976]
Length=1166

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP P   S YV  +++P++ FL  E+   +     + +LLQ    ++ D Y  L+
Sbjct  618  YQMTNKPPPTNPSTYVVSIIQPMQEFL--EKWGMHFDAAKKQQLLQAIVEEVCDVYSSLS  675

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            ++L+  A + E SL+  +L  QR +G+SS ++++ +SDT+K+ MQL LD+QE  R +++L
Sbjct  676  SELLRSALELEESLKSRKL--QRHSGSSSTLANNTVSDTEKMRMQLLLDLQEIQREVAAL  733

Query  314  GID  306
            G+D
Sbjct  734  GLD  736



>gb|ETI49393.1| hypothetical protein F443_06719 [Phytophthora parasitica P1569]
Length=1165

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP P   S YV  +++P++ FL  E+   +     + +LLQ    ++ D Y  L+
Sbjct  618  YQMTNKPPPTNPSTYVVSIIQPMQEFL--EKWGMHFDAAKKQQLLQAIVEEVCDVYSSLS  675

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            ++L+  A + E SL+  +L  QR +G+SS ++++ +SDT+K+ MQL LD+QE  R +++L
Sbjct  676  SELLRSALELEESLKSRKL--QRHSGSSSTLANNTVSDTEKMRMQLLLDLQEIQREVAAL  733

Query  314  GID  306
            G+D
Sbjct  734  GLD  736



>ref|XP_008892343.1| hypothetical protein PPTG_02808 [Phytophthora parasitica INRA-310]
 gb|ETN23145.1| hypothetical protein PPTG_02808 [Phytophthora parasitica INRA-310]
Length=757

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP P   S YV  +++P++ FL  E+   +     + +LLQ    ++ D Y  L+
Sbjct  618  YQMTNKPPPTNPSTYVVSIIQPMQEFL--EKWGMHFDAAKKQQLLQAIVEEVCDVYSSLS  675

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            ++L+  A + E SL+  +L  QR +G+SS ++++ +SDT+K+ MQL LD+QE  R +++L
Sbjct  676  SELLRSALELEESLKSRKL--QRHSGSSSTLANNTVSDTEKMRMQLLLDLQEIQREVAAL  733

Query  314  GID  306
            G+D
Sbjct  734  GLD  736



>gb|ETL95872.1| hypothetical protein L917_06400 [Phytophthora parasitica]
Length=757

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP P   S YV  +++P++ FL  E+   +     + +LLQ    ++ D Y  L+
Sbjct  618  YQMTNKPPPTNPSTYVVSIIQPMQEFL--EKWGMHFDAAKKQQLLQAIVEEVCDVYSSLS  675

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            ++L+  A + E SL+  +L  QR +G+SS ++++ +SDT+K+ MQL LD+QE  R +++L
Sbjct  676  SELLRSALELEESLKSRKL--QRHSGSSSTLANNTVSDTEKMRMQLLLDLQEIQREVAAL  733

Query  314  GID  306
            G+D
Sbjct  734  GLD  736



>gb|ETK89268.1| hypothetical protein L915_06592 [Phytophthora parasitica]
 gb|ETL42722.1| hypothetical protein L916_06530 [Phytophthora parasitica]
 gb|ETM49037.1| hypothetical protein L914_06503 [Phytophthora parasitica]
Length=1166

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP P   S YV  +++P++ FL  E+   +     + +LLQ    ++ D Y  L+
Sbjct  618  YQMTNKPPPTNPSTYVVSIIQPMQEFL--EKWGMHFDAAKKQQLLQAIVEEVCDVYSSLS  675

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            ++L+  A + E SL+  +L  QR +G+SS ++++ +SDT+K+ MQL LD+QE  R +++L
Sbjct  676  SELLRSALELEESLKSRKL--QRHSGSSSTLANNTVSDTEKMRMQLLLDLQEIQREVAAL  733

Query  314  GID  306
            G+D
Sbjct  734  GLD  736



>ref|XP_009870043.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Apaloderma vittatum]
Length=715

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YYE  
Sbjct  570  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDT--LKQPMIHQWLEGALSECTQKYYETV  627

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  628  SDVLSSVKKMEESLK--RLKQARRTTASNPVGTNGGMSDDDKIRLQLALDVEYFGEQVRK  685

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G+  + I S+ +L + V   + Q
Sbjct  686  MGLKTSNIESFSALTELVLTAKDQ  709



>ref|XP_010284176.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Phaethon lepturus]
Length=350

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YYE  
Sbjct  205  YRRTNKEVPTKASPYVDSALKPFYRLQNDYKDT--LKQPMIHQWLEGALSESTQKYYETV  262

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  263  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  320

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G+  ++I S+ +L + V   + Q
Sbjct  321  MGLQTSSIKSFSALAELVLAAKDQ  344



>ref|XP_009074061.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Acanthisitta chloris]
Length=439

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 80/138 (58%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T RYYE  
Sbjct  294  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDT--LKQSMVHQWLEGALSESTQRYYETV  351

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  352  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFREQIRK  409

Query  317  LGIDAATIPSYRSLWQCV  264
            +G++ ++I S+ +L + V
Sbjct  410  MGLETSSIKSFSALTELV  427



>ref|XP_010196213.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Colius striatus]
 gb|KFP30106.1| Conserved oligomeric Golgi complex subunit 2 [Colius striatus]
Length=740

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 81/145 (56%), Gaps = 6/145 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPY+   L+P     +  R T  L + +  + L+GA  + T +YYE  
Sbjct  594  YRRTNKEVPTKASPYIDSALKPFYRLQNKYRNT--LKQPMIHQWLEGALSESTQKYYETV  651

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDH--NISDTDKICMQLFLDIQEYARNLS  321
            +D+++  +K E SL+  RL   RR   S+ V  +   +SD +KI +QL LD++ +   + 
Sbjct  652  SDVLSSVKKMEESLK--RLKQARRTANSNPVGTNGGGMSDDNKIRLQLALDVEYFGEQIR  709

Query  320  SLGIDAATIPSYRSLWQCVAPTERQ  246
             +G+D ++I S+ +L + V   + Q
Sbjct  710  KMGLDTSSIKSFSALTELVQTAKDQ  734



>gb|KFP90068.1| Conserved oligomeric Golgi complex subunit 2, partial [Apaloderma 
vittatum]
Length=717

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDT--LKQPMIHQWLEGALSECTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTTASNPVGTNGGMSDDDKIRLQLALDVEYFGEQVRK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G+  + I S+ +L + V   + Q
Sbjct  688  MGLKTSNIESFSALTELVLTAKDQ  711



>ref|XP_010196214.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Colius striatus]
Length=739

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 81/145 (56%), Gaps = 6/145 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPY+   L+P     +  R T  L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTKASPYIDSALKPFYRLQNKYRNT--LKQPMIHQWLEGALSESTQKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDH--NISDTDKICMQLFLDIQEYARNLS  321
            +D+++  +K E SL+  RL   RR   S+ V  +   +SD +KI +QL LD++ +   + 
Sbjct  651  SDVLSSVKKMEESLK--RLKQARRTANSNPVGTNGGGMSDDNKIRLQLALDVEYFGEQIR  708

Query  320  SLGIDAATIPSYRSLWQCVAPTERQ  246
             +G+D ++I S+ +L + V   + Q
Sbjct  709  KMGLDTSSIKSFSALTELVQTAKDQ  733



>gb|KFP72142.1| Conserved oligomeric Golgi complex subunit 2, partial [Acanthisitta 
chloris]
Length=440

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 80/138 (58%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T RYYE  
Sbjct  295  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDT--LKQSMVHQWLEGALSESTQRYYETV  352

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  353  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFREQIRK  410

Query  317  LGIDAATIPSYRSLWQCV  264
            +G++ ++I S+ +L + V
Sbjct  411  MGLETSSIKSFSALTELV  428



>ref|XP_010389860.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Corvus 
cornix cornix]
Length=738

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R T  L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTKASPYVDSALKPFHRLQNDYRDT--LKQPMIHQWLEGALSESTQKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  651  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQVQK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  709  MGLETSSIKSFSALAELVLTAKDQ  732



