BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048I07

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613825.1|  PREDICTED: zinc finger BED domain-containing...    333   3e-105   Nicotiana tomentosiformis
ref|XP_009761601.1|  PREDICTED: zinc finger BED domain-containing...    328   7e-103   Nicotiana sylvestris
ref|XP_009791008.1|  PREDICTED: zinc finger BED domain-containing...    326   1e-102   Nicotiana sylvestris
ref|XP_009621122.1|  PREDICTED: zinc finger BED domain-containing...    325   3e-102   Nicotiana tomentosiformis
ref|XP_010312124.1|  PREDICTED: zinc finger BED domain-containing...    317   5e-99    Solanum lycopersicum
ref|XP_010313787.1|  PREDICTED: zinc finger BED domain-containing...    309   8e-95    
ref|XP_010313784.1|  PREDICTED: zinc finger BED domain-containing...    309   8e-95    
ref|XP_010313785.1|  PREDICTED: zinc finger BED domain-containing...    309   8e-95    
ref|XP_010313781.1|  PREDICTED: zinc finger BED domain-containing...    309   1e-94    Solanum lycopersicum
ref|XP_011078385.1|  PREDICTED: zinc finger BED domain-containing...    303   2e-94    Sesamum indicum [beniseed]
emb|CDP10447.1|  unnamed protein product                                293   1e-92    Coffea canephora [robusta coffee]
emb|CAN68819.1|  hypothetical protein VITISV_023069                     260   8e-84    Vitis vinifera
ref|XP_011457831.1|  PREDICTED: zinc finger BED domain-containing...    273   3e-81    Fragaria vesca subsp. vesca
ref|XP_011457833.1|  PREDICTED: zinc finger BED domain-containing...    273   3e-81    Fragaria vesca subsp. vesca
gb|KJB23615.1|  hypothetical protein B456_004G107300                    267   6e-81    Gossypium raimondii
ref|XP_007013535.1|  BED zinc finger,hAT family dimerization doma...    263   2e-79    
gb|KHN15060.1|  Putative AC transposase                                 269   2e-79    Glycine soja [wild soybean]
gb|KJB64715.1|  hypothetical protein B456_010G061500                    263   4e-79    Gossypium raimondii
ref|XP_007013534.1|  BED zinc finger,hAT family dimerization doma...    263   5e-79    
gb|KDO73493.1|  hypothetical protein CISIN_1g002915mg                   266   5e-79    Citrus sinensis [apfelsine]
ref|XP_007155048.1|  hypothetical protein PHAVU_003G168600g             268   7e-79    Phaseolus vulgaris [French bean]
ref|XP_010047980.1|  PREDICTED: zinc finger BED domain-containing...    261   8e-79    Eucalyptus grandis [rose gum]
ref|XP_004493926.1|  PREDICTED: uncharacterized protein LOC101507...    268   9e-79    
ref|XP_006453082.1|  hypothetical protein CICLE_v10007308mg             267   1e-78    Citrus clementina [clementine]
gb|KHN03605.1|  Putative AC transposase                                 267   2e-78    Glycine soja [wild soybean]
ref|XP_010656463.1|  PREDICTED: zinc finger BED domain-containing...    261   2e-78    Vitis vinifera
gb|KJB64716.1|  hypothetical protein B456_010G061600                    260   3e-78    Gossypium raimondii
emb|CBI28241.3|  unnamed protein product                                259   1e-76    Vitis vinifera
gb|EPS67926.1|  hypothetical protein M569_06846                         256   2e-76    Genlisea aurea
gb|EYU34976.1|  hypothetical protein MIMGU_mgv1a002172mg                256   2e-76    Erythranthe guttata [common monkey flower]
ref|XP_007138404.1|  hypothetical protein PHAVU_009G205900g             258   3e-76    Phaseolus vulgaris [French bean]
gb|KGN65126.1|  hypothetical protein Csa_1G229510                       255   1e-75    Cucumis sativus [cucumbers]
ref|XP_008242815.1|  PREDICTED: putative AC transposase isoform X2      254   2e-75    Prunus mume [ume]
ref|XP_008242814.1|  PREDICTED: putative AC transposase isoform X1      254   2e-75    Prunus mume [ume]
ref|XP_007203781.1|  hypothetical protein PRUPE_ppa001983mg             253   3e-75    Prunus persica
ref|XP_007203782.1|  hypothetical protein PRUPE_ppa001983mg             253   4e-75    Prunus persica
ref|XP_011017829.1|  PREDICTED: zinc finger BED domain-containing...    250   1e-74    Populus euphratica
ref|XP_002325202.1|  hypothetical protein POPTR_0018s12690g             249   3e-74    Populus trichocarpa [western balsam poplar]
ref|XP_008457064.1|  PREDICTED: putative AC transposase                 249   7e-74    Cucumis melo [Oriental melon]
gb|KGN60709.1|  hypothetical protein Csa_2G008020                       248   1e-73    Cucumis sativus [cucumbers]
ref|XP_009363984.1|  PREDICTED: zinc finger BED domain-containing...    251   1e-73    Pyrus x bretschneideri [bai li]
ref|XP_009363983.1|  PREDICTED: zinc finger BED domain-containing...    251   2e-73    
ref|XP_010687925.1|  PREDICTED: zinc finger BED domain-containing...    252   2e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687924.1|  PREDICTED: zinc finger BED domain-containing...    252   2e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250193.1|  PREDICTED: zinc finger BED domain-containing...    241   5e-71    Nelumbo nucifera [Indian lotus]
ref|XP_010241568.1|  PREDICTED: zinc finger BED domain-containing...    234   1e-68    Nelumbo nucifera [Indian lotus]
ref|XP_010535860.1|  PREDICTED: zinc finger BED domain-containing...    226   1e-65    Tarenaya hassleriana [spider flower]
ref|XP_010541714.1|  PREDICTED: zinc finger BED domain-containing...    221   1e-63    Tarenaya hassleriana [spider flower]
ref|XP_010541713.1|  PREDICTED: zinc finger BED domain-containing...    220   2e-63    Tarenaya hassleriana [spider flower]
ref|XP_011014817.1|  PREDICTED: zinc finger BED domain-containing...    222   4e-63    Populus euphratica
ref|XP_010496529.1|  PREDICTED: zinc finger BED domain-containing...    219   6e-63    Camelina sativa [gold-of-pleasure]
ref|XP_010514702.1|  PREDICTED: zinc finger BED domain-containing...    219   8e-63    Camelina sativa [gold-of-pleasure]
ref|NP_001241846.1|  uncharacterized protein LOC100857052               209   3e-62    
gb|ABA18109.1|  hAT-like transposase                                    217   3e-62    Arabidopsis arenosa
ref|XP_002875576.1|  hypothetical protein ARALYDRAFT_323059             217   4e-62    Arabidopsis lyrata subsp. lyrata
ref|XP_006279357.1|  hypothetical protein CARUB_v10008021mg             217   5e-62    Capsella rubella
ref|XP_006385302.1|  hypothetical protein POPTR_0003s02610g             216   7e-62    
ref|XP_006384324.1|  hypothetical protein POPTR_0004s12760g             218   9e-62    Populus trichocarpa [western balsam poplar]
ref|XP_010425789.1|  PREDICTED: zinc finger BED domain-containing...    216   9e-62    Camelina sativa [gold-of-pleasure]
ref|XP_006419173.1|  hypothetical protein EUTSA_v10002435mg             216   9e-62    Eutrema salsugineum [saltwater cress]
gb|AAS16893.2|  putative hAT family dimerisation domain containin...    207   2e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006384329.1|  hypothetical protein POPTR_0004s12810g             217   2e-61    Populus trichocarpa [western balsam poplar]
emb|CBI36351.3|  unnamed protein product                                205   8e-61    Vitis vinifera
ref|XP_002325201.2|  hypothetical protein POPTR_0018s12680g             214   1e-60    
ref|XP_010236763.1|  PREDICTED: zinc finger BED domain-containing...    202   4e-60    
ref|XP_011081954.1|  PREDICTED: zinc finger BED domain-containing...    211   5e-60    Sesamum indicum [beniseed]
emb|CDO98171.1|  unnamed protein product                                211   5e-60    Coffea canephora [robusta coffee]
dbj|BAK01733.1|  predicted protein                                      212   7e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008776870.1|  PREDICTED: zinc finger BED domain-containing...    211   7e-60    Phoenix dactylifera
ref|XP_011081945.1|  PREDICTED: zinc finger BED domain-containing...    211   7e-60    Sesamum indicum [beniseed]
gb|AAW28145.1|  hAT-like transposase                                    211   9e-60    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056444.1|  Os05g0583100                                       207   9e-60    
ref|XP_009390780.1|  PREDICTED: zinc finger BED domain-containing...    211   9e-60    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_189803.1|  BED zinc finger and hAT dimerization domain-con...    211   9e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009415017.1|  PREDICTED: zinc finger BED domain-containing...    211   9e-60    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA18094.1|  hAT-like transposase                                    211   1e-59    Olimarabidopsis pumila
gb|ACN26356.1|  unknown                                                 207   1e-59    Zea mays [maize]
ref|XP_009139828.1|  PREDICTED: zinc finger BED domain-containing...    209   3e-59    Brassica rapa
ref|XP_008643588.1|  PREDICTED: LOC100281046 isoform X1                 210   4e-59    Zea mays [maize]
ref|NP_001147437.1|  LOC100281046                                       209   4e-59    Zea mays [maize]
emb|CDX74476.1|  BnaA04g09130D                                          209   7e-59    
gb|EPS65666.1|  hypothetical protein M569_09109                         208   9e-59    Genlisea aurea
ref|NP_001174288.1|  Os05g0239150                                       209   1e-58    
ref|NP_001051173.1|  Os03g0733400                                       209   1e-58    
gb|EAY97185.1|  hypothetical protein OsI_19106                          202   1e-58    Oryza sativa Indica Group [Indian rice]
gb|EAY91763.1|  hypothetical protein OsI_13406                          202   2e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_010097200.1|  Putative AC transposase                            207   3e-58    Morus notabilis
ref|XP_010230409.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    199   4e-58    
gb|EEE64835.1|  hypothetical protein OsJ_19692                          207   4e-58    Oryza sativa Japonica Group [Japonica rice]
gb|EEC79762.1|  hypothetical protein OsI_21153                          207   4e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_008675089.1|  PREDICTED: transposon protein isoform X1           207   5e-58    Zea mays [maize]
ref|NP_001147988.1|  transposon protein                                 207   5e-58    
emb|CDY37871.1|  BnaC04g31350D                                          205   7e-58    Brassica napus [oilseed rape]
ref|XP_009757867.1|  PREDICTED: zinc finger BED domain-containing...    205   2e-57    Nicotiana sylvestris
ref|XP_010654811.1|  PREDICTED: zinc finger BED domain-containing...    205   2e-57    Vitis vinifera
ref|XP_009757855.1|  PREDICTED: zinc finger BED domain-containing...    205   2e-57    Nicotiana sylvestris
ref|XP_009594303.1|  PREDICTED: zinc finger BED domain-containing...    204   2e-57    Nicotiana tomentosiformis
ref|XP_002463929.1|  hypothetical protein SORBIDRAFT_01g009090          204   5e-57    Sorghum bicolor [broomcorn]
ref|XP_011017830.1|  PREDICTED: zinc finger BED domain-containing...    203   8e-57    Populus euphratica
ref|XP_009392578.1|  PREDICTED: zinc finger BED domain-containing...    202   1e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010063482.1|  PREDICTED: zinc finger BED domain-containing...    203   2e-56    Eucalyptus grandis [rose gum]
ref|XP_010906913.1|  PREDICTED: zinc finger BED domain-containing...    202   2e-56    Elaeis guineensis
ref|XP_009379900.1|  PREDICTED: zinc finger BED domain-containing...    201   2e-56    
emb|CAN81954.1|  hypothetical protein VITISV_014020                     204   3e-56    Vitis vinifera
ref|XP_009379897.1|  PREDICTED: zinc finger BED domain-containing...    201   3e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009379895.1|  PREDICTED: zinc finger BED domain-containing...    201   4e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010906914.1|  PREDICTED: zinc finger BED domain-containing...    201   6e-56    Elaeis guineensis
gb|KDO48633.1|  hypothetical protein CISIN_1g005485mg                   200   9e-56    Citrus sinensis [apfelsine]
ref|XP_010691104.1|  PREDICTED: zinc finger BED domain-containing...    199   3e-55    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006427320.1|  hypothetical protein CICLE_v10025036mg             198   5e-55    Citrus clementina [clementine]
ref|XP_008790202.1|  PREDICTED: zinc finger BED domain-containing...    197   7e-55    Phoenix dactylifera
ref|NP_001151544.1|  transposon protein                                 197   1e-54    Zea mays [maize]