>ref|XP_005491190.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Zonotrichia 
albicollis]
Length=764

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R T  L + +    L+GA  + T +YYE  
Sbjct  619  YRRTNKEVPTKASPYVDSALKPFYRLQNDYRDT--LKQPMIHHWLEGALSESTQKYYETV  676

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LDI+ +   +  
Sbjct  677  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDIEYFGEQIRK  734

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  735  MGLETSSIKSFSALAELVLTAKDQ  758



>gb|KFP64444.1| Conserved oligomeric Golgi complex subunit 2, partial [Cariama 
cristata]
Length=717

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R T  L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYRDT--LKQPMIRQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  688  MGLETSSIKSFSALTELVLTAKDQ  711



>ref|XP_009697273.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Cariama cristata]
Length=715

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R T  L + +  + L+GA  + T +YYE  
Sbjct  570  YRRTNKEVPTKASPYVDSALKPFYRLQNEYRDT--LKQPMIRQWLEGALSESTQKYYETV  627

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  628  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  685

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  686  MGLETSSIKSFSALTELVLTAKDQ  709



>ref|XP_005518612.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Pseudopodoces humilis]
Length=737

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R    L + +  + L GA  + T +YYE  
Sbjct  592  YRRTNKEVPTKASPYVDSALKPFHRLQNDYRDA--LKQPMIHQWLAGALSESTQKYYETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  650  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  707

Query  317  LGIDAATIPSYRSLWQCVAPTERQNII  237
            +G++ ++I S+ +L + V   + Q  +
Sbjct  708  MGLETSSIKSFSALAELVLTAKDQATV  734



>ref|XP_005518611.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Pseudopodoces humilis]
Length=738

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R    L + +  + L GA  + T +YYE  
Sbjct  593  YRRTNKEVPTKASPYVDSALKPFHRLQNDYRDA--LKQPMIHQWLAGALSESTQKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  651  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQNII  237
            +G++ ++I S+ +L + V   + Q  +
Sbjct  709  MGLETSSIKSFSALAELVLTAKDQATV  735



>gb|KFQ55583.1| Conserved oligomeric Golgi complex subunit 2, partial [Nestor 
notabilis]
Length=712

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YY+  
Sbjct  567  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKGT--LKQPMIHQWLEGALSESTQKYYDTV  624

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ Y   +  
Sbjct  625  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYYGEQIRK  682

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  683  MGLETSSIKSFSALTELVLTAKDQ  706



>ref|XP_010560976.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Haliaeetus leucocephalus]
 ref|XP_010560977.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Haliaeetus leucocephalus]
Length=626

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 80/138 (58%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P    L  E   T L + +  + L+GA  + T +YYE  
Sbjct  481  YRRTNKEVPTKASPYVDSALKPF-YLLQNEYKDT-LKQPMVHQWLEGALSESTQKYYETV  538

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  539  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  596

Query  317  LGIDAATIPSYRSLWQCV  264
            +G++ ++I S+ +L + V
Sbjct  597  MGLETSSIKSFSALTELV  614



>ref|XP_010560978.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X4 [Haliaeetus leucocephalus]
Length=623

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 80/138 (58%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P    L  E   T L + +  + L+GA  + T +YYE  
Sbjct  478  YRRTNKEVPTKASPYVDSALKPF-YLLQNEYKDT-LKQPMVHQWLEGALSESTQKYYETV  535

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  536  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  593

Query  317  LGIDAATIPSYRSLWQCV  264
            +G++ ++I S+ +L + V
Sbjct  594  MGLETSSIKSFSALTELV  611



>ref|XP_010019366.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Nestor notabilis]
Length=713

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YY+  
Sbjct  568  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKGT--LKQPMIHQWLEGALSESTQKYYDTV  625

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ Y   +  
Sbjct  626  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYYGEQIRK  683

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  684  MGLETSSIKSFSALTELVLTAKDQ  707



>ref|XP_005043524.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Ficedula 
albicollis]
Length=796

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  R T  L + +  + L+GA  + T +YYE  
Sbjct  651  YRRTNKEVPTKASPYVDSALKPFFRLQNDYRDT--LKQPMIHQWLEGALSESTQKYYETV  708

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  709  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  766

Query  317  LGIDAATIPSY  285
            +G++ ++I S+
Sbjct  767  MGLETSSIKSF  777



>gb|KFZ60054.1| Conserved oligomeric Golgi complex subunit 2, partial [Podiceps 
cristatus]
Length=717

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMVHQWLEGAVSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDDKIRLQLALDVEYFGEQIQK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQNII  237
            +G++ ++I S+ +L + V   + Q  +
Sbjct  688  MGLETSSIKSFSALTELVLTAKDQATV  714



>gb|KFP94737.1| Conserved oligomeric Golgi complex subunit 2, partial [Haliaeetus 
albicilla]
Length=717

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P    L  E   T L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPF-YLLQNEYKDT-LKQPMVHQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  688  MGLETSSIKSFSALTELVLTAKDQ  711



>ref|XP_005440304.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Falco cherrug]
Length=739

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  594  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDA--LKQPMIHQWLEGALSESTQKYYETV  651

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  652  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  709

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  710  MGLETSSIKSFSALTELVLTAKDQ  733



>ref|XP_005239169.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Falco 
peregrinus]
Length=720

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  575  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDA--LKQPMIHQWLEGALSESTQKYYETV  632

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  633  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  690

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  691  MGLETSSIKSFSALTELVLTAKDQ  714



>ref|XP_010560975.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Haliaeetus leucocephalus]
Length=712

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P    L  E   T L + +  + L+GA  + T +YYE  
Sbjct  567  YRRTNKEVPTKASPYVDSALKPF-YLLQNEYKDT-LKQPMVHQWLEGALSESTQKYYETV  624

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  625  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  682

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  683  MGLETSSIKSFSALTELVLTAKDQ  706



>ref|XP_010560974.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Haliaeetus leucocephalus]
Length=734

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P    L  E   T L + +  + L+GA  + T +YYE  
Sbjct  589  YRRTNKEVPTKASPYVDSALKPF-YLLQNEYKDT-LKQPMVHQWLEGALSESTQKYYETV  646

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  647  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  704

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  705  MGLETSSIKSFSALTELVLTAKDQ  728



>ref|XP_005440305.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Falco cherrug]
Length=738

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDA--LKQPMIHQWLEGALSESTQKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  651  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  709  MGLETSSIKSFSALTELVLTAKDQ  732



>gb|KFW80703.1| Conserved oligomeric Golgi complex subunit 2 [Manacus vitellinus]
Length=723

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YYE  
Sbjct  578  YRRTNKEVPAKASPYVDSALKPFYRLQNEYKDT--LKQPMIHQWLEGALSESTQKYYETV  635

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  636  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  693

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  694  MGLETSSIRSFSALTELVLTAKDQ  717



>ref|XP_008921823.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Manacus vitellinus]
Length=734

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YYE  
Sbjct  589  YRRTNKEVPAKASPYVDSALKPFYRLQNEYKDT--LKQPMIHQWLEGALSESTQKYYETV  646

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  647  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  704

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  705  MGLETSSIRSFSALTELVLTAKDQ  728



>ref|XP_009921343.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Haliaeetus albicilla]
Length=752

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P    L  E   T L + +  + L+GA  + T +YYE  
Sbjct  607  YRRTNKEVPTKASPYVDSALKPF-YLLQNEYKDT-LKQPMVHQWLEGALSESTQKYYETV  664

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  665  SDVLSSVKKMEESLK--RLKQARRTTTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  722

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  723  MGLETSSIKSFSALTELVLTAKDQ  746



>ref|XP_008921822.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Manacus vitellinus]
Length=735

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YYE  
Sbjct  590  YRRTNKEVPAKASPYVDSALKPFYRLQNEYKDT--LKQPMIHQWLEGALSESTQKYYETV  647

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  648  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  705

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  706  MGLETSSIRSFSALTELVLTAKDQ  729



>ref|XP_004898237.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
 ref|XP_004854734.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
 gb|EHB11545.1| Conserved oligomeric Golgi complex subunit 2 [Heterocephalus 
glaber]
Length=738

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 77/146 (53%), Gaps = 5/146 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P      G R    L   +  + L+GA  + T +Y E  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPFYQLQSGHR--NKLKPAVMQQWLEGALSESTHKYCETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   RRA A+S V S   +SD DKI +QL LD++     +  
Sbjct  651  SDVLNSVKKMEESLK--RLKQARRAPATSTVGSSGGMSDDDKIRLQLALDVEYLGEQIQK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQNI  240
            +G+  ++I S+ +L + +A    Q +
Sbjct  709  MGLQTSSIKSFEALTELMAAARDQAV  734



>ref|XP_009829212.1| hypothetical protein H257_05897 [Aphanomyces astaci]
 gb|ETV81354.1| hypothetical protein H257_05897 [Aphanomyces astaci]
Length=716

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 72/141 (51%), Gaps = 6/141 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            Y+MTNKP+P   S YV+ V RPL  FL   R     T  L  ++L        D Y   A
Sbjct  581  YQMTNKPMPTTPSTYVATVTRPLDEFLAKWREDVG-THPLASDVLS----TTMDSYASAA  635

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
             DL+  A + E SL K R   +     SS + D  +SDTDK+  QLFLD+QE AR  S  
Sbjct  636  LDLLKSATELEESL-KSRKNQRLMMQTSSALVDDAVSDTDKMRRQLFLDMQELARIASDF  694

Query  314  GIDAATIPSYRSLWQCVAPTE  252
            G+D     SY+ + Q VA  +
Sbjct  695  GVDITQFASYQRMRQDVASND  715



>gb|KFP07462.1| Conserved oligomeric Golgi complex subunit 2, partial [Calypte 
anna]
Length=656

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  E L+GA  + T +YYE  
Sbjct  516  YRRTNKEVPTKASPYVESALKPFYRLQNEYK--DRLKQPMIQEWLEGALSESTQKYYETV  573

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   R+  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  574  SDVLSSVKKMEESLK--RLKQARKTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  631

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  632  MGLETSSIKSFSALSELVLSAKDQ  655



>gb|KFR13493.1| Conserved oligomeric Golgi complex subunit 2, partial [Opisthocomus 
hoazin]
Length=717

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G+D ++I S+ +L + V   + Q
Sbjct  688  MGLDTSSIKSFPALAELVLTAKDQ  711



>ref|XP_009571302.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Fulmarus 
glacialis]
Length=404

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  259  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  316

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  317  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  374

Query  317  LGIDAATIPSYRSLWQCVAPTERQNII  237
            +G++ ++I S+ +L + V   + Q  +
Sbjct  375  MGLETSSIKSFSALTELVLSAKDQATV  401



>ref|XP_010002540.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Chaetura pelagica]
Length=715

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  E L+ A  + T +YYE  
Sbjct  570  YRRTNKEVPSKASPYVDSALKPFHRLQNEYK--DILKQSMVHEWLESALSECTQKYYETV  627

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  628  SDVLSSVKKMEESLK--RLKQARRTPASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  685

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  686  MGLETSSIKSFSALTELVLTAKDQ  709



>gb|KFU94611.1| Conserved oligomeric Golgi complex subunit 2, partial [Chaetura 
pelagica]
Length=717

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  E L+ A  + T +YYE  
Sbjct  572  YRRTNKEVPSKASPYVDSALKPFHRLQNEYK--DILKQSMVHEWLESALSECTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTPASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  688  MGLETSSIKSFSALTELVLTAKDQ  711



>ref|XP_010147792.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Eurypyga helias]
Length=715

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  570  YRRTNKEVPTKASPYVDSALKPFYRLHNEYK--DILKQPMIHQWLEGALSESTQKYYETV  627

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  628  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEEVRK  685

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  686  MGLETSSIKSFSALTELVLTAKDQ  709



>ref|XP_008500618.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Calypte 
anna]
Length=704

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  E L+GA  + T +YYE  
Sbjct  561  YRRTNKEVPTKASPYVESALKPFYRLQNEYK--DRLKQPMIQEWLEGALSESTQKYYETV  618

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   R+  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  619  SDVLSSVKKMEESLK--RLKQARKTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  676

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  677  MGLETSSIKSFSALSELVLSAKDQ  700



>gb|KFW03254.1| Conserved oligomeric Golgi complex subunit 2, partial [Eurypyga 
helias]
Length=718

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  573  YRRTNKEVPTKASPYVDSALKPFYRLHNEYK--DILKQPMIHQWLEGALSESTQKYYETV  630

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  631  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEEVRK  688

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  689  MGLETSSIKSFSALTELVLTAKDQ  712



>gb|KFW00567.1| Conserved oligomeric Golgi complex subunit 2, partial [Fulmarus 
glacialis]
Length=422

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  277  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  334

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  335  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  392

Query  317  LGIDAATIPSYRSLWQCVAPTERQNII  237
            +G++ ++I S+ +L + V   + Q  +
Sbjct  393  MGLETSSIKSFSALTELVLSAKDQATV  419



>gb|KFQ91617.1| Conserved oligomeric Golgi complex subunit 2, partial [Nipponia 
nippon]
Length=717

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQNII  237
            +G++ ++I S+ +L + V   + Q  +
Sbjct  688  MGLETSSIKSFSALTELVITAKDQATV  714



>ref|XP_009936334.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Opisthocomus 
hoazin]
Length=870

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  725  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  782

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  783  SDVLSSVKKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  840

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G+D ++I S+ +L + V   + Q
Sbjct  841  MGLDTSSIKSFPALAELVLTAKDQ  864



>gb|ELT94120.1| hypothetical protein CAPTEDRAFT_214095 [Capitella teleta]
Length=764

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 82/146 (56%), Gaps = 9/146 (6%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TN+ +P + S YV+ VL+P++ F++     T     + +   +G    I+++Y  + 
Sbjct  624  YRRTNREVPSKSSVYVTSVLQPIEFFIEEHSEMTSSANIVHWT--KGILRCISEQYLTVT  681

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            AD++   RK E SL++++     R   SS+ + H +SD DKI +QL+LD+Q++ + + SL
Sbjct  682  ADVLTSVRKMEESLKRLK-----RGKGSSNAAQHGMSDDDKIRLQLYLDVQQFGQQIPSL  736

Query  314  G--IDAATIPSYRSLWQCVAPTERQN  243
               I A+ I ++  L   V   ++ N
Sbjct  737  WPEISASDIDNFDDLMTVVVNAKKGN  762



>ref|XP_009469603.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nipponia 
nippon]
Length=774

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  629  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  686

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  687  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  744

Query  317  LGIDAATIPSYRSLWQCVAPTERQNII  237
            +G++ ++I S+ +L + V   + Q  +
Sbjct  745  MGLETSSIKSFSALTELVITAKDQATV  771



>ref|XP_009565362.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Cuculus canorus]
Length=738

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--NILKQPMIHQWLEGALSESTQKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  651  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  709  MGLERSSIKSFSALAELVLTAKDQ  732



>ref|XP_009565361.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Cuculus canorus]
 gb|KFO80730.1| Conserved oligomeric Golgi complex subunit 2 [Cuculus canorus]
Length=739

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  594  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--NILKQPMIHQWLEGALSESTQKYYETV  651

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD DKI +QL LD++ +   +  
Sbjct  652  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  709

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  710  MGLERSSIKSFSALAELVLTAKDQ  733



>ref|XP_007987957.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Chlorocebus 
sabaeus]
Length=738

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 79/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLFQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  651  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  710  GLQASDIKSFPALTELVAAAKDQ  732



>ref|XP_010372341.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Rhinopithecus roxellana]
Length=738

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 79/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLFQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  651  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  710  GLQASDIKSFPALAELVAAAKDQ  732



>ref|XP_010372342.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Rhinopithecus roxellana]
Length=737

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 79/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  592  YRRTNKEVPTTASSYVDSALKPLFQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  650  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  708

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  709  GLQASDIKSFPALAELVAAAKDQ  731