ref|XP_008643805.1|  PREDICTED: transposon protein isoform X1           197   2e-54    Zea mays [maize]
ref|XP_010230399.1|  PREDICTED: zinc finger BED domain-containing...    197   2e-54    Brachypodium distachyon [annual false brome]
ref|NP_001136571.1|  uncharacterized protein LOC100216693               193   3e-54    
dbj|BAK03580.1|  predicted protein                                      187   9e-54    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN03603.1|  Putative AC transposase                                 180   2e-53    Glycine soja [wild soybean]
ref|XP_007215012.1|  hypothetical protein PRUPE_ppa002495mg             192   8e-53    Prunus persica
emb|CDY48867.1|  BnaA06g03150D                                          191   1e-52    Brassica napus [oilseed rape]
ref|XP_009147901.1|  PREDICTED: zinc finger BED domain-containing...    191   1e-52    Brassica rapa
emb|CDY60307.1|  BnaUnng00680D                                          188   2e-51    Brassica napus [oilseed rape]
dbj|BAJ88673.1|  predicted protein                                      188   3e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010520572.1|  PREDICTED: zinc finger BED domain-containing...    187   3e-51    Tarenaya hassleriana [spider flower]
dbj|BAJ96825.1|  predicted protein                                      187   4e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009336302.1|  PREDICTED: zinc finger BED domain-containing...    185   2e-50    Pyrus x bretschneideri [bai li]
gb|KHN22430.1|  Putative AC transposase                                 181   2e-49    Glycine soja [wild soybean]
ref|XP_011457838.1|  PREDICTED: zinc finger BED domain-containing...    182   3e-49    Fragaria vesca subsp. vesca
ref|XP_002442948.1|  hypothetical protein SORBIDRAFT_08g005330          182   3e-49    Sorghum bicolor [broomcorn]
gb|KGN52935.1|  hypothetical protein Csa_4G006420                       177   1e-47    Cucumis sativus [cucumbers]
ref|XP_006851229.1|  hypothetical protein AMTR_s00180p00017340          177   2e-47    
gb|KHN44191.1|  Putative AC transposase                                 176   3e-47    Glycine soja [wild soybean]
gb|EEC79764.1|  hypothetical protein OsI_21155                          167   4e-47    Oryza sativa Indica Group [Indian rice]
ref|XP_011467072.1|  PREDICTED: zinc finger BED domain-containing...    172   6e-46    Fragaria vesca subsp. vesca
ref|XP_007150768.1|  hypothetical protein PHAVU_005G179200g             170   4e-45    Phaseolus vulgaris [French bean]
ref|NP_001056445.1|  Os05g0583200                                       169   2e-44    
gb|EEE64837.1|  hypothetical protein OsJ_19694                          168   8e-44    Oryza sativa Japonica Group [Japonica rice]
emb|CDX89026.1|  BnaA04g01600D                                          166   1e-43    
emb|CDY00623.1|  BnaC04g23020D                                          165   2e-42    
gb|KHN01319.1|  Putative AC transposase                                 161   4e-42    Glycine soja [wild soybean]
ref|XP_006369306.1|  hypothetical protein POPTR_0001s20900g             162   2e-41    
ref|XP_011044854.1|  PREDICTED: zinc finger BED domain-containing...    161   2e-41    Populus euphratica
gb|EYU24629.1|  hypothetical protein MIMGU_mgv1a023531mg                160   2e-41    Erythranthe guttata [common monkey flower]
ref|XP_011044853.1|  PREDICTED: zinc finger BED domain-containing...    161   2e-41    Populus euphratica
ref|XP_006857388.1|  hypothetical protein AMTR_s00067p00136180          159   2e-41    
ref|XP_011044850.1|  PREDICTED: zinc finger BED domain-containing...    161   2e-41    Populus euphratica
ref|XP_006369308.1|  hypothetical protein POPTR_0001s20900g             162   2e-41    
ref|XP_011007707.1|  PREDICTED: zinc finger BED domain-containing...    160   9e-41    Populus euphratica
ref|XP_011007708.1|  PREDICTED: zinc finger BED domain-containing...    159   1e-40    Populus euphratica
ref|XP_011007706.1|  PREDICTED: zinc finger BED domain-containing...    160   1e-40    Populus euphratica
ref|XP_011007705.1|  PREDICTED: zinc finger BED domain-containing...    160   1e-40    Populus euphratica
ref|XP_011007704.1|  PREDICTED: zinc finger BED domain-containing...    160   1e-40    Populus euphratica
ref|XP_011007700.1|  PREDICTED: zinc finger BED domain-containing...    160   1e-40    Populus euphratica
gb|KJB66355.1|  hypothetical protein B456_010G137500                    151   3e-38    Gossypium raimondii
ref|XP_007023276.1|  BED zinc finger,hAT family dimerization domain     151   3e-38    
ref|XP_009596751.1|  PREDICTED: zinc finger BED domain-containing...    143   6e-38    Nicotiana tomentosiformis
gb|EPS64824.1|  hypothetical protein M569_09955                         147   8e-37    Genlisea aurea
gb|EEC70768.1|  hypothetical protein OsI_02196                          144   1e-36    Oryza sativa Indica Group [Indian rice]
sp|Q0JMB2.3|RSLE4_ORYSJ  RecName: Full=Zinc finger BED domain-con...    144   7e-36    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043202.2|  Os01g0518400                                       144   8e-36    
ref|XP_009800989.1|  PREDICTED: zinc finger BED domain-containing...    143   2e-35    Nicotiana sylvestris
ref|XP_010649234.1|  PREDICTED: zinc finger BED domain-containing...    136   2e-35    
ref|XP_009624222.1|  PREDICTED: zinc finger BED domain-containing...    142   3e-35    Nicotiana tomentosiformis
emb|CAN60218.1|  hypothetical protein VITISV_006612                     142   4e-35    Vitis vinifera
ref|XP_010656943.1|  PREDICTED: zinc finger BED domain-containing...    142   6e-35    Vitis vinifera
gb|KHN26291.1|  Putative AC transposase                                 142   6e-35    Glycine soja [wild soybean]
ref|XP_010644074.1|  PREDICTED: zinc finger BED domain-containing...    142   7e-35    Vitis vinifera
ref|XP_010656944.1|  PREDICTED: zinc finger BED domain-containing...    141   7e-35    
ref|XP_010656941.1|  PREDICTED: zinc finger BED domain-containing...    141   8e-35    Vitis vinifera
ref|XP_010327097.1|  PREDICTED: zinc finger BED domain-containing...    140   1e-34    Solanum lycopersicum
ref|XP_010521534.1|  PREDICTED: zinc finger BED domain-containing...    142   2e-34    Tarenaya hassleriana [spider flower]
ref|XP_007135765.1|  hypothetical protein PHAVU_010G156900g             139   4e-34    Phaseolus vulgaris [French bean]
ref|XP_010273438.1|  PREDICTED: zinc finger BED domain-containing...    139   6e-34    Nelumbo nucifera [Indian lotus]
gb|KDP34464.1|  hypothetical protein JCGZ_11935                         139   7e-34    Jatropha curcas
ref|XP_011468523.1|  PREDICTED: zinc finger BED domain-containing...    134   1e-33    Fragaria vesca subsp. vesca
emb|CDP06055.1|  unnamed protein product                                138   1e-33    Coffea canephora [robusta coffee]
ref|XP_011460363.1|  PREDICTED: zinc finger BED domain-containing...    131   1e-33    Fragaria vesca subsp. vesca
gb|KHN23048.1|  Putative AC transposase                                 138   2e-33    Glycine soja [wild soybean]
ref|XP_009601856.1|  PREDICTED: zinc finger BED domain-containing...    131   2e-33    Nicotiana tomentosiformis
gb|EPS60750.1|  hypothetical protein M569_14050                         137   3e-33    Genlisea aurea
ref|XP_010272686.1|  PREDICTED: zinc finger BED domain-containing...    137   3e-33    Nelumbo nucifera [Indian lotus]
emb|CDY39631.1|  BnaC05g11600D                                          136   5e-33    Brassica napus [oilseed rape]
ref|XP_011045538.1|  PREDICTED: zinc finger BED domain-containing...    135   9e-33    Populus euphratica
gb|AAD55482.1|AC009322_22  Hypothetical protein                         137   1e-32    Arabidopsis thaliana [mouse-ear cress]
emb|CDP18725.1|  unnamed protein product                                135   1e-32    Coffea canephora [robusta coffee]
ref|XP_011465798.1|  PREDICTED: zinc finger BED domain-containing...    134   1e-32    Fragaria vesca subsp. vesca
emb|CAN68697.1|  hypothetical protein VITISV_042570                     137   1e-32    Vitis vinifera
ref|XP_007133312.1|  hypothetical protein PHAVU_011G169000g             135   1e-32    Phaseolus vulgaris [French bean]
emb|CAN80126.1|  hypothetical protein VITISV_013417                     137   1e-32    Vitis vinifera
ref|XP_009600169.1|  PREDICTED: zinc finger BED domain-containing...    129   1e-32    
ref|XP_010675272.1|  PREDICTED: zinc finger BED domain-containing...    135   2e-32    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010430022.1|  PREDICTED: probable serine/threonine-protein...    132   2e-32    Camelina sativa [gold-of-pleasure]
ref|XP_007213601.1|  hypothetical protein PRUPE_ppa002416mg             134   2e-32    Prunus persica
ref|XP_009791292.1|  PREDICTED: zinc finger BED domain-containing...    127   3e-32    Nicotiana sylvestris
ref|XP_006370067.1|  hypothetical protein POPTR_0001s39240g             133   6e-32    
ref|XP_011098171.1|  PREDICTED: zinc finger BED domain-containing...    133   7e-32    Sesamum indicum [beniseed]
ref|XP_006377715.1|  hypothetical protein POPTR_0011s10500g             133   9e-32    Populus trichocarpa [western balsam poplar]
ref|XP_009376729.1|  PREDICTED: zinc finger BED domain-containing...    132   2e-31    Pyrus x bretschneideri [bai li]
ref|XP_011044575.1|  PREDICTED: zinc finger BED domain-containing...    132   2e-31    Populus euphratica
ref|XP_009764968.1|  PREDICTED: zinc finger BED domain-containing...    129   2e-31    Nicotiana sylvestris
ref|XP_011471014.1|  PREDICTED: zinc finger BED domain-containing...    131   2e-31    Fragaria vesca subsp. vesca
ref|XP_009783770.1|  PREDICTED: zinc finger BED domain-containing...    131   4e-31    Nicotiana sylvestris
ref|XP_009610280.1|  PREDICTED: zinc finger BED domain-containing...    131   5e-31    Nicotiana tomentosiformis
ref|XP_009631898.1|  PREDICTED: zinc finger BED domain-containing...    129   7e-31    
ref|XP_010417758.1|  PREDICTED: zinc finger BED domain-containing...    132   8e-31    
ref|XP_010417759.1|  PREDICTED: zinc finger BED domain-containing...    132   9e-31    Camelina sativa [gold-of-pleasure]
ref|XP_006300389.1|  hypothetical protein CARUB_v10019720mg             131   1e-30    Capsella rubella
ref|XP_010472998.1|  PREDICTED: zinc finger BED domain-containing...    131   1e-30    Camelina sativa [gold-of-pleasure]
ref|XP_010472999.1|  PREDICTED: zinc finger BED domain-containing...    131   1e-30    
ref|XP_006409564.1|  hypothetical protein EUTSA_v10022530mg             131   1e-30    
ref|XP_010327109.1|  PREDICTED: zinc finger BED domain-containing...    130   1e-30    Solanum lycopersicum
ref|XP_010551474.1|  PREDICTED: zinc finger BED domain-containing...    129   1e-30    Tarenaya hassleriana [spider flower]
ref|XP_011076819.1|  PREDICTED: zinc finger BED domain-containing...    129   1e-30    Sesamum indicum [beniseed]
gb|KGN55034.1|  hypothetical protein Csa_4G624400                       130   1e-30    Cucumis sativus [cucumbers]
gb|ACF86826.1|  unknown                                                 120   2e-30    Zea mays [maize]
ref|XP_011082939.1|  PREDICTED: zinc finger BED domain-containing...    128   4e-30    Sesamum indicum [beniseed]
ref|XP_010256080.1|  PREDICTED: zinc finger BED domain-containing...    128   4e-30    Nelumbo nucifera [Indian lotus]
ref|XP_010256082.1|  PREDICTED: zinc finger BED domain-containing...    128   4e-30    Nelumbo nucifera [Indian lotus]
gb|KJB27004.1|  hypothetical protein B456_004G271300                    128   5e-30    Gossypium raimondii
ref|XP_009138908.1|  PREDICTED: zinc finger BED domain-containing...    129   8e-30    Brassica rapa
ref|XP_010655772.1|  PREDICTED: zinc finger BED domain-containing...    121   1e-29    Vitis vinifera
ref|XP_007021998.1|  BED zinc finger,hAT family dimerization doma...    126   2e-29    
ref|XP_007022001.1|  BED zinc finger,hAT family dimerization doma...    127   2e-29    
ref|XP_010060762.1|  PREDICTED: zinc finger BED domain-containing...    126   2e-29    Eucalyptus grandis [rose gum]
ref|XP_011460829.1|  PREDICTED: zinc finger BED domain-containing...    126   2e-29    Fragaria vesca subsp. vesca
ref|XP_007216990.1|  hypothetical protein PRUPE_ppa002590mg             126   2e-29    Prunus persica
emb|CAN83599.1|  hypothetical protein VITISV_015691                     124   8e-29    Vitis vinifera