>gb|KFP20406.1| Conserved oligomeric Golgi complex subunit 2, partial [Egretta 
garzetta]
Length=717

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +A  +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDNKIRLQLALDVEYFAEQIRK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  688  MGLETSSIKSFSALTELVLTAKDQ  711



>ref|XP_002809356.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Pongo 
abelii]
Length=738

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 78/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL  F    R    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPL--FQLQSRHKDKLKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  651  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVENLGEQIQKL  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  710  GLQASDIKSFPALAELVAAAKDQ  732



>ref|XP_009642480.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Egretta 
garzetta]
Length=720

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  575  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  632

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +A  +  
Sbjct  633  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDNKIRLQLALDVEYFAEQIRK  690

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  691  MGLETSSIKSFSALTELVLTAKDQ  714



>ref|XP_009280091.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Aptenodytes 
forsteri]
Length=811

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+ A  + T +YYE  
Sbjct  666  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLESALSESTQKYYETV  723

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  724  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  781

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  782  MGVETSSIKSFSALTELVLTAKDQ  805



>ref|XP_005539862.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X4 [Macaca fascicularis]
Length=680

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  535  YRRTNKEVPTTASSYVDSALKPLFQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  592

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+   ++ V     +SD DKI +QL LD++     +  
Sbjct  593  SDVLNSVKKMEESLK--RLKQARKTTPTNPVGPSGGMSDDDKIRLQLALDVEYLGEQIQK  650

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            LG+ A+ I S+ +L + VA  + Q
Sbjct  651  LGLQASDIKSFPALAELVAAAKDQ  674



>ref|XP_003893831.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Papio 
anubis]
Length=738

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLFQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+   ++ V     +SD DKI +QL LD++     +  
Sbjct  651  SDVLNSVKKMEESLK--RLKQARKTTPTNPVGPSGGMSDDDKIRLQLALDVEYLGEQIQK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            LG+ A+ I S+ +L + VA  + Q
Sbjct  709  LGLQASDIKSFPALAELVAAAKDQ  732



>gb|KFM09209.1| Conserved oligomeric Golgi complex subunit 2, partial [Aptenodytes 
forsteri]
Length=716

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+ A  + T +YYE  
Sbjct  571  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLESALSESTQKYYETV  628

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  629  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  686

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  687  MGVETSSIKSFSALTELVLTAKDQ  710



>ref|XP_005539859.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Macaca fascicularis]
Length=740

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  595  YRRTNKEVPTTASSYVDSALKPLFQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  652

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+   ++ V     +SD DKI +QL LD++     +  
Sbjct  653  SDVLNSVKKMEESLK--RLKQARKTTPTNPVGPSGGMSDDDKIRLQLALDVEYLGEQIQK  710

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            LG+ A+ I S+ +L + VA  + Q
Sbjct  711  LGLQASDIKSFPALAELVAAAKDQ  734



>ref|XP_005539861.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Macaca fascicularis]
Length=737

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  592  YRRTNKEVPTTASSYVDSALKPLFQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+   ++ V     +SD DKI +QL LD++     +  
Sbjct  650  SDVLNSVKKMEESLK--RLKQARKTTPTNPVGPSGGMSDDDKIRLQLALDVEYLGEQIQK  707

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            LG+ A+ I S+ +L + VA  + Q
Sbjct  708  LGLQASDIKSFPALAELVAAAKDQ  731



>ref|XP_002808309.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 2-like [Macaca mulatta]
 ref|XP_005539860.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Macaca fascicularis]
 gb|EHH15962.1| hypothetical protein EGK_02145 [Macaca mulatta]
 gb|EHH61454.1| hypothetical protein EGM_20105 [Macaca fascicularis]
Length=738

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLFQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+   ++ V     +SD DKI +QL LD++     +  
Sbjct  651  SDVLNSVKKMEESLK--RLKQARKTTPTNPVGPSGGMSDDDKIRLQLALDVEYLGEQIQK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            LG+ A+ I S+ +L + VA  + Q
Sbjct  709  LGLQASDIKSFPALAELVAAAKDQ  732



>ref|XP_002158309.2| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Hydra vulgaris]
Length=677

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 72/142 (51%), Gaps = 10/142 (7%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK  P   S YV   + PL  F       T L++  R ++L  +   +++RYY L 
Sbjct  534  YRRTNKEPPSEPSKYVLNAIIPLNKFASN---ATMLSENQRHDILSSSLGNLSERYYTLV  590

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSD-----VSDHNISDTDKICMQLFLDIQEYAR  330
             +L+   RKTE SL  +RL  QR+A +        V+   +SD +KI  QL LD + +  
Sbjct  591  DELLTAIRKTEDSL--LRLKQQRKAASGQSEVNQLVNTSEVSDENKIRKQLLLDSEAFGH  648

Query  329  NLSSLGIDAATIPSYRSLWQCV  264
            ++S+LG    + P+Y  L   V
Sbjct  649  HMSTLGFTGESFPAYLKLMNVV  670



>ref|XP_004088075.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
2 [Nomascus leucogenys]
Length=622

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 78/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+GA  + T +YYE  
Sbjct  477  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGALNESTHKYYETV  534

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  535  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  593

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  594  GLQASDIKSFPALAELVAAAKDQ  616



>ref|XP_003267296.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
1 [Nomascus leucogenys]
Length=679

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 78/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+GA  + T +YYE  
Sbjct  534  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGALNESTHKYYETV  591

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  592  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  650

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  651  GLQASDIKSFPALAELVAAAKDQ  673



>ref|XP_009499491.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Phalacrocorax carbo]
Length=715

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 80/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P   F         L + +  + L+GA  + T +YYE  
Sbjct  570  YRRTNKEVPTKASPYVDSALKPF--FRLQNEYKDILKQPVIHQWLEGALSESTQKYYETV  627

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  628  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  685

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  686  MGLETSSIKSFSALTELVLTAKDQ  709



>gb|KFW89140.1| Conserved oligomeric Golgi complex subunit 2, partial [Phalacrocorax 
carbo]
Length=717

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 80/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P   F         L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPF--FRLQNEYKDILKQPVIHQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  688  MGLETSSIKSFSALTELVLTAKDQ  711



>ref|XP_009327513.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Pygoscelis 
adeliae]
Length=784

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+ A  + T +YYE  
Sbjct  639  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLESALSESTQKYYETV  696

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  697  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  754

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  755  MGVETSSIKSFSALTELVLTAKDQ  778



>gb|KFW70739.1| Conserved oligomeric Golgi complex subunit 2, partial [Pygoscelis 
adeliae]
Length=717

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+ A  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLESALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  688  MGVETSSIKSFSALTELVLTAKDQ  711



>ref|XP_007662934.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Ornithorhynchus 
anatinus]
Length=705

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV G L+P     +  R T  L   L  + L+ A  +   RY +  
Sbjct  560  YRRTNKEVPSKASPYVDGALKPFHQLQEDHRDT--LPPTLARQWLEEALSESARRYIDTV  617

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  RK E SL++++  A++ A  +   S   +SD DKI +QL LD++ +   +  +
Sbjct  618  SDVLSSVRKMEESLKRLK-QARKAAAVTPAGSSGGMSDDDKIRLQLALDVERFVEQVRGM  676

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+  + I S+ +L +  A  + Q
Sbjct  677  GLQTSDIDSFSALIELAAAAKEQ  699



>ref|XP_010137889.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Buceros rhinoceros silvestris]
Length=140

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 76/131 (58%), Gaps = 5/131 (4%)
 Frame = -3

Query  653  LPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVA  474
            +P + SPYV   L+P     +  + T  L + +  + L+GA  + T +YYE  +D+++  
Sbjct  2    VPTKASPYVDSALKPFFRLQNEYKNT--LKQPVIHQWLEGALSETTQKYYETVSDVLSSV  59

Query  473  RKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSSLGIDAAT  297
            +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  +G++A++
Sbjct  60   KKMEESLK--RLKQARRTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIQKMGLEASS  117

Query  296  IPSYRSLWQCV  264
            + S+ +L + V
Sbjct  118  VKSFSALAELV  128



>ref|XP_010705329.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Meleagris 
gallopavo]
Length=739

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + S YV   L+P     +  R    L + +  + L+GA  + T RYYE  
Sbjct  594  YRRTNKEVPTKASSYVDSALKPFYRLQNEYR--NVLKQPMIHQWLEGALSESTQRYYETV  651

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  A + V ++  +SD DKI +QL LD++ +   +  
Sbjct  652  SDVLSSVKKMEESLK--RLKQARRTAALNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  709

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++   I S+ +L + V   + Q
Sbjct  710  MGLETNNIKSFSALTELVLSAKDQ  733



>ref|XP_010192959.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Mesitornis unicolor]
 gb|KFQ29464.1| Conserved oligomeric Golgi complex subunit 2 [Mesitornis unicolor]
Length=734

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  589  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMILQWLEGALSESTQKYYETV  646

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  647  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQVRK  704

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  705  MGLETSSIKSFSALTELVLSAKDQ  728



>gb|KFO15367.1| Conserved oligomeric Golgi complex subunit 2, partial [Balearica 
regulorum gibbericeps]
Length=717

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQSMIHQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   R+   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  630  SDVLSSVKKMEESLK--RLKQARKTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  687

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  688  MGLETSSIKSFSALTELVLTAKDQ  711



>ref|XP_010192960.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Mesitornis unicolor]
Length=733

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  588  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMILQWLEGALSESTQKYYETV  645

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  646  SDVLSSVKKMEESLK--RLKQARRTVTSNPVGTNGGMSDDNKIRLQLALDVEYFGEQVRK  703

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  704  MGLETSSIKSFSALTELVLSAKDQ  727



>ref|XP_010309769.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Balearica regulorum gibbericeps]
Length=715

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  570  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQSMIHQWLEGALSESTQKYYETV  627

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   R+   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  628  SDVLSSVKKMEESLK--RLKQARKTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  685

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  686  MGLETSSIKSFSALTELVLTAKDQ  709



>ref|XP_005106374.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Aplysia californica]
Length=795

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 68/133 (51%), Gaps = 5/133 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + S Y+SGV++PL  F +    T  L ++ + E L      +  ++ E+ 
Sbjct  654  YRRTNKEVPTKPSTYLSGVVKPLTHFCEEHSGT--LKEQQKLEFLTHVFISLAKQFSEVT  711

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
             +++   RK E SL+++R   + R G         +SD+DKI  Q+ +DI  +   +  L
Sbjct  712  TEVLTSTRKMEESLRRLR---KARGGEKEKEKSGGVSDSDKIRTQIIIDINSFHEQMKQL  768

Query  314  GIDAATIPSYRSL  276
            G+   +I  Y  L
Sbjct  769  GLQPVSIDGYSEL  781



>ref|XP_005715264.1| unnamed protein product [Chondrus crispus]
 emb|CDF35445.1| unnamed protein product [Chondrus crispus]
Length=806

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 76/143 (53%), Gaps = 6/143 (4%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYE  501
            ATYRM++K  P  HS +V  +LRPLK F         L +  R ++      + +  Y+ 
Sbjct  601  ATYRMSSKQAPNTHSTFVPKILRPLKIFTKEYEDAIELVE--RTKIATVVCEQTSMEYFN  658

Query  500  LAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLS  321
            +A DL+   + +E++L+++ +G   R+G S+  S   +S  +KI MQL+LD+ ++  ++ 
Sbjct  659  MATDLLQRNKSSEATLRRLNIG---RSGTSTG-SGSAMSVIEKISMQLYLDVAKFMDDIR  714

Query  320  SLGIDAATIPSYRSLWQCVAPTE  252
              G+    +PS   LW  V   E
Sbjct  715  GFGVSTDQVPSLACLWNSVKRVE  737



>dbj|BAH13668.1| unnamed protein product [Homo sapiens]
Length=427

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+G   + T +YYE  
Sbjct  282  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGTLSESTHKYYETV  339

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  340  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  398

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  399  GLQASDIKSFSALAELVAAAKDQ  421



>ref|XP_794127.3| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Strongylocentrotus 
purpuratus]
Length=739

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 81/145 (56%), Gaps = 5/145 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TN+ +P + S YVS  L+PL+TF++  RA   L+   R E        IT  Y  ++
Sbjct  596  YRRTNREVPSKPSSYVSSTLKPLQTFVEDHRAI--LSDSRRQEWTLAVISNITKEYLAIS  653

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDH-NISDTDKICMQLFLDIQEYARNLSS  318
             +L+   +K E SL+  RL A ++ GA++  + +  +SD DKI +QL LD++ +A+ + +
Sbjct  654  TELLTSVKKMEDSLK--RLKALKKTGAAAGSTPYQGMSDDDKIRLQLALDVRFFAQQIDA  711

Query  317  LGIDAATIPSYRSLWQCVAPTERQN  243
             G+ +  I  ++ L   V  T  Q+
Sbjct  712  FGLVSIEISVFQELSTLVEATVNQS  736



>gb|KDD75489.1| hypothetical protein H632_c659p0 [Helicosporidium sp. ATCC 50920]
Length=166

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 79/143 (55%), Gaps = 4/143 (3%)
 Frame = -3

Query  683  TATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYY  504
             AT+RMT++  P+R S YV+ +L+PL   +        L  ++R EL+Q    ++   + 
Sbjct  16   VATFRMTSRAAPLRPSQYVAQLLQPLAQSVSEGGVAARLENDMRQELVQLTLERLARHFL  75

Query  503  ELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDK-ICMQLFLDIQEYAR-  330
             +A + ++V RKTESSL++ +  +++R       +    SDT   +  QL LD++E+AR 
Sbjct  76   GVAGETLSVVRKTESSLRRFK--SRQRLAEGQAQAAAAPSDTGSLVAQQLALDVEEFARL  133

Query  329  NLSSLGIDAATIPSYRSLWQCVA  261
              + LG+DA  + +Y  L   +A
Sbjct  134  AKTELGVDATQMEAYAELVAVIA  156



>ref|XP_005706755.1| oligomeric Golgi complex component COG2-like protein [Galdieria 
sulphuraria]
 gb|EME30235.1| oligomeric Golgi complex component COG2-like protein [Galdieria 
sulphuraria]
Length=657

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 71/125 (57%), Gaps = 13/125 (10%)
 Frame = -3

Query  680  ATYRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKE--LRFELLQGAAFKITDRY  507
            A YRMT KP+P  HSP+VS +LRPL+  L        ++KE  L+  ++     ++ +RY
Sbjct  531  AAYRMTTKPVPKHHSPFVSNILRPLRDVLQ------LISKEEDLKSPIVDTVCQQVVERY  584

Query  506  YELAADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARN  327
              + A++++  RK E +L+++ LG      +SS  +  N+SD +KI  QL LD ++    
Sbjct  585  IAMTAEIISSVRKAEDTLKRLNLGR-----SSSGNNSENVSDLEKIRRQLELDGKKLTEE  639

Query  326  LSSLG  312
            L  +G
Sbjct  640  LKQIG  644



>ref|XP_005148648.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Melopsittacus undulatus]
Length=738

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 79/137 (58%), Gaps = 3/137 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+ A  + T +YYE  
Sbjct  593  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKGT--LKQPMIHQWLESALSESTQKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  +K E SL++++  A+R A  +   ++  +SD +KI +QL LD++ Y   +  +
Sbjct  651  SDVLSSVKKMEESLKRLK-QARRTATPNPVGTNGGMSDDNKIRLQLALDVEYYGEQIRKM  709

Query  314  GIDAATIPSYRSLWQCV  264
            G++ + + S+ +L + V
Sbjct  710  GLETSNLKSFSALTELV  726



>ref|XP_005148647.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Melopsittacus undulatus]
Length=739

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 79/137 (58%), Gaps = 3/137 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +  + L+ A  + T +YYE  
Sbjct  594  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKGT--LKQPMIHQWLESALSESTQKYYETV  651

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  +K E SL++++  A+R A  +   ++  +SD +KI +QL LD++ Y   +  +
Sbjct  652  SDVLSSVKKMEESLKRLK-QARRTATPNPVGTNGGMSDDNKIRLQLALDVEYYGEQIRKM  710