gb|KJB75465.1|  hypothetical protein B456_012G042700                    124   1e-28    Gossypium raimondii
ref|XP_010684309.1|  PREDICTED: zinc finger BED domain-containing...    121   2e-28    
gb|KGN47993.1|  hypothetical protein Csa_6G423350                       124   2e-28    Cucumis sativus [cucumbers]
gb|KJB45835.1|  hypothetical protein B456_007G331900                    122   4e-28    Gossypium raimondii
gb|KHG11798.1|  Putative AC transposase                                 122   5e-28    Gossypium arboreum [tree cotton]
gb|KHG07030.1|  Putative AC transposase                                 122   9e-28    Gossypium arboreum [tree cotton]
ref|XP_009356659.1|  PREDICTED: zinc finger BED domain-containing...    121   1e-27    Pyrus x bretschneideri [bai li]
ref|XP_009374223.1|  PREDICTED: zinc finger BED domain-containing...    117   1e-27    
ref|XP_009374222.1|  PREDICTED: zinc finger BED domain-containing...    117   1e-27    
emb|CDY20085.1|  BnaA01g29170D                                          120   2e-27    Brassica napus [oilseed rape]
ref|XP_008343867.1|  PREDICTED: uncharacterized protein LOC103406660    119   2e-27    
emb|CAE04247.3|  OSJNBa0089N06.8                                        121   2e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006407043.1|  hypothetical protein EUTSA_v10020233mg             120   2e-27    
ref|NP_001053960.1|  Os04g0628400                                       121   2e-27    
ref|XP_010035892.1|  PREDICTED: zinc finger BED domain-containing...    120   2e-27    Eucalyptus grandis [rose gum]
ref|XP_008784137.1|  PREDICTED: zinc finger BED domain-containing...    115   2e-27    
ref|XP_009116606.1|  PREDICTED: zinc finger BED domain-containing...    120   3e-27    
ref|XP_007048823.1|  BED zinc finger,hAT family dimerization domain     120   3e-27    
gb|EYU28909.1|  hypothetical protein MIMGU_mgv1a002591mg                120   4e-27    Erythranthe guttata [common monkey flower]
gb|KHN18108.1|  Putative AC transposase                                 118   6e-27    Glycine soja [wild soybean]
ref|XP_007146367.1|  hypothetical protein PHAVU_006G034500g             119   6e-27    Phaseolus vulgaris [French bean]
ref|XP_011082213.1|  PREDICTED: zinc finger BED domain-containing...    114   7e-27    
ref|XP_008804919.1|  PREDICTED: zinc finger BED domain-containing...    111   8e-27    Phoenix dactylifera
ref|XP_009759412.1|  PREDICTED: zinc finger BED domain-containing...    116   9e-27    Nicotiana sylvestris
emb|CDY38777.1|  BnaA07g28490D                                          118   1e-26    Brassica napus [oilseed rape]
ref|XP_009105674.1|  PREDICTED: zinc finger BED domain-containing...    118   1e-26    Brassica rapa
ref|NP_001130386.1|  uncharacterized protein LOC100191482               117   1e-26    
gb|EMS55659.1|  Putative AC transposase                                 119   1e-26    Triticum urartu
ref|XP_009797845.1|  PREDICTED: zinc finger BED domain-containing...    115   1e-26    Nicotiana sylvestris
ref|XP_007032573.1|  BED zinc finger,hAT family dimerization domain     112   1e-26    
ref|XP_008780286.1|  PREDICTED: zinc finger BED domain-containing...    112   2e-26    Phoenix dactylifera
emb|CDY11633.1|  BnaC06g31060D                                          117   2e-26    Brassica napus [oilseed rape]
gb|AAG52564.1|AC010675_12  unknown protein; 6859-4829                   117   2e-26    Arabidopsis thaliana [mouse-ear cress]
gb|KHM99619.1|  Putative AC transposase                                 117   3e-26    Glycine soja [wild soybean]
gb|AAD39658.1|AC007591_23  Similar to gi|22113 Ac transposase (OR...    118   3e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779859.1|  PREDICTED: zinc finger BED domain-containing...    110   3e-26    
ref|XP_008779300.1|  PREDICTED: zinc finger BED domain-containing...    112   4e-26    
ref|XP_006297141.1|  hypothetical protein CARUB_v10013145mg             117   4e-26    Capsella rubella
ref|XP_010253168.1|  PREDICTED: zinc finger BED domain-containing...    117   5e-26    Nelumbo nucifera [Indian lotus]
dbj|BAB02646.1|  Ac transposase-like protein                            117   5e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009610782.1|  PREDICTED: zinc finger BED domain-containing...    112   5e-26    
ref|XP_010253170.1|  PREDICTED: zinc finger BED domain-containing...    116   6e-26    Nelumbo nucifera [Indian lotus]
ref|XP_002455637.1|  hypothetical protein SORBIDRAFT_03g015311          115   6e-26    
emb|CAJ32533.1|  transposase-related protein w-gary2                    117   7e-26    Triticum aestivum [Canadian hard winter wheat]
emb|CAJ32532.1|  transposase related protein w-gary1                    117   7e-26    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011470501.1|  PREDICTED: zinc finger BED domain-containing...    115   8e-26    Fragaria vesca subsp. vesca
ref|XP_010535019.1|  PREDICTED: zinc finger BED domain-containing...    116   9e-26    Tarenaya hassleriana [spider flower]
gb|KDP42662.1|  hypothetical protein JCGZ_00166                         115   1e-25    Jatropha curcas
ref|XP_009377735.1|  PREDICTED: zinc finger BED domain-containing...    115   1e-25    Pyrus x bretschneideri [bai li]
ref|XP_002443959.1|  hypothetical protein SORBIDRAFT_07g005050          115   1e-25    
ref|XP_006416924.1|  hypothetical protein EUTSA_v10009614mg             116   1e-25    
ref|XP_010465389.1|  PREDICTED: zinc finger BED domain-containing...    115   1e-25    Camelina sativa [gold-of-pleasure]
ref|XP_009590929.1|  PREDICTED: zinc finger BED domain-containing...    112   1e-25    
ref|NP_001054384.1|  Os05g0102300                                       114   2e-25    
ref|XP_009339884.1|  PREDICTED: zinc finger BED domain-containing...    108   2e-25    
ref|XP_009762657.1|  PREDICTED: zinc finger BED domain-containing...    113   2e-25    
ref|XP_010234331.1|  PREDICTED: zinc finger BED domain-containing...    115   3e-25    
emb|CAJ32531.1|  transposase-related protein b-gary                     114   4e-25    
ref|NP_001175414.1|  Os08g0180400                                       114   4e-25    
ref|XP_010928367.1|  PREDICTED: zinc finger BED domain-containing...    107   5e-25    
ref|XP_007020914.1|  BED zinc finger,hAT family dimerization doma...    114   5e-25    
ref|XP_010497000.1|  PREDICTED: zinc finger BED domain-containing...    114   5e-25    
ref|XP_010474243.1|  PREDICTED: zinc finger BED domain-containing...    114   5e-25    
ref|XP_010512061.1|  PREDICTED: zinc finger BED domain-containing...    114   6e-25    
ref|XP_010502162.1|  PREDICTED: zinc finger BED domain-containing...    114   6e-25    
ref|XP_010512060.1|  PREDICTED: zinc finger BED domain-containing...    114   6e-25    
ref|XP_010487284.1|  PREDICTED: zinc finger BED domain-containing...    113   6e-25    
ref|XP_010502134.1|  PREDICTED: zinc finger BED domain-containing...    113   7e-25    
ref|XP_010502154.1|  PREDICTED: zinc finger BED domain-containing...    113   7e-25    
ref|XP_010502139.1|  PREDICTED: zinc finger BED domain-containing...    113   7e-25    
ref|XP_009767674.1|  PREDICTED: zinc finger BED domain-containing...    107   8e-25    
ref|XP_007227649.1|  hypothetical protein PRUPE_ppa016870mg             113   8e-25    
dbj|BAK01372.1|  predicted protein                                      113   1e-24    
gb|KJB36104.1|  hypothetical protein B456_006G141300                    112   1e-24    
ref|XP_007036331.1|  BED zinc finger,hAT family dimerization domain     112   1e-24    
ref|XP_010678116.1|  PREDICTED: zinc finger BED domain-containing...    106   1e-24    
ref|XP_008776470.1|  PREDICTED: zinc finger BED domain-containing...    110   1e-24    
gb|AAP53984.1|  hAT family dimerisation domain containing protein       112   2e-24    
ref|NP_001169279.1|  uncharacterized protein LOC100383142               112   2e-24    
ref|XP_007199330.1|  hypothetical protein PRUPE_ppa023755mg             111   2e-24    
ref|XP_009780905.1|  PREDICTED: uncharacterized protein LOC104229878    108   2e-24    
ref|NP_001172874.1|  Os02g0237700                                       111   3e-24    
ref|XP_010415664.1|  PREDICTED: zinc finger BED domain-containing...    111   3e-24    
ref|XP_007221262.1|  hypothetical protein PRUPE_ppa020713mg             111   3e-24    
ref|XP_010415663.1|  PREDICTED: zinc finger BED domain-containing...    111   3e-24    
ref|XP_007219605.1|  hypothetical protein PRUPE_ppa023156mg             111   3e-24    
ref|XP_007227103.1|  hypothetical protein PRUPE_ppa025706mg             111   4e-24    
ref|XP_010462713.1|  PREDICTED: zinc finger BED domain-containing...    112   4e-24    
ref|XP_007224101.1|  hypothetical protein PRUPE_ppa015615mg             111   4e-24    
gb|KCW80149.1|  hypothetical protein EUGRSUZ_C01493                     110   4e-24    
ref|XP_010686703.1|  PREDICTED: zinc finger BED domain-containing...    111   5e-24    
ref|XP_009769481.1|  PREDICTED: zinc finger BED domain-containing...    105   5e-24    
ref|XP_008778371.1|  PREDICTED: zinc finger BED domain-containing...    106   5e-24    
ref|XP_006390942.1|  hypothetical protein EUTSA_v10018229mg             110   6e-24    
ref|XP_007200126.1|  hypothetical protein PRUPE_ppa018034mg             110   7e-24    
ref|XP_010240467.1|  PREDICTED: zinc finger BED domain-containing...    110   8e-24    
gb|KJB27753.1|  hypothetical protein B456_005G007800                    110   8e-24    
gb|ACN33643.1|  unknown                                                 110   8e-24    
ref|XP_009769521.1|  PREDICTED: zinc finger BED domain-containing...    108   1e-23    
ref|XP_008779896.1|  PREDICTED: zinc finger BED domain-containing...    104   1e-23    
gb|KJB50760.1|  hypothetical protein B456_008G186400                    109   1e-23    
gb|KJB09837.1|  hypothetical protein B456_001G170000                    109   1e-23    
ref|XP_010056247.1|  PREDICTED: zinc finger BED domain-containing...    107   2e-23    
ref|NP_001060325.2|  Os07g0624100                                       110   2e-23    
ref|XP_010480984.1|  PREDICTED: zinc finger BED domain-containing...    107   2e-23    
ref|XP_009630946.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-23    
gb|KJB42529.1|  hypothetical protein B456_007G156600                    109   2e-23    
emb|CDP09275.1|  unnamed protein product                                101   2e-23    
ref|XP_008779743.1|  PREDICTED: zinc finger BED domain-containing...    109   2e-23    
ref|XP_002448572.1|  hypothetical protein SORBIDRAFT_06g029390          109   2e-23    
gb|KCW80278.1|  hypothetical protein EUGRSUZ_C01635                     108   2e-23    
ref|XP_010470025.1|  PREDICTED: zinc finger BED domain-containing...    105   3e-23    
ref|XP_010916778.1|  PREDICTED: zinc finger BED domain-containing...    103   3e-23    
ref|XP_009775322.1|  PREDICTED: zinc finger BED domain-containing...    106   3e-23    
ref|NP_001151767.1|  LOC100285402                                       108   3e-23    
ref|XP_007022882.1|  BED zinc finger,hAT family dimerization doma...    108   4e-23    
ref|XP_009769155.1|  PREDICTED: zinc finger BED domain-containing...    102   4e-23    
ref|XP_009418454.1|  PREDICTED: zinc finger BED domain-containing...    108   4e-23    
ref|XP_007022002.1|  BED zinc finger,hAT family dimerization doma...    108   4e-23    
ref|XP_011085903.1|  PREDICTED: zinc finger BED domain-containing...    104   5e-23    
ref|XP_008792782.1|  PREDICTED: zinc finger BED domain-containing...    107   8e-23    
ref|XP_008792783.1|  PREDICTED: zinc finger BED domain-containing...    107   9e-23    
ref|XP_009372067.1|  PREDICTED: zinc finger BED domain-containing...    105   9e-23    
ref|XP_009110492.1|  PREDICTED: zinc finger BED domain-containing...    107   1e-22    
ref|XP_006305940.1|  hypothetical protein CARUB_v10011179mg             107   1e-22    
ref|XP_010236819.1|  PREDICTED: zinc finger BED domain-containing...    104   1e-22    
gb|KJB73059.1|  hypothetical protein B456_011G212800                    107   1e-22    
ref|XP_006658274.1|  PREDICTED: uncharacterized protein LOC102709665    106   1e-22    
ref|XP_010468189.1|  PREDICTED: zinc finger BED domain-containing...    105   1e-22    
ref|XP_009766998.1|  PREDICTED: zinc finger BED domain-containing...    105   1e-22    
gb|KCW72874.1|  hypothetical protein EUGRSUZ_E01324                     107   1e-22    
ref|XP_010666012.1|  PREDICTED: zinc finger BED domain-containing...    106   1e-22    