Query  314  GIDAATIPSYRSLWQCV  264
            G++ + + S+ +L + V
Sbjct  711  GLETSNLKSFSALTELV  727



>dbj|BAH13805.1| unnamed protein product [Homo sapiens]
Length=622

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+G   + T +YYE  
Sbjct  477  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGTLSESTHKYYETV  534

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  535  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  593

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  594  GLQASDIKSFSALAELVAAAKDQ  616



>ref|XP_004028612.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
2 [Gorilla gorilla gorilla]
Length=679

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 78/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G++    L + +  + L+G   + T +YYE  
Sbjct  534  YRRTNKEVPTTASSYVDSALKPLFQLQSGQKDK--LKQAIIQQWLEGTLSESTHKYYETV  591

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  592  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  650

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  651  GLQASDIKSFPALSELVAAAKDQ  673



>dbj|BAH12018.1| unnamed protein product [Homo sapiens]
Length=679

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+G   + T +YYE  
Sbjct  534  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGTLSESTHKYYETV  591

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  592  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  650

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  651  GLQASDIKSFSALAELVAAAKDQ  673



>ref|XP_004028611.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
1 [Gorilla gorilla gorilla]
Length=738

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 78/143 (55%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G++    L + +  + L+G   + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLFQLQSGQKDK--LKQAIIQQWLEGTLSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  651  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  710  GLQASDIKSFPALSELVAAAKDQ  732



>ref|XP_007127671.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Physeter 
catodon]
Length=717

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 74/143 (52%), Gaps = 2/143 (1%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL    +G +    L + +  + L+GA  + T +YYE  
Sbjct  571  YRRTNKEVPTTASSYVDSALKPLYQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETV  628

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  RK E SL++++   +      +  S   +SD DKI +QL LD+      +  +
Sbjct  629  SDVLNSVRKMEESLKRLKQARRTAPATPAGPSGGGMSDDDKIRLQLALDVAYLGEQIEKI  688

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+    I S+ +L + VA  + Q
Sbjct  689  GLRTKDIRSFPALTELVAAAKDQ  711



>ref|NP_031383.1| conserved oligomeric Golgi complex subunit 2 isoform 1 [Homo 
sapiens]
 sp|Q14746.1|COG2_HUMAN RecName: Full=Conserved oligomeric Golgi complex subunit 2; Short=COG 
complex subunit 2; AltName: Full=Component of oligomeric 
Golgi complex 2; AltName: Full=Low density lipoprotein 
receptor defect C-complementing protein [Homo sapiens]
 emb|CAA84427.1| Cog2 protein [Homo sapiens]
 gb|AAH14960.1| Component of oligomeric golgi complex 2 [Homo sapiens]
 gb|EAW69915.1| component of oligomeric golgi complex 2, isoform CRA_a [Homo 
sapiens]
 gb|ABM83170.1| component of oligomeric golgi complex 2 [synthetic construct]
 gb|ABM86371.1| component of oligomeric golgi complex 2 [synthetic construct]
 gb|ABW03786.1| component of oligomeric golgi complex 2 [synthetic construct]
 dbj|BAG35559.1| unnamed protein product [Homo sapiens]
 gb|AIC50874.1| COG2, partial [synthetic construct]
Length=738

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+G   + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGTLSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  651  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  710  GLQASDIKSFSALAELVAAAKDQ  732



>ref|XP_004310291.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tursiops 
truncatus]
Length=739

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 73/143 (51%), Gaps = 2/143 (1%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLHQLQSGHKDK--LKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  RK E SL++++   +      +  S   +SD DKI +QL LD+      +  +
Sbjct  651  SDVLNSVRKMEESLKRLKQARRTAPATPAGPSGGGMSDDDKIRLQLALDVAYLGEQIEKI  710

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+    I S+ +L + VA  + Q
Sbjct  711  GLRTKDIRSFPALTELVAAAKDQ  733



>ref|NP_001138508.1| conserved oligomeric Golgi complex subunit 2 isoform 2 [Homo 
sapiens]
 gb|AAH51906.1| Component of oligomeric golgi complex 2 [Homo sapiens]
 gb|EAW69916.1| component of oligomeric golgi complex 2, isoform CRA_b [Homo 
sapiens]
Length=737

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+G   + T +YYE  
Sbjct  592  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGTLSESTHKYYETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  650  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  708

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  709  GLQASDIKSFSALAELVAAAKDQ  731



>ref|XP_009904610.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Picoides 
pubescens]
 gb|KFV71774.1| Conserved oligomeric Golgi complex subunit 2 [Picoides pubescens]
Length=739

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+ A  + T +YYE  
Sbjct  594  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DRLKQPMIHQWLECALSESTQKYYETV  651

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  AS+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  652  SDVLSSVKKMEESLK--RLKQARRTAASNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  709

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++ ++I S+ +L + V   + Q
Sbjct  710  MGLEVSSIKSFSALTELVLTAKDQ  733



>ref|XP_004935547.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X4 [Gallus gallus]
Length=626

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + S YV   L+P     +  R    L + +  + L+GA  + T +YYE  
Sbjct  481  YRRTNKEVPTKASSYVDSALKPFYRLQNEYR--NILKQPMIHQWLEGALSESTQKYYETV  538

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  A + V ++  +SD DKI +QL LD++ +   +  
Sbjct  539  SDVLSSVKKMEESLK--RLKQARRTAALNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  596

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++   I S+ +L + V   + Q
Sbjct  597  MGLETNNIKSFSALTELVLTAKDQ  620



>ref|XP_001964533.1| GF23234 [Drosophila ananassae]
 gb|EDV30329.1| GF23234 [Drosophila ananassae]
Length=708

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 74/128 (58%), Gaps = 6/128 (5%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TN+ +P R S YV  +LRPLKTF   ++  + L   +  ++L   A  IT  Y+ + 
Sbjct  565  YRKTNREVPTRCSAYVDQMLRPLKTF--SQQHESQLGTLVVEQILSEVASHITKAYFAVV  622

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNI-SDTDKICMQLFLDIQEYARNLSS  318
            +D++   +KTE SL+++R     ++G S+ VS+  + SD DKI +QL +D+  + + LS 
Sbjct  623  SDVLTSVQKTEESLRRLR---NVKSGGSAPVSNSAVMSDDDKIRVQLRVDVSSWKQELSK  679

Query  317  LGIDAATI  294
            L   A  I
Sbjct  680  LNFQATQI  687



>gb|KFV73661.1| Conserved oligomeric Golgi complex subunit 2, partial [Struthio 
camelus australis]
Length=717

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 80/146 (55%), Gaps = 3/146 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +       L + + ++ L+GA  + T +Y E  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQN--ECKDLLKQPMIYQWLEGALSESTQKYCETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  +K E SL++++  A++ A  S   ++  +SD DKI +QL LD++ +   +  +
Sbjct  630  SDVLSSVKKMEESLKRLK-QARKTATPSPVGTNGGMSDDDKIRLQLALDVEYFGDQIQRM  688

Query  314  GIDAATIPSYRSLWQCVAPTERQNII  237
            G+  + I S+ +L + V   + Q  +
Sbjct  689  GLQTSNIKSFSALTELVLTAKDQTTV  714



>ref|XP_004935546.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Gallus gallus]
Length=738

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + S YV   L+P     +  R    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTKASSYVDSALKPFYRLQNEYR--NILKQPMIHQWLEGALSESTQKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  A + V ++  +SD DKI +QL LD++ +   +  
Sbjct  651  SDVLSSVKKMEESLK--RLKQARRTAALNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++   I S+ +L + V   + Q
Sbjct  709  MGLETNNIKSFSALTELVLTAKDQ  732



>ref|XP_419583.2| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Gallus gallus]
Length=739

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + S YV   L+P     +  R    L + +  + L+GA  + T +YYE  
Sbjct  594  YRRTNKEVPTKASSYVDSALKPFYRLQNEYR--NILKQPMIHQWLEGALSESTQKYYETV  651

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   RR  A + V ++  +SD DKI +QL LD++ +   +  
Sbjct  652  SDVLSSVKKMEESLK--RLKQARRTAALNPVGTNGGMSDDDKIRLQLALDVEYFGEQIRK  709

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G++   I S+ +L + V   + Q
Sbjct  710  MGLETNNIKSFSALTELVLTAKDQ  733



>ref|XP_001148147.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Pan troglodytes]
Length=738

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+G   + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGTLSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  651  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  710  GLQASDIKSFPALAELVAAAKDQ  732



>ref|XP_009439912.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Pan troglodytes]
Length=737

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+G   + T +YYE  
Sbjct  592  YRRTNKEVPTTASSYVDSALKPLFQLQSGHKDK--LKQAIIQQWLEGTLSESTHKYYETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  L
Sbjct  650  SDVLNSVKKMEESLKRLK-QARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKL  708

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+ A+ I S+ +L + VA  + Q
Sbjct  709  GLQASDIKSFPALAELVAAAKDQ  731



>ref|XP_005508688.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Columba livia]
Length=733

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 77/134 (57%), Gaps = 5/134 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  588  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  645

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   R+   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  646  SDVLSSVKKMEESLK--RLKQARKTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  703

Query  317  LGIDAATIPSYRSL  276
            +G++ ++I S+ +L
Sbjct  704  MGLETSSIKSFSAL  717



>ref|XP_005508687.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Columba livia]
Length=734

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 77/134 (57%), Gaps = 5/134 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  589  YRRTNKEVPTKASPYVDSALKPFYRLQNEYK--DILKQPMIHQWLEGALSESTQKYYETV  646

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D+++  +K E SL+  RL   R+   S+ V ++  +SD +KI +QL LD++ +   +  
Sbjct  647  SDVLSSVKKMEESLK--RLKQARKTATSNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRK  704

Query  317  LGIDAATIPSYRSL  276
            +G++ ++I S+ +L
Sbjct  705  MGLETSSIKSFSAL  718



>ref|XP_009679359.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Struthio 
camelus australis]
Length=785

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 80/146 (55%), Gaps = 3/146 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +       L + + ++ L+GA  + T +Y E  
Sbjct  640  YRRTNKEVPTKASPYVDSALKPFYRLQN--ECKDLLKQPMIYQWLEGALSESTQKYCETV  697

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  +K E SL++++  A++ A  S   ++  +SD DKI +QL LD++ +   +  +
Sbjct  698  SDVLSSVKKMEESLKRLK-QARKTATPSPVGTNGGMSDDDKIRLQLALDVEYFGDQIQRM  756

Query  314  GIDAATIPSYRSLWQCVAPTERQNII  237
            G+  + I S+ +L + V   + Q  +
Sbjct  757  GLQTSNIKSFSALTELVLTAKDQTTV  782



>ref|XP_004281614.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Orcinus 
orca]
Length=739

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 72/143 (50%), Gaps = 2/143 (1%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+GA    T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLHQLQSGHKDK--LKQAIIQQWLEGALSDSTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  RK E SL++++   +      +  S   +SD DKI +QL LD+      +  +
Sbjct  651  SDVLNSVRKMEESLKRLKQARRTAPATPAGPSGGGMSDDDKIRLQLALDVAYLGEQIEKI  710

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+    I S+ +L + VA  + Q
Sbjct  711  GLRTKDIRSFPALTELVAAAKDQ  733



>ref|XP_006937851.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Felis catus]
Length=737

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P +    G +    L + +  + L+GA  + T +YYE  
Sbjct  592  YRRTNKEVPTTASSYVDSALKPFRQLQSGHKDK--LRQAVIRQWLEGALSESTHKYYETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  +
Sbjct  650  SDVLNSVKKMEESLKRLK-QARKTTPANPIGPGGGMSDDDKIRLQLALDVEYLGEQIQKM  708

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+    I S+ +L + VA T+ Q
Sbjct  709  GLATKDIKSFPALAELVAATKDQ  731



>ref|XP_003473537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Cavia porcellus]
Length=738

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 73/138 (53%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P      G R    L   +  + L+GA  + T +Y E  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPFYQLQSGHRDK--LKPTVMQQWLEGALSESTHKYCETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   RRA A+S V     +SD DKI +QL LD++     +  
Sbjct  651  SDVLNSVKKMEESLK--RLKQARRAPATSTVGPSSGMSDDDKIRLQLALDVEYLGEQIRK  708

Query  317  LGIDAATIPSYRSLWQCV  264
            +G+  ++I S+ +L + V
Sbjct  709  MGLQTSSIRSFEALTELV  726



>ref|XP_010233328.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=308

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  476  ARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDI  345
            ARKTESSLQ++R GAQR+ GAS+D S + ISDTDKICMQLFLDI
Sbjct  265  ARKTESSLQRLRQGAQRQVGASTDASGNVISDTDKICMQLFLDI  308



>ref|XP_007450662.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Lipotes vexillifer]
Length=738

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 73/143 (51%), Gaps = 2/143 (1%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+GA  + T +YYE  
Sbjct  592  YRRTNKEVPTTASSYVDSALKPLYQLQSGHKDK--LKQAIIQQWLEGALSESTHKYYETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  RK E SL++++   +      +  S   +SD DKI +QL LD+      +  +
Sbjct  650  SDVLNSVRKMEESLKRLKQARRTAPATPAGPSGGGMSDDDKIRLQLALDVAYLGEQIEKI  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+    I S+ +L + VA  + Q
Sbjct  710  GLRTKDIRSFPALTELVAAAKDQ  732



>ref|XP_007450661.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Lipotes vexillifer]
Length=739

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 73/143 (51%), Gaps = 2/143 (1%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+PL     G +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPLYQLQSGHKDK--LKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  RK E SL++++   +      +  S   +SD DKI +QL LD+      +  +
Sbjct  651  SDVLNSVRKMEESLKRLKQARRTAPATPAGPSGGGMSDDDKIRLQLALDVAYLGEQIEKI  710

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+    I S+ +L + VA  + Q
Sbjct  711  GLRTKDIRSFPALTELVAAAKDQ  733



>ref|XP_005005280.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Cavia porcellus]
Length=737

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 73/138 (53%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P      G R    L   +  + L+GA  + T +Y E  
Sbjct  592  YRRTNKEVPTTASSYVDSALKPFYQLQSGHRDK--LKPTVMQQWLEGALSESTHKYCETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   RRA A+S V     +SD DKI +QL LD++     +  
Sbjct  650  SDVLNSVKKMEESLK--RLKQARRAPATSTVGPSSGMSDDDKIRLQLALDVEYLGEQIRK  707

Query  317  LGIDAATIPSYRSLWQCV  264
            +G+  ++I S+ +L + V
Sbjct  708  MGLQTSSIRSFEALTELV  725



>ref|XP_003993981.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Felis catus]
Length=738

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P +    G +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPFRQLQSGHKDK--LRQAVIRQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  +
Sbjct  651  SDVLNSVKKMEESLKRLK-QARKTTPANPIGPGGGMSDDDKIRLQLALDVEYLGEQIQKM  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+    I S+ +L + VA T+ Q
Sbjct  710  GLATKDIKSFPALAELVAATKDQ  732



>gb|KFV07773.1| Conserved oligomeric Golgi complex subunit 2, partial [Pterocles 
gutturalis]
Length=717

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 82/143 (57%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDV--LKQPMIHQWLEGALSESTQKYYETV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  +K E SL++++  A++ A  +   ++  +SD +KI +QL LD++ +   +  +
Sbjct  630  SDVLSSVKKMEESLKRLK-QARKTATLNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRKM  688

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G++ ++I S+ +L + V   + Q
Sbjct  689  GLETSSIKSFSALTELVLTAKDQ  711



>ref|XP_010072831.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Pterocles gutturalis]
Length=715

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 82/143 (57%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  570  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDV--LKQPMIHQWLEGALSESTQKYYETV  627

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  +K E SL++++  A++ A  +   ++  +SD +KI +QL LD++ +   +  +
Sbjct  628  SDVLSSVKKMEESLKRLK-QARKTATLNPVGTNGGMSDDNKIRLQLALDVEYFGEQIRKM  686