ref|XP_009372066.1|  PREDICTED: zinc finger BED domain-containing...    106   2e-22    
ref|XP_009804558.1|  PREDICTED: zinc finger BED domain-containing...    102   2e-22    
ref|XP_009781566.1|  PREDICTED: zinc finger BED domain-containing...    102   2e-22    
ref|XP_009118128.1|  PREDICTED: zinc finger BED domain-containing...    105   2e-22    
ref|XP_009781000.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-22    
ref|XP_009770558.1|  PREDICTED: zinc finger BED domain-containing...    102   3e-22    
emb|CDX83987.1|  BnaC08g16580D                                          106   3e-22    
ref|XP_011008584.1|  PREDICTED: zinc finger BED domain-containing...    101   3e-22    
ref|XP_007214254.1|  hypothetical protein PRUPE_ppa024136mg             106   3e-22    
gb|ABA98760.1|  hAT family dimerisation domain containing protein       105   3e-22    
ref|XP_006380778.1|  hypothetical protein POPTR_0007s13470g             105   3e-22    
ref|XP_010924127.1|  PREDICTED: zinc finger BED domain-containing...    105   4e-22    
emb|CDP22169.1|  unnamed protein product                                103   4e-22    
gb|EEC83056.1|  hypothetical protein OsI_28162                          103   4e-22    
ref|XP_007221311.1|  hypothetical protein PRUPE_ppa025777mg             105   5e-22    
ref|XP_007213385.1|  hypothetical protein PRUPE_ppa026473mg             105   5e-22    
ref|XP_010232197.1|  PREDICTED: zinc finger BED domain-containing...    105   5e-22    
ref|XP_007225531.1|  hypothetical protein PRUPE_ppa025795mg             105   6e-22    
ref|XP_011465667.1|  PREDICTED: zinc finger BED domain-containing...    100   6e-22    
ref|XP_009148917.1|  PREDICTED: zinc finger BED domain-containing...    104   8e-22    
emb|CAN80405.1|  hypothetical protein VITISV_006869                     102   1e-21    
ref|XP_007224708.1|  hypothetical protein PRUPE_ppa025218mg             103   1e-21    
emb|CAN78233.1|  hypothetical protein VITISV_027466                     104   1e-21    
ref|XP_011468655.1|  PREDICTED: zinc finger BED domain-containing...    103   1e-21    
gb|KJB30382.1|  hypothetical protein B456_005G140200                    103   1e-21    
gb|EEE68154.1|  hypothetical protein OsJ_26265                          104   1e-21    
gb|EPS71279.1|  hypothetical protein M569_03484                         102   2e-21    
ref|XP_007033377.1|  BED zinc finger,hAT family dimerization doma...    103   2e-21    
ref|XP_006384497.1|  hypothetical protein POPTR_0004s15890g             102   2e-21    
ref|XP_010247653.1|  PREDICTED: zinc finger BED domain-containing...    100   2e-21    
ref|XP_008798027.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-21    
ref|XP_007033376.1|  BED zinc finger,hAT family dimerization doma...    103   2e-21    
ref|XP_007033378.1|  BED zinc finger,hAT family dimerization doma...    103   2e-21    
ref|XP_010907377.1|  PREDICTED: zinc finger BED domain-containing...    100   2e-21    
gb|KJB39155.1|  hypothetical protein B456_007G001000                    103   2e-21    
ref|XP_010490052.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-21    
gb|EEC83003.1|  hypothetical protein OsI_28049                          103   2e-21    
ref|XP_009394499.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-21    
ref|XP_009791353.1|  PREDICTED: zinc finger BED domain-containing...    102   2e-21    
ref|XP_008791217.1|  PREDICTED: zinc finger BED domain-containing...    103   2e-21    
ref|XP_010923373.1|  PREDICTED: zinc finger BED domain-containing...    103   3e-21    
ref|XP_006383274.1|  hypothetical protein POPTR_0005s13270g             100   3e-21    
ref|XP_011462907.1|  PREDICTED: zinc finger BED domain-containing...    100   4e-21    
ref|XP_006384292.1|  hypothetical protein POPTR_0004s11480g             102   4e-21    
emb|CAA25635.1|  unnamed protein product                              98.2    5e-21    
ref|XP_008238080.1|  PREDICTED: uncharacterized protein LOC103336760    101   5e-21    
ref|XP_007203825.1|  hypothetical protein PRUPE_ppa014705m2g          96.3    5e-21    
gb|KJB29513.1|  hypothetical protein B456_005G104500                    102   6e-21    
ref|XP_010923384.1|  PREDICTED: zinc finger BED domain-containing...    102   6e-21    
ref|XP_009774379.1|  PREDICTED: zinc finger BED domain-containing...  96.3    6e-21    
ref|XP_002444581.1|  hypothetical protein SORBIDRAFT_07g023966        97.1    7e-21    
ref|XP_009767846.1|  PREDICTED: zinc finger BED domain-containing...    102   8e-21    
ref|XP_009604434.1|  PREDICTED: zinc finger BED domain-containing...  99.0    1e-20    
ref|XP_009608078.1|  PREDICTED: zinc finger BED domain-containing...  97.8    1e-20    
ref|XP_009608079.1|  PREDICTED: zinc finger BED domain-containing...  97.4    2e-20    
ref|XP_010274137.1|  PREDICTED: zinc finger BED domain-containing...    100   2e-20    
ref|XP_002456204.1|  hypothetical protein SORBIDRAFT_03g032090          100   2e-20    
ref|XP_010692516.1|  PREDICTED: zinc finger BED domain-containing...  97.4    2e-20    
ref|XP_009357245.1|  PREDICTED: zinc finger BED domain-containing...  98.2    2e-20    
gb|EEE68201.1|  hypothetical protein OsJ_26362                          100   2e-20    
ref|XP_009757222.1|  PREDICTED: zinc finger BED domain-containing...  96.7    2e-20    
ref|XP_008680982.1|  PREDICTED: uncharacterized protein LOC100191...    100   2e-20    
ref|NP_001130635.1|  uncharacterized protein LOC100191735               100   2e-20    
ref|XP_010675028.1|  PREDICTED: zinc finger BED domain-containing...    100   2e-20    
ref|XP_009780212.1|  PREDICTED: zinc finger BED domain-containing...    100   2e-20    
gb|EAZ05927.1|  hypothetical protein OsI_28164                          100   2e-20    
ref|XP_007200690.1|  hypothetical protein PRUPE_ppa026648m1g          95.9    3e-20    
ref|XP_003591965.1|  Elongation factor 1-alpha                          100   3e-20    
ref|XP_009604433.1|  PREDICTED: zinc finger BED domain-containing...  99.0    3e-20    
ref|XP_011046058.1|  PREDICTED: zinc finger BED domain-containing...    100   3e-20    
gb|KJB76715.1|  hypothetical protein B456_012G102500                  99.8    3e-20    
ref|XP_007200197.1|  hypothetical protein PRUPE_ppa016010mg             100   4e-20    
ref|XP_009768907.1|  PREDICTED: zinc finger BED domain-containing...  98.6    4e-20    
ref|XP_009757221.1|  PREDICTED: zinc finger BED domain-containing...  96.7    4e-20    
ref|XP_010678441.1|  PREDICTED: zinc finger BED domain-containing...    100   4e-20    
emb|CDX81706.1|  BnaC08g38950D                                        99.0    4e-20    
ref|XP_010237819.1|  PREDICTED: zinc finger BED domain-containing...  99.0    5e-20    
ref|XP_010693749.1|  PREDICTED: zinc finger BED domain-containing...  99.8    5e-20    
ref|XP_011046060.1|  PREDICTED: zinc finger BED domain-containing...  99.8    5e-20    
ref|XP_002451486.1|  hypothetical protein SORBIDRAFT_04g002725        99.0    6e-20    
ref|XP_009775590.1|  PREDICTED: zinc finger BED domain-containing...  99.4    7e-20    
ref|XP_009618720.1|  PREDICTED: zinc finger BED domain-containing...  97.8    9e-20    
ref|XP_009773687.1|  PREDICTED: zinc finger BED domain-containing...  97.8    9e-20    
ref|XP_010682485.1|  PREDICTED: zinc finger BED domain-containing...  93.6    1e-19    
ref|XP_011462906.1|  PREDICTED: zinc finger BED domain-containing...  97.8    1e-19    
ref|XP_009765425.1|  PREDICTED: zinc finger BED domain-containing...  97.4    1e-19    
ref|XP_006374644.1|  hypothetical protein POPTR_0015s13960g           98.2    1e-19    
ref|XP_010260312.1|  PREDICTED: uncharacterized protein LOC104599462  94.4    1e-19    
ref|XP_011460276.1|  PREDICTED: zinc finger BED domain-containing...  94.7    1e-19    
ref|XP_010501749.1|  PREDICTED: zinc finger BED domain-containing...  98.6    2e-19    
sp|P08770.2|TRA1_MAIZE  RecName: Full=Putative AC transposase; Al...  98.2    2e-19    
ref|XP_002452110.1|  hypothetical protein SORBIDRAFT_04g019795        92.0    2e-19    
ref|XP_010247003.1|  PREDICTED: zinc finger BED domain-containing...  92.0    2e-19    
ref|XP_006369187.1|  hypothetical protein POPTR_0001s18450g           97.4    2e-19    
ref|NP_001043974.1|  Os01g0698300                                     97.8    2e-19    
ref|XP_006370155.1|  hypothetical protein POPTR_0001s40220g           97.8    2e-19    
sp|P03010.1|TRAC9_MAIZE  RecName: Full=Putative AC9 transposase       97.8    2e-19    
ref|XP_009590167.1|  PREDICTED: zinc finger BED domain-containing...  95.5    2e-19    
ref|XP_010273256.1|  PREDICTED: zinc finger BED domain-containing...  92.8    2e-19    
ref|NP_001061196.1|  Os08g0198000                                     97.8    2e-19    
ref|XP_010686979.1|  PREDICTED: zinc finger BED domain-containing...  97.4    2e-19    
gb|AAX95923.1|  transposon protein, putative, unclassified            97.8    2e-19    
ref|XP_009790469.1|  PREDICTED: zinc finger BED domain-containing...  93.2    2e-19    
ref|NP_001062550.1|  Os09g0101200                                     96.7    3e-19    
ref|XP_010229759.1|  PREDICTED: zinc finger BED domain-containing...  96.7    3e-19    
ref|XP_009596761.1|  PREDICTED: zinc finger BED domain-containing...  94.4    3e-19    
ref|XP_006384349.1|  hypothetical protein POPTR_0004s13680g           96.7    3e-19    
ref|XP_009781949.1|  PREDICTED: zinc finger BED domain-containing...  97.8    3e-19    
ref|XP_011462645.1|  PREDICTED: zinc finger BED domain-containing...  95.1    3e-19    
ref|XP_010271391.1|  PREDICTED: zinc finger BED domain-containing...  95.1    3e-19    
ref|XP_010548831.1|  PREDICTED: zinc finger BED domain-containing...  97.4    3e-19    
ref|NP_001174030.1|  Os04g0542100                                     94.4    3e-19    
gb|KHN10510.1|  Putative AC transposase                               94.4    3e-19    
ref|XP_009591036.1|  PREDICTED: zinc finger BED domain-containing...  93.2    4e-19    
gb|ABF94985.1|  hAT family dimerisation domain containing protein     97.1    4e-19    
ref|XP_006380262.1|  hypothetical protein POPTR_0007s00640g           95.9    4e-19    
ref|XP_010326126.1|  PREDICTED: zinc finger BED domain-containing...  93.2    4e-19    
gb|EEC71336.1|  hypothetical protein OsI_03395                        96.7    5e-19    
ref|XP_009629645.1|  PREDICTED: zinc finger BED domain-containing...  95.1    5e-19    
ref|XP_009785735.1|  PREDICTED: zinc finger BED domain-containing...  91.7    5e-19    
ref|NP_001057110.1|  Os06g0209900                                     97.1    5e-19    
gb|KJB23882.1|  hypothetical protein B456_004G119900                  96.3    5e-19    
ref|XP_009764185.1|  PREDICTED: zinc finger BED domain-containing...  92.8    5e-19    
ref|XP_007224714.1|  hypothetical protein PRUPE_ppa025056mg           95.9    5e-19    
ref|XP_006371212.1|  hypothetical protein POPTR_0019s06065g           95.9    6e-19    
ref|XP_007217385.1|  hypothetical protein PRUPE_ppa025773mg           96.3    6e-19    
ref|XP_006375745.1|  hypothetical protein POPTR_0013s01720g           95.9    7e-19    
gb|AEF33496.1|  putative transposase                                  95.9    7e-19    
ref|XP_009788201.1|  PREDICTED: zinc finger BED domain-containing...  92.4    7e-19    
gb|KJB80009.1|  hypothetical protein B456_013G077200                  95.5    8e-19    
ref|XP_009774751.1|  PREDICTED: zinc finger BED domain-containing...  94.4    1e-18    
ref|XP_011462908.1|  PREDICTED: zinc finger BED domain-containing...  95.1    1e-18    
gb|ABD32595.1|  HAT dimerisation                                      89.7    1e-18    
ref|XP_010468590.1|  PREDICTED: zinc finger BED domain-containing...  92.0    1e-18    
ref|XP_007044089.1|  Uncharacterized protein TCM_008928               91.3    1e-18    
gb|KJB10737.1|  hypothetical protein B456_001G220000                  95.1    1e-18    
gb|KJB27884.1|  hypothetical protein B456_005G014600                  95.9    1e-18    
ref|XP_010507065.1|  PREDICTED: zinc finger BED domain-containing...  90.5    1e-18    
gb|KJB33209.1|  hypothetical protein B456_006G000800                  95.1    1e-18    
ref|XP_009624860.1|  PREDICTED: zinc finger BED domain-containing...  91.7    2e-18    
ref|XP_009775656.1|  PREDICTED: zinc finger BED domain-containing...  95.1    2e-18    
ref|XP_010265968.1|  PREDICTED: zinc finger BED domain-containing...  93.6    2e-18    