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G++ ++I S+ +L + V   + Q
Sbjct  687  GLETSSIKSFSALTELVLTAKDQ  709



>ref|XP_005005281.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X3 [Cavia porcellus]
Length=711

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 73/138 (53%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P      G R    L   +  + L+GA  + T +Y E  
Sbjct  566  YRRTNKEVPTTASSYVDSALKPFYQLQSGHRDK--LKPTVMQQWLEGALSESTHKYCETV  623

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVS-DHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   RRA A+S V     +SD DKI +QL LD++     +  
Sbjct  624  SDVLNSVKKMEESLK--RLKQARRAPATSTVGPSSGMSDDDKIRLQLALDVEYLGEQIRK  681

Query  317  LGIDAATIPSYRSLWQCV  264
            +G+  ++I S+ +L + V
Sbjct  682  MGLQTSSIRSFEALTELV  699



>ref|XP_003410940.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Loxodonta 
africana]
Length=738

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 76/143 (53%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + S YV   L+P        +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEVPTKASSYVDSALKPFYQLQSEHKDK--LKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   AS   S   +SD DKI +QL LD++     +  +
Sbjct  651  SDVLNSVKKMEESLKRLK-QARKTTSASPIGSSGGMSDDDKIRLQLALDVEYLGEQIQKM  709

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+  + I S+ +L + V   + Q
Sbjct  710  GLQTSNIKSFPALIELVVAAKDQ  732



>ref|XP_005405048.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Chinchilla lanigera]
Length=738

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 72/138 (52%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P      G R     T  +  + L+GA  + T +Y E  
Sbjct  593  YRRTNKEVPTTASSYVDSALKPFYQLQSGHRDKVKPT--VMHQWLEGALSESTHKYCETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDH-NISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   RRA  +S V     +SD DKI +QL LD++     +  
Sbjct  651  SDVLNSVKKMEESLK--RLKQARRAPTTSTVGPSVGMSDDDKIRLQLALDVEYLGEQIQK  708

Query  317  LGIDAATIPSYRSLWQCV  264
            +G+  ++I S+ +L + V
Sbjct  709  MGLQTSSIKSFEALTELV  726



>ref|XP_005405049.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Chinchilla lanigera]
Length=737

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 72/138 (52%), Gaps = 5/138 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P      G R     T  +  + L+GA  + T +Y E  
Sbjct  592  YRRTNKEVPTTASSYVDSALKPFYQLQSGHRDKVKPT--VMHQWLEGALSESTHKYCETV  649

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDH-NISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   RRA  +S V     +SD DKI +QL LD++     +  
Sbjct  650  SDVLNSVKKMEESLK--RLKQARRAPTTSTVGPSVGMSDDDKIRLQLALDVEYLGEQIQK  707

Query  317  LGIDAATIPSYRSLWQCV  264
            +G+  ++I S+ +L + V
Sbjct  708  MGLQTSSIKSFEALTELV  725



>ref|XP_007086077.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Panthera 
tigris altaica]
Length=716

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV   L+P +    G +    L + +  + L+GA  + T +YYE  
Sbjct  571  YRRTNKEVPTTASSYVDSALKPFRQLQSGHKDK--LRQAVIRQWLEGALSESTHKYYETV  628

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  +K E SL++++  A++   A+       +SD DKI +QL LD++     +  +
Sbjct  629  SDVLNSVKKMEESLKRLK-QARKTTPANPIGPGGGMSDDDKIRLQLALDVEYLGEQIQMM  687

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G+    I S+ +L + VA T+ Q
Sbjct  688  GLATKDIKSFPALAELVAATKDQ  710



>ref|XP_007173850.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Balaenoptera acutorostrata scammoni]
Length=609

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 69/138 (50%), Gaps = 2/138 (1%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P   S YV G L+PL     G      L + +    L GA  + T +YYE  
Sbjct  463  YRRTNKEVPTTASSYVDGALKPLYQLQSGHEDK--LKRAVIQRWLAGALSESTHKYYETV  520

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++N  RK E SL++++   +      +  S   +SD DKI +QL LD+      +  +
Sbjct  521  SDVLNSVRKMEESLKRLKQARRTTPATPAGPSGGGMSDDDKIRLQLALDVAYLGEQIEKI  580

Query  314  GIDAATIPSYRSLWQCVA  261
            G+    I S+ +L + VA
Sbjct  581  GLRTKDIRSFPALTELVA  598



>ref|XP_007936688.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Orycteropus 
afer afer]
Length=738

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 76/144 (53%), Gaps = 5/144 (3%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + S YV   L+P     +  +    L + +  + L+GA  + T +YYE  
Sbjct  593  YRRTNKEIPTKASSYVDSALKPFYQLQNEHKDK--LKQAIIQQWLEGALSESTHKYYETV  650

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDHNISDTDKICMQLFLDIQEYARNLSS  318
            +D++N  +K E SL+  RL   R+   S+ V S   +SD DKI +QL LD++     +  
Sbjct  651  SDVLNSVKKMEESLK--RLKQARKTTPSNPVGSSGGMSDDDKIRLQLALDVEYLGEQIQK  708

Query  317  LGIDAATIPSYRSLWQCVAPTERQ  246
            +G+  + I S+ +L + V   + Q
Sbjct  709  IGLQTSNIKSFPALIELVVAAKDQ  732



>ref|XP_008944103.1| PREDICTED: conserved oligomeric Golgi complex subunit 2, partial 
[Merops nubicus]
Length=715

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 81/143 (57%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +    L+GA  + T +YY+  
Sbjct  570  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDT--LKQPMIHLWLEGALSESTQKYYDTV  627

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  +K E SL++++  A+R A ++   ++  +SD +KI +QL LD++ +   +  +
Sbjct  628  SDVLSSVKKMEESLKRLK-QARRTATSNPLGTNGGMSDDNKIRLQLALDVEYFGEQIRKM  686

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G++   I S+ +L + V   + Q
Sbjct  687  GLETTNIKSFSALTELVLAAKDQ  709



>gb|KFQ34940.1| Conserved oligomeric Golgi complex subunit 2, partial [Merops 
nubicus]
Length=716

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 81/143 (57%), Gaps = 3/143 (2%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TNK +P + SPYV   L+P     +  + T  L + +    L+GA  + T +YY+  
Sbjct  572  YRRTNKEVPTKASPYVDSALKPFYRLQNEYKDT--LKQPMIHLWLEGALSESTQKYYDTV  629

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D+++  +K E SL++++  A+R A ++   ++  +SD +KI +QL LD++ +   +  +
Sbjct  630  SDVLSSVKKMEESLKRLK-QARRTATSNPLGTNGGMSDDNKIRLQLALDVEYFGEQIRKM  688

Query  314  GIDAATIPSYRSLWQCVAPTERQ  246
            G++   I S+ +L + V   + Q
Sbjct  689  GLETTNIKSFSALTELVLAAKDQ  711



>ref|XP_009055731.1| hypothetical protein LOTGIDRAFT_232605 [Lottia gigantea]
 gb|ESO93530.1| hypothetical protein LOTGIDRAFT_232605 [Lottia gigantea]
Length=744

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 71/135 (53%), Gaps = 6/135 (4%)
 Frame = -3

Query  674  YRMTNKPLPVRHSPYVSGVLRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELA  495
            YR TN+ +P + S Y+  + +PLK FL+  +    L  + + + L      +T++Y  + 
Sbjct  605  YRKTNREVPSKPSNYIISLEKPLKNFLEEHQ----LESKQKADFLTQVFSSLTEQYITVT  660

Query  494  ADLVNVARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQEYARNLSSL  315
            +D++   +K E SL+  RL   R    SSD + H +SD DK+  Q+ LDI  Y   +S  
Sbjct  661  SDVLTSVKKMEESLK--RLKKARGTDKSSDSNSHGMSDDDKVRQQIILDIDCYGNQISGH  718

Query  314  GIDAATIPSYRSLWQ  270
            GID + +  +  L +
Sbjct  719  GIDKSAVNGFDKLLE  733



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880