>ref|XP_009613825.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=785

 Score =   333 bits (855),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 176/192 (92%), Gaps = 2/192 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGE+A+TYV+IV+EGIHELF +YVALPLPLTPTY EEANGGA+  +
Sbjct  594  RFKMKLVEFSFTKIYGEEAATYVKIVEEGIHELFLEYVALPLPLTPTYAEEANGGAIKQE  653

Query  558  DAQEL--STNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            +AQ+L  S+N  GLTDFDA+IMET+SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK
Sbjct  654  NAQDLGASSNGAGLTDFDAYIMETTSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  713

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YPTLSKMARDIL+VPVST PADSVF TV KEMD+YRCSLRPETVEAL+CAKDW QN  V 
Sbjct  714  YPTLSKMARDILSVPVSTVPADSVFCTVGKEMDQYRCSLRPETVEALICAKDWLQNASVD  773

Query  204  SITAPIKMEVPI  169
            ++ APIKMEVPI
Sbjct  774  TLHAPIKMEVPI  785



>ref|XP_009761601.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
 ref|XP_009761602.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
Length=798

 Score =   328 bits (840),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 174/192 (91%), Gaps = 2/192 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGE+A+TYV+IV+EGIHELF +YVALPLPLTPTY EEANGG +  +
Sbjct  607  RFKMKLVEFSFTKIYGEEAATYVKIVEEGIHELFLEYVALPLPLTPTYAEEANGGDIKQE  666

Query  558  DAQEL--STNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            +AQ+L  S+N  GLTDFDA+IMET+SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK
Sbjct  667  NAQDLGASSNGAGLTDFDAYIMETTSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  726

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YPTLSKMARDIL+VPVST  ADSVF TV KEMD+YRCSLRPETVEAL+CAKDW QN  V 
Sbjct  727  YPTLSKMARDILSVPVSTVTADSVFCTVGKEMDQYRCSLRPETVEALICAKDWLQNASVD  786

Query  204  SITAPIKMEVPI  169
            ++ APIKMEVPI
Sbjct  787  TLHAPIKMEVPI  798



>ref|XP_009791008.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
Length=742

 Score =   326 bits (835),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 174/192 (91%), Gaps = 2/192 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGE+A+TYV+IV+EGIHELF +YVALPLPLTPTY E+ANGGA+  +
Sbjct  551  RFKMKLVEFSFTKIYGEEAATYVKIVEEGIHELFLEYVALPLPLTPTYAEDANGGAMKQE  610

Query  558  DAQEL--STNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            +AQ +  S+N  GLTDFDA+IMET+SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK
Sbjct  611  NAQGVGASSNGAGLTDFDAYIMETTSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  670

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YPTLS MARDIL+VPVST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V 
Sbjct  671  YPTLSIMARDILSVPVSTITADSVFSTVSKEMDRYRCSLRPETVEALICAKDWLQNASVN  730

Query  204  SITAPIKMEVPI  169
            ++ AP+KMEVPI
Sbjct  731  TLHAPLKMEVPI  742



>ref|XP_009621122.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=743

 Score =   325 bits (832),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 2/192 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGE+A+TYV+IV+EGIHELF +YVALPLPLTPTY EEANGGA+  +
Sbjct  552  RFKMKLVEFSFTKIYGEEAATYVKIVEEGIHELFLEYVALPLPLTPTYAEEANGGAMKQE  611

Query  558  DAQEL--STNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            +A  +  S+N  GLTDFDA+IMET+SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK
Sbjct  612  NAHGVGASSNGPGLTDFDAYIMETTSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  671

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YPTLSKMARDIL+VPVS+  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN    
Sbjct  672  YPTLSKMARDILSVPVSSVTADSVFSTVSKEMDRYRCSLRPETVEALICAKDWLQNASEN  731

Query  204  SITAPIKMEVPI  169
            ++ APIKMEVPI
Sbjct  732  TLHAPIKMEVPI  743



>ref|XP_010312124.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Solanum lycopersicum]
Length=772

 Score =   317 bits (812),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 166/192 (86%), Gaps = 2/192 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKIYGE+A+ YV+ V+EGIHELF +YVALPLPLTPTY+EE NG  +  +
Sbjct  581  RFKMKLVEFSFSKIYGEEAAAYVKTVEEGIHELFNEYVALPLPLTPTYVEEVNGSGMRQE  640

Query  558  DAQEL--STNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            D Q L  S N LGLTDFD +IMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR+K
Sbjct  641  DGQGLDASCNGLGLTDFDVYIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRIK  700

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YPTLSKMARDIL+VPVST  ADS+FSTV KEMD YRCSLRPETVEAL+CAKDW QN  + 
Sbjct  701  YPTLSKMARDILSVPVSTVTADSIFSTVSKEMDHYRCSLRPETVEALICAKDWLQNASLD  760

Query  204  SITAPIKMEVPI  169
            +   PIKMEVPI
Sbjct  761  TSPIPIKMEVPI  772



>ref|XP_010313787.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X5 [Solanum lycopersicum]
Length=907

 Score =   309 bits (791),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 165/190 (87%), Gaps = 6/190 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGE+A+T+V+ V+EGIHELF +YVALPLPLTP Y EE + GA+  +
Sbjct  724  RFKMKLVEFSFTKIYGEEAATFVKFVEEGIHELFLEYVALPLPLTPAYAEEVDDGALKQE  783

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
            +         GLTDFDA+IMET+SQQSRSELDQYL+ESLLPRVHEFDVVGWWKLNRMKYP
Sbjct  784  NGGG------GLTDFDAYIMETTSQQSRSELDQYLDESLLPRVHEFDVVGWWKLNRMKYP  837

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  199
            TLSKMARDIL+VPVST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++
Sbjct  838  TLSKMARDILSVPVSTVTADSVFSTVGKEMDRYRCSLRPETVEALICAKDWLQNASVNTL  897

Query  198  TAPIKMEVPI  169
             APIKMEVPI
Sbjct  898  HAPIKMEVPI  907



>ref|XP_010313784.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Solanum lycopersicum]
Length=921

 Score =   309 bits (792),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 165/190 (87%), Gaps = 6/190 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGE+A+T+V+ V+EGIHELF +YVALPLPLTP Y EE + GA+  +
Sbjct  738  RFKMKLVEFSFTKIYGEEAATFVKFVEEGIHELFLEYVALPLPLTPAYAEEVDDGALKQE  797

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
            +         GLTDFDA+IMET+SQQSRSELDQYL+ESLLPRVHEFDVVGWWKLNRMKYP
Sbjct  798  NGGG------GLTDFDAYIMETTSQQSRSELDQYLDESLLPRVHEFDVVGWWKLNRMKYP  851

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  199
            TLSKMARDIL+VPVST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++
Sbjct  852  TLSKMARDILSVPVSTVTADSVFSTVGKEMDRYRCSLRPETVEALICAKDWLQNASVNTL  911

Query  198  TAPIKMEVPI  169
             APIKMEVPI
Sbjct  912  HAPIKMEVPI  921



>ref|XP_010313785.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Solanum lycopersicum]
 ref|XP_010313786.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X4 [Solanum lycopersicum]
Length=921

 Score =   309 bits (791),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 165/190 (87%), Gaps = 6/190 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGE+A+T+V+ V+EGIHELF +YVALPLPLTP Y EE + GA+  +
Sbjct  738  RFKMKLVEFSFTKIYGEEAATFVKFVEEGIHELFLEYVALPLPLTPAYAEEVDDGALKQE  797

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
            +         GLTDFDA+IMET+SQQSRSELDQYL+ESLLPRVHEFDVVGWWKLNRMKYP
Sbjct  798  NGGG------GLTDFDAYIMETTSQQSRSELDQYLDESLLPRVHEFDVVGWWKLNRMKYP  851

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  199
            TLSKMARDIL+VPVST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++
Sbjct  852  TLSKMARDILSVPVSTVTADSVFSTVGKEMDRYRCSLRPETVEALICAKDWLQNASVNTL  911

Query  198  TAPIKMEVPI  169
             APIKMEVPI
Sbjct  912  HAPIKMEVPI  921



>ref|XP_010313781.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010313782.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010313783.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
Length=935

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 165/190 (87%), Gaps = 6/190 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGE+A+T+V+ V+EGIHELF +YVALPLPLTP Y EE + GA+  +
Sbjct  752  RFKMKLVEFSFTKIYGEEAATFVKFVEEGIHELFLEYVALPLPLTPAYAEEVDDGALKQE  811

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
            +         GLTDFDA+IMET+SQQSRSELDQYL+ESLLPRVHEFDVVGWWKLNRMKYP
Sbjct  812  NGGG------GLTDFDAYIMETTSQQSRSELDQYLDESLLPRVHEFDVVGWWKLNRMKYP  865

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  199
            TLSKMARDIL+VPVST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++
Sbjct  866  TLSKMARDILSVPVSTVTADSVFSTVGKEMDRYRCSLRPETVEALICAKDWLQNASVNTL  925

Query  198  TAPIKMEVPI  169
             APIKMEVPI
Sbjct  926  HAPIKMEVPI  935



>ref|XP_011078385.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Sesamum indicum]
 ref|XP_011078386.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Sesamum indicum]
Length=700

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 166/192 (86%), Gaps = 2/192 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKIYGE+A++YV++VD+GIHELF +YVALPLPLTP Y EEANG ++  +
Sbjct  509  RFKMKLVEFSFSKIYGEEAASYVKVVDDGIHELFLEYVALPLPLTPAYAEEANGASIKPE  568

Query  558  DAQEL--STNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            D Q +  S+N LGLTDFD +IMET+SQ ++SELDQYLEESLLPRVHEFDV+GWWKLNR+K
Sbjct  569  DPQGMGISSNGLGLTDFDVYIMETTSQLAKSELDQYLEESLLPRVHEFDVIGWWKLNRIK  628

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YPTLSKMARDIL++PV T PA SVF TV KEMD YRCSLRPETVEAL+CAKDW Q+E V+
Sbjct  629  YPTLSKMARDILSIPVCTVPATSVFDTVRKEMDSYRCSLRPETVEALICAKDWLQSENVE  688

Query  204  SITAPIKMEVPI  169
            +    +KME PI
Sbjct  689  TALPVVKMEAPI  700



>emb|CDP10447.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 165/195 (85%), Gaps = 5/195 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPT--YIEEANGGAVN  565
            RFKMKLVEFSFSKIY E+A+TYV+IVDEGIHELF +YVALPLPL  T  Y+EEAN G V 
Sbjct  291  RFKMKLVEFSFSKIYNEEAATYVKIVDEGIHELFVEYVALPLPLPLTPTYVEEANNGTVK  350

Query  564  TQDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             +D Q    L++N LGLTDFD +IMET+SQQS+SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  351  AEDPQGGNLLASNGLGLTDFDVYIMETTSQQSKSELDQYLEESLLPRVHEFDVVGWWKLN  410

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            RMKYPTLSKMARDIL++PVST P  SVF TV KEMDRYRCSLRPETVEAL+CAKDW Q  
Sbjct  411  RMKYPTLSKMARDILSIPVSTVPVGSVFDTVGKEMDRYRCSLRPETVEALICAKDWIQGV  470

Query  213  LVKSITAPIKMEVPI  169
             V +   P+KMEVPI
Sbjct  471  SVDTSIVPVKMEVPI  485



>emb|CAN68819.1| hypothetical protein VITISV_023069 [Vitis vinifera]
Length=195

 Score =   260 bits (665),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 152/177 (86%), Gaps = 6/177 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDAS-TYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT  562
            RFKMKLVEFSF KIYG++A+ T +R+VDEG+HELF +YVALPLPLTPTY++E N G++  
Sbjct  4    RFKMKLVEFSFPKIYGDEAAPTCIRVVDEGLHELFLEYVALPLPLTPTYVDEGNAGSMKG  63

Query  561  QDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +D  +   LS+N  GL+DFD +I+ETSSQQ +SELDQYLEES+LPRVHEFD++GWWKLN+
Sbjct  64   EDHSQGGLLSSN--GLSDFDVYILETSSQQMKSELDQYLEESVLPRVHEFDLLGWWKLNK  121

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            +KYPTLSKMARDIL++PVS+   +S++ TV KEMD YR SLRPETVEAL+CAKDW Q
Sbjct  122  LKYPTLSKMARDILSIPVSSVAVESIYDTVGKEMDEYRNSLRPETVEALICAKDWLQ  178



>ref|XP_011457831.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=949

 Score =   273 bits (698),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNT  562
            RFKMKLVEFSF+K+YGE+A T+++IVD+GIHELF +Y+ LPLPLTP Y EE N GG   T
Sbjct  761  RFKMKLVEFSFNKVYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPAYAEEGNAGGNTRT  820

Query  561  QDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +D+Q  +T + GLTDFD +IMET+SQQ +SELDQYLEE+LLPRVHEFDV+GWWKLN+MKY
Sbjct  821  EDSQGGTTADNGLTDFDVYIMETTSQQMKSELDQYLEEALLPRVHEFDVLGWWKLNKMKY  880

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARDIL++PVST  +DSVF     EMD+YR SLRPET+EA++CAKDW Q
Sbjct  881  PTLSKMARDILSIPVSTVSSDSVFDNTANEMDQYRSSLRPETLEAVICAKDWMQ  934



>ref|XP_011457833.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=917

 Score =   273 bits (697),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNT  562
            RFKMKLVEFSF+K+YGE+A T+++IVD+GIHELF +Y+ LPLPLTP Y EE N GG   T
Sbjct  729  RFKMKLVEFSFNKVYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPAYAEEGNAGGNTRT  788

Query  561  QDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +D+Q  +T + GLTDFD +IMET+SQQ +SELDQYLEE+LLPRVHEFDV+GWWKLN+MKY
Sbjct  789  EDSQGGTTADNGLTDFDVYIMETTSQQMKSELDQYLEEALLPRVHEFDVLGWWKLNKMKY  848

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARDIL++PVST  +DSVF     EMD+YR SLRPET+EA++CAKDW Q
Sbjct  849  PTLSKMARDILSIPVSTVSSDSVFDNTANEMDQYRSSLRPETLEAVICAKDWMQ  902



>gb|KJB23615.1| hypothetical protein B456_004G107300 [Gossypium raimondii]
 gb|KJB23616.1| hypothetical protein B456_004G107300 [Gossypium raimondii]
Length=673

 Score =   267 bits (683),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 149/186 (80%), Gaps = 8/186 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KI+GEDA TY++IVD+GIHELF +YVALPLPLTPTY EE N G     
Sbjct  485  RFKMKLVEFSFTKIFGEDAPTYIKIVDDGIHELFLEYVALPLPLTPTYTEEGNAGNNGKT  544

Query  558  DAQELST--NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            D  +     ++ GLTDFD +IMETSSQQ +SELDQYLEESLLPRV EFDV+GWWKLN+MK
Sbjct  545  DESQQGNLLSDQGLTDFDVYIMETSSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKMK  604

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW------Q  223
            YPTLSKMARDIL++PVS A  DSVF  + K++D YR SLRPETVEAL+CAKDW      +
Sbjct  605  YPTLSKMARDILSIPVSAAAPDSVFDIIIKQLDEYRSSLRPETVEALICAKDWLHYGSEE  664

Query  222  QNELVK  205
             N LVK
Sbjct  665  SNALVK  670



>ref|XP_007013535.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 ref|XP_007013536.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 ref|XP_007013537.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31154.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31155.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31156.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
Length=673

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYG+DA TY++IVD+GIHELF +YVALPLPLTPTY EE N G  N +
Sbjct  484  RFKMKLVEFSFTKIYGDDAPTYIKIVDDGIHELFLEYVALPLPLTPTYAEEGNAGN-NGK  542

Query  558  DAQELSTNEL---GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
                   N L   GLTDFD +IMET+SQQ +SELDQYLEESLLPRV EFDV+GWWKLN++
Sbjct  543  PEDSHQGNLLSDHGLTDFDVYIMETTSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKL  602

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            KYPTLSKMARDIL++PVS A  +SVF  V K++D+YR SLRPETVEAL+CAKDW      
Sbjct  603  KYPTLSKMARDILSIPVSAAAPESVFDIVDKQLDQYRSSLRPETVEALICAKDWLHYGST  662

Query  207  KSITAPIKME  178
            +   A +KME
Sbjct  663  EVSNALVKME  672



>gb|KHN15060.1| Putative AC transposase [Glycine soja]
Length=1154

 Score =   269 bits (688),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  738   RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
             RFKMKLVEFSF+KIYGEDA  YV+IVD+GIHELF +YVALPLPLTP Y EE N G+    
Sbjct  965   RFKMKLVEFSFTKIYGEDAHEYVKIVDDGIHELFHEYVALPLPLTPAYAEEGNAGSHPRA  1024

Query  558   DAQELST--NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                   T   + GLTDFD +IMETSS Q +SELDQYLEESLLPRV +FDV+GWWKLN++K
Sbjct  1025  GESPGGTLMPDNGLTDFDVYIMETSSHQMKSELDQYLEESLLPRVPDFDVLGWWKLNKLK  1084

Query  384   YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
             YPTLSKMARDIL+VPVS+ P +SVF T  KEMD+YR SLRPETVEA+VCAKDW Q    +
Sbjct  1085  YPTLSKMARDILSVPVSSVPPESVFDTKVKEMDQYRSSLRPETVEAIVCAKDWMQYGAAE  1144

Query  204   SITAPIKME  178
             +  A +KME
Sbjct  1145  ASNAIVKME  1153



>gb|KJB64715.1| hypothetical protein B456_010G061500 [Gossypium raimondii]
Length=678

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANG---GAV  568
            RFKMKLVEFSF+KIYGEDA TY++ VD+GIHELF +YVALPLPLTPTY+EE NG   G  
Sbjct  489  RFKMKLVEFSFTKIYGEDAPTYIKTVDDGIHELFLEYVALPLPLTPTYVEEVNGANNGKT  548

Query  567  NTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
            N      L ++  GL DFD +IMET+SQQ +SELDQYLEESLLPRV EFDV+GWWKLN+M
Sbjct  549  NESHQGNLLSDH-GLADFDVYIMETNSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKM  607

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            KYPTLSKMARDIL++PVS A  +S+F    K++D YR SLRPETVEAL+CAKDW      
Sbjct  608  KYPTLSKMARDILSIPVSAAATESIFDITDKQLDEYRSSLRPETVEALICAKDWLHYGSS  667

Query  207  KSITAPIKME  178
                A +KME
Sbjct  668  DVSNALVKME  677



>ref|XP_007013534.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY31153.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
Length=711

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 151/190 (79%), Gaps = 4/190 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYG+DA TY++IVD+GIHELF +YVALPLPLTPTY EE N G  N +
Sbjct  522  RFKMKLVEFSFTKIYGDDAPTYIKIVDDGIHELFLEYVALPLPLTPTYAEEGNAGN-NGK  580

Query  558  DAQELSTNEL---GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
                   N L   GLTDFD +IMET+SQQ +SELDQYLEESLLPRV EFDV+GWWKLN++
Sbjct  581  PEDSHQGNLLSDHGLTDFDVYIMETTSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKL  640

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            KYPTLSKMARDIL++PVS A  +SVF  V K++D+YR SLRPETVEAL+CAKDW      
Sbjct  641  KYPTLSKMARDILSIPVSAAAPESVFDIVDKQLDQYRSSLRPETVEALICAKDWLHYGST  700

Query  207  KSITAPIKME  178
            +   A +KME
Sbjct  701  EVSNALVKME  710



>gb|KDO73493.1| hypothetical protein CISIN_1g002915mg [Citrus sinensis]
 gb|KDO73494.1| hypothetical protein CISIN_1g002915mg [Citrus sinensis]
Length=866

 Score =   266 bits (679),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 154/190 (81%), Gaps = 3/190 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYG+DA TY++IVD+GIHELF +YV+LPLPLTPTY EE N G     
Sbjct  678  RFKMKLVEFSFTKIYGDDAPTYIKIVDDGIHELFLEYVSLPLPLTPTY-EEGNAGNNMKS  736

Query  558  DAQELST--NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            D  +  T  ++ GLTDFD FIMET++QQ +SELDQYL+ESLLPR H+FD++GWWKLN+MK
Sbjct  737  DESQGGTLLSDNGLTDFDMFIMETTNQQMKSELDQYLDESLLPRAHDFDLLGWWKLNKMK  796

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YPTLSKMARDIL+VPV +   DSVF TV KE+DRYR SLRPETVEAL+CAKDW Q    +
Sbjct  797  YPTLSKMARDILSVPVCSVGQDSVFDTVSKELDRYRSSLRPETVEALICAKDWFQYGSSE  856

Query  204  SITAPIKMEV  175
               A +K+E+
Sbjct  857  GSNALVKLEI  866



>ref|XP_007155048.1| hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris]
 gb|ESW27042.1| hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris]
Length=1252

 Score =   268 bits (686),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 154/190 (81%), Gaps = 6/190 (3%)
 Frame = -3

Query  738   RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
             RFKMKLVEFSF+KIYGEDA  YV+IVD+GIHELF +YV LPLPLTP Y E+A G  V T+
Sbjct  1065  RFKMKLVEFSFTKIYGEDAHVYVKIVDDGIHELFHEYVTLPLPLTPAYAEDA-GSHVKTE  1123

Query  558   DAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
              +     LS N  GLTDFD +IMETSS Q++SELDQYLEESLLPRV +FDV+GWWKLN++
Sbjct  1124  GSPGGTLLSDN--GLTDFDVYIMETSSHQTKSELDQYLEESLLPRVPDFDVLGWWKLNKI  1181

Query  387   KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
             KYPTLSKMARDIL+VPVS+ P +SVF T  KEMD+YR SLRPETVEA+VCAKDW Q    
Sbjct  1182  KYPTLSKMARDILSVPVSSVPPESVFDTKVKEMDQYRSSLRPETVEAIVCAKDWMQYGAA  1241

Query  207   KSITAPIKME  178
             ++  A +KME
Sbjct  1242  EASHALVKME  1251



>ref|XP_010047980.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047981.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047982.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047983.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 gb|KCW80053.1| hypothetical protein EUGRSUZ_C01383 [Eucalyptus grandis]
Length=658

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 151/190 (79%), Gaps = 3/190 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+K++GEDA  YV+IVDEGIHELF +YV+LPLPLTPTY EE   G    +
Sbjct  470  RFKMKLVEFSFTKVFGEDAPNYVKIVDEGIHELFLEYVSLPLPLTPTYAEEGQNGNKMEE  529

Query  558  DAQ--ELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
              Q   L T+  GLTDFD +IMETS QQ +SELDQYL+E+LLPRV EFDV+GWWKLN++K
Sbjct  530  SPQGGHLLTDH-GLTDFDMYIMETSGQQMKSELDQYLDETLLPRVQEFDVLGWWKLNKLK  588

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YPTLSKMARDIL++PVST   DSVF T  KEMD+YRCSLRP+TVEAL+C KDW Q    +
Sbjct  589  YPTLSKMARDILSIPVSTVLPDSVFDTAPKEMDKYRCSLRPDTVEALLCTKDWLQYGSSQ  648

Query  204  SITAPIKMEV  175
               A +K+E+
Sbjct  649  ISNALVKVEM  658



>ref|XP_004493926.1| PREDICTED: uncharacterized protein LOC101507795 isoform X1 [Cicer 
arietinum]
 ref|XP_004493927.1| PREDICTED: uncharacterized protein LOC101507795 isoform X2 [Cicer 
arietinum]
Length=1274

 Score =   268 bits (685),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  738   RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
             RFKMKLVEFSF+KIY EDA  YV+IVD+GIHELF +Y  LPLPLTP Y +E N G+    
Sbjct  1085  RFKMKLVEFSFTKIYSEDAHVYVKIVDDGIHELFHEYATLPLPLTPAYADEGNAGSNAKM  1144

Query  558   DAQELST--NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
             +     T  ++ GL DFD +IMETSS Q++SELDQYLEESLLPRV +FDV+GWWKLN++K
Sbjct  1145  EGSPGGTLLSDNGLADFDVYIMETSSHQTKSELDQYLEESLLPRVPDFDVLGWWKLNKLK  1204

Query  384   YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
             YPTLSKMARDIL++PV T P DS+F    KEMD+YR SLRPETVEALVCAKDW Q    +
Sbjct  1205  YPTLSKMARDILSIPVCTVPPDSIFDKKGKEMDQYRSSLRPETVEALVCAKDWMQYTAPE  1264

Query  204   SITAPIKME  178
             S+TA +KME
Sbjct  1265  SLTALVKME  1273



>ref|XP_006453082.1| hypothetical protein CICLE_v10007308mg [Citrus clementina]
 gb|ESR66322.1| hypothetical protein CICLE_v10007308mg [Citrus clementina]
Length=1064

 Score =   267 bits (682),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 154/190 (81%), Gaps = 3/190 (2%)
 Frame = -3

Query  738   RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
             RFKMKLVEFSF+KIYG+DA TY++IVD+GIHELF +YV+LPLPLTPTY EE N G     
Sbjct  876   RFKMKLVEFSFTKIYGDDAPTYIKIVDDGIHELFLEYVSLPLPLTPTY-EEGNAGNNMKS  934

Query  558   DAQELST--NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
             D  +  T  ++ GLTDFD FIMET++QQ +SELDQYL+ESLLPR H+FD++GWWKLN+MK
Sbjct  935   DESQGGTLLSDNGLTDFDMFIMETTNQQMKSELDQYLDESLLPRAHDFDLLGWWKLNKMK  994

Query  384   YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
             YPTLSKMARDIL+VPV +   DSVF TV KE+DRYR SLRPETVEAL+CAKDW Q    +
Sbjct  995   YPTLSKMARDILSVPVCSVGQDSVFDTVSKELDRYRSSLRPETVEALICAKDWFQYGSSE  1054

Query  204   SITAPIKMEV  175
                A +K+E+
Sbjct  1055  GSNALVKLEI  1064



>gb|KHN03605.1| Putative AC transposase [Glycine soja]
Length=1180

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  738   RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
             RFKMKLVEFSF+KIYGEDA  YV+IVD+GIHELF +YV LPLPLTP Y EE N G     
Sbjct  991   RFKMKLVEFSFTKIYGEDAHEYVKIVDDGIHELFHEYVTLPLPLTPAYAEEGNPGNHPKT  1050

Query  558   DAQELST--NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                   T  ++ GLTDFD +IMETS+ Q +SELDQYLEESLLPRV +FDV+GWWKLN++K
Sbjct  1051  GGSPGGTLMSDNGLTDFDVYIMETSNHQMKSELDQYLEESLLPRVPDFDVLGWWKLNKLK  1110

Query  384   YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
             YPTLSKMARDIL+VPVS+ P +SVF T  KEMD+YR SLRPETVEALVCAKDW Q    +
Sbjct  1111  YPTLSKMARDILSVPVSSLPPESVFDTKVKEMDQYRSSLRPETVEALVCAKDWMQYGAAE  1170

Query  204   SITAPIKME  178
             +  A +KME
Sbjct  1171  ASNAIVKME  1179



>ref|XP_010656463.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656464.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656465.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656466.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656467.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656468.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
Length=675

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 152/177 (86%), Gaps = 6/177 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDAS-TYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT  562
            RFKMKLVEFSF KIYG++A+ T +R+VDEG+HELF +YVALPLPLTPTY++E N G++  
Sbjct  484  RFKMKLVEFSFPKIYGDEAAPTCIRVVDEGLHELFLEYVALPLPLTPTYVDEGNAGSMKG  543

Query  561  QDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +D  +   LS+N  GL+DFD +I+ETSSQQ +SELDQYLEES+LPRVHEFD++GWWKLN+
Sbjct  544  EDHSQGGLLSSN--GLSDFDVYILETSSQQMKSELDQYLEESVLPRVHEFDLLGWWKLNK  601

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            +KYPTLSKMARDIL++PVS+   +S++ TV KEMD YR SLRPETVEAL+CAKDW Q
Sbjct  602  LKYPTLSKMARDILSIPVSSVAVESIYDTVGKEMDEYRNSLRPETVEALICAKDWLQ  658



>gb|KJB64716.1| hypothetical protein B456_010G061600 [Gossypium raimondii]
Length=678

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 147/190 (77%), Gaps = 4/190 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANG---GAV  568
            RFKMKLVEFSF+KIYGEDA TY++ VD+GIHELF +YVALPLPLTPTY EE NG   G  
Sbjct  489  RFKMKLVEFSFTKIYGEDAPTYIKTVDDGIHELFLEYVALPLPLTPTYAEEVNGANNGKT  548

Query  567  NTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
            N      L ++  GL DFD +IMET+SQQ +SELDQYLEESLLPRV EFDV+GWWKLN+M
Sbjct  549  NESHQGNLLSDH-GLADFDVYIMETNSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKM  607

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            KYPTLSKMARDIL++PVS A  +S+F    K++D YR SLRPETVEAL+CAKDW      
Sbjct  608  KYPTLSKMARDILSIPVSAAATESIFDITDKQLDEYRSSLRPETVEALICAKDWLHYGSS  667

Query  207  KSITAPIKME  178
                A ++ME
Sbjct  668  DVSNALVRME  677



>emb|CBI28241.3| unnamed protein product [Vitis vinifera]
Length=839

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 152/177 (86%), Gaps = 6/177 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDAS-TYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT  562
            RFKMKLVEFSF KIYG++A+ T +R+VDEG+HELF +YVALPLPLTPTY++E N G++  
Sbjct  563  RFKMKLVEFSFPKIYGDEAAPTCIRVVDEGLHELFLEYVALPLPLTPTYVDEGNAGSMKG  622

Query  561  QDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +D  +   LS+N  GL+DFD +I+ETSSQQ +SELDQYLEES+LPRVHEFD++GWWKLN+
Sbjct  623  EDHSQGGLLSSN--GLSDFDVYILETSSQQMKSELDQYLEESVLPRVHEFDLLGWWKLNK  680

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            +KYPTLSKMARDIL++PVS+   +S++ TV KEMD YR SLRPETVEAL+CAKDW Q
Sbjct  681  LKYPTLSKMARDILSIPVSSVAVESIYDTVGKEMDEYRNSLRPETVEALICAKDWLQ  737



>gb|EPS67926.1| hypothetical protein M569_06846, partial [Genlisea aurea]
Length=696

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 151/204 (74%), Gaps = 17/204 (8%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT-  562
            RFKMKLVEFSFSKIYG++A++YV++VD+GIHELFQ+YV LPLPLTP Y EE NG  + T 
Sbjct  493  RFKMKLVEFSFSKIYGDEAASYVKVVDDGIHELFQEYVTLPLPLTPAYAEEQNGAPIKTT  552

Query  561  ------------QDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFD  418
                        + +   + N  GL DFDA+I+ET+SQ  +SELD+YLEESLLPRV +FD
Sbjct  553  AAVAAEAEPEGSKSSSNSNNNASGLMDFDAYIIETTSQLEKSELDRYLEESLLPRVQDFD  612

Query  417  VVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVC  238
            VVGWWK+NRM YPTLSKMARDIL+ PV T   DSVF T  KEMD YRCSLRPETVEALVC
Sbjct  613  VVGWWKINRMNYPTLSKMARDILSSPVCTVCPDSVFDTTGKEMDGYRCSLRPETVEALVC  672

Query  237  AKDWQQNELVKSITA----PIKME  178
            AKDW   E   S +A     +KME
Sbjct  673  AKDWLTAEKRDSASATASPTVKME  696



>gb|EYU34976.1| hypothetical protein MIMGU_mgv1a002172mg [Erythranthe guttata]
Length=705

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 157/193 (81%), Gaps = 4/193 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGED-ASTYVRIVDEGIHELFQDYVALPLPLT--PTYIEEANGGAV  568
            RFKMKLV+F+F KIYGE+ A+++++IVDEGIHELF +Y++ P+  T   +Y E+ NG +V
Sbjct  514  RFKMKLVQFTFVKIYGEERAASFIKIVDEGIHELFHEYLSFPMHSTHDSSYGEDENGQSV  573

Query  567  NTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
              +D++ + +N  GL+DFDA+IMET+SQ S++ELDQYLEESLLPRVH+FDVVGWWKLNR+
Sbjct  574  KIEDSEGMDSNG-GLSDFDAYIMETTSQLSKTELDQYLEESLLPRVHDFDVVGWWKLNRI  632

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            KYPTLSKMARD+L+VPV T P + VF TV +EMD YR SLR ETVEAL+CAKDW Q E +
Sbjct  633  KYPTLSKMARDVLSVPVCTVPGNMVFDTVRREMDSYRSSLRSETVEALICAKDWLQPEKL  692

Query  207  KSITAPIKMEVPI  169
            +     IKME+PI
Sbjct  693  EGPAPVIKMEIPI  705



>ref|XP_007138404.1| hypothetical protein PHAVU_009G205900g [Phaseolus vulgaris]
 gb|ESW10398.1| hypothetical protein PHAVU_009G205900g [Phaseolus vulgaris]
Length=856

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 6/190 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVN--  565
            RFKMKLVEFSF+KIYG+DA  Y++ V++GIHE+F +YVALPLPLTP Y E+   G  +  
Sbjct  667  RFKMKLVEFSFTKIYGDDAHLYIKTVEDGIHEMFHEYVALPLPLTPAYTEDGCSGNRSKM  726

Query  564  --TQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
              +Q    LS N  GLTDFDA+IMETSSQQ +SELDQYLEESLLPRV +FDV+GWWKLN+
Sbjct  727  EESQGDAMLSDN--GLTDFDAYIMETSSQQMKSELDQYLEESLLPRVPDFDVLGWWKLNK  784

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            +KYPTLSKMARDIL+VPVST   DSVF +  KEMD+YR SLRPETVEA+VC+KDW Q   
Sbjct  785  LKYPTLSKMARDILSVPVSTVAPDSVFYSKTKEMDQYRSSLRPETVEAIVCSKDWMQYGT  844

Query  210  VKSITAPIKM  181
             ++  A +KM
Sbjct  845  AEASNALVKM  854



>gb|KGN65126.1| hypothetical protein Csa_1G229510 [Cucumis sativus]
Length=751

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNT  562
            RFKMKLVEFSF+K+YGE+A  Y+++VD+GIHELF +YVALPLPLTPTY E+ +  G +  
Sbjct  552  RFKMKLVEFSFTKVYGEEAPAYIKVVDDGIHELFDEYVALPLPLTPTYAEDGSVDGNMKG  611

Query  561  QDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +D+Q    ++ G TDFD +IMET+SQQ +SELD+YLE+SLLPRV +FD++GWWKLN+ KY
Sbjct  612  EDSQGNLLSDNGFTDFDVYIMETTSQQMKSELDRYLEDSLLPRVQDFDLLGWWKLNKFKY  671

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            PTLSKMARDIL++PVST P DSVF T  K+MD+YR SLRPETVEA++C+KDW Q  L
Sbjct  672  PTLSKMARDILSIPVSTLPPDSVFITRRKKMDQYRSSLRPETVEAMICSKDWMQCGL  728



>ref|XP_008242815.1| PREDICTED: putative AC transposase isoform X2 [Prunus mume]
Length=724

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 156/178 (88%), Gaps = 6/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA-VNT  562
            RFKMKLVEFSF+KIYGE+A T+++IVD+GIHELF +Y+ LPLPLTPTY ++  GGA V T
Sbjct  534  RFKMKLVEFSFNKIYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPTYADDGTGGANVKT  593

Query  561  QDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +D+Q    L+ N  GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVHEFDV+GWWKLN+
Sbjct  594  EDSQGGTLLTDN--GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHEFDVLGWWKLNK  651

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            MKYPTLSKMARDIL++PVST P++SVF TV KEMD+YR SLRPETVEAL+CAKDW Q+
Sbjct  652  MKYPTLSKMARDILSIPVSTVPSESVFDTVAKEMDQYRSSLRPETVEALICAKDWMQH  709



>ref|XP_008242814.1| PREDICTED: putative AC transposase isoform X1 [Prunus mume]
Length=733

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 156/178 (88%), Gaps = 6/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA-VNT  562
            RFKMKLVEFSF+KIYGE+A T+++IVD+GIHELF +Y+ LPLPLTPTY ++  GGA V T
Sbjct  543  RFKMKLVEFSFNKIYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPTYADDGTGGANVKT  602

Query  561  QDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +D+Q    L+ N  GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVHEFDV+GWWKLN+
Sbjct  603  EDSQGGTLLTDN--GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHEFDVLGWWKLNK  660

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            MKYPTLSKMARDIL++PVST P++SVF TV KEMD+YR SLRPETVEAL+CAKDW Q+
Sbjct  661  MKYPTLSKMARDILSIPVSTVPSESVFDTVAKEMDQYRSSLRPETVEALICAKDWMQH  718



>ref|XP_007203781.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
 gb|EMJ04980.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
Length=724

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 156/178 (88%), Gaps = 6/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA-VNT  562
            RFKMKLVEFSF+KIYGE+A T+++IVD+GIHELF +Y+ LPLPLTPTY ++  GGA V T
Sbjct  534  RFKMKLVEFSFNKIYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPTYADDGTGGANVKT  593

Query  561  QDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +D+Q    L+ N  GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVHEFDV+GWWKLN+
Sbjct  594  EDSQGGTLLTDN--GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHEFDVLGWWKLNK  651

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            MKYPTLSKMARDIL++PVST P++SVF T+ KEMD+YR SLRPETVEAL+CAKDW Q+
Sbjct  652  MKYPTLSKMARDILSIPVSTVPSESVFDTIAKEMDQYRSSLRPETVEALICAKDWMQH  709



>ref|XP_007203782.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
 gb|EMJ04981.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
Length=733

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 156/178 (88%), Gaps = 6/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA-VNT  562
            RFKMKLVEFSF+KIYGE+A T+++IVD+GIHELF +Y+ LPLPLTPTY ++  GGA V T
Sbjct  543  RFKMKLVEFSFNKIYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPTYADDGTGGANVKT  602

Query  561  QDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +D+Q    L+ N  GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVHEFDV+GWWKLN+
Sbjct  603  EDSQGGTLLTDN--GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHEFDVLGWWKLNK  660

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            MKYPTLSKMARDIL++PVST P++SVF T+ KEMD+YR SLRPETVEAL+CAKDW Q+
Sbjct  661  MKYPTLSKMARDILSIPVSTVPSESVFDTIAKEMDQYRSSLRPETVEALICAKDWMQH  718



>ref|XP_011017829.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=666

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLV+F FSKI+G++A  YV+IVD+G+HELF +YVALPLPLTPTY E+ N   + T+
Sbjct  476  RFKMKLVQFRFSKIFGDEAPLYVKIVDDGLHELFLEYVALPLPLTPTYAEDGNFENMKTE  535

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
            D Q    ++ GLTDFD +IMET+SQ +RSELDQYLEESLLPR+ E DV+ WWK+N++KYP
Sbjct  536  DNQGTLLSDHGLTDFDMYIMETTSQNTRSELDQYLEESLLPRLQELDVLEWWKMNKLKYP  595

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            TLSK+ARDILT+ VSTA  DSVF T  KE+D YR SLRPETVEALVCAKDW Q
Sbjct  596  TLSKLARDILTIQVSTADPDSVFDTEIKELDSYRSSLRPETVEALVCAKDWLQ  648



>ref|XP_002325202.1| hypothetical protein POPTR_0018s12690g [Populus trichocarpa]
 gb|EEF03767.1| hypothetical protein POPTR_0018s12690g [Populus trichocarpa]
Length=666

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLV+F FSKI+G++A  YV+IVD+G+HELF +YVALPLPLTPTY E+ N   + T+
Sbjct  476  RFKMKLVQFRFSKIFGDEAPLYVKIVDDGLHELFLEYVALPLPLTPTYAEDGNFENMKTE  535

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
            D Q    ++ GLTDFD +IMET+SQ +RSELDQYLEESLLPR+ E D++ WWK+N++KYP
Sbjct  536  DNQGTLLSDHGLTDFDMYIMETTSQNTRSELDQYLEESLLPRLQELDLLDWWKMNKLKYP  595

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            TLSK+ARDILT+ VSTA  DSVF T  KE+D YR SLRPETVEALVCAKDW Q
Sbjct  596  TLSKLARDILTIQVSTADPDSVFDTEIKELDSYRSSLRPETVEALVCAKDWLQ  648



>ref|XP_008457064.1| PREDICTED: putative AC transposase [Cucumis melo]
 ref|XP_008457073.1| PREDICTED: putative AC transposase [Cucumis melo]
Length=677

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 147/192 (77%), Gaps = 6/192 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNT  562
            RFKMKLVEFSF+K+YGE+A  Y++IVD+GIHELF +Y+ LPLPLTPTY +E N GG + +
Sbjct  488  RFKMKLVEFSFNKLYGEEAPAYIKIVDDGIHELFHEYITLPLPLTPTYADEGNAGGNIKS  547

Query  561  QDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +  Q    LS N  GLTDFD +IMETSSQQ +SELDQYL ESLLPRV +FD++GWWK N+
Sbjct  548  EGPQSGSLLSDN--GLTDFDVYIMETSSQQMKSELDQYLAESLLPRVQDFDLLGWWKQNK  605

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            MKYPTLS MARDIL++PV T P +S+F    KEMD YR SLRP TVEA++C +DW Q   
Sbjct  606  MKYPTLSTMARDILSIPVCTLPPESIFDMEIKEMDPYRSSLRPATVEAIICTRDWIQCGF  665

Query  210  VKSITAPIKMEV  175
             +   + +KME 
Sbjct  666  AEVSDSLVKMEC  677



>gb|KGN60709.1| hypothetical protein Csa_2G008020 [Cucumis sativus]
Length=677

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 144/192 (75%), Gaps = 6/192 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV---  568
            RFKMKLVEFSF+K+YGE+A  Y++IVD+GIHELF +YV LPLPLTPTY +E N G+    
Sbjct  488  RFKMKLVEFSFNKLYGEEAPAYIKIVDDGIHELFHEYVTLPLPLTPTYADEGNAGSNIKS  547

Query  567  -NTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
               Q    LS N  GLTDFD +IMETSSQQ +SELDQYL ESLLPRV +FD++GWWK N+
Sbjct  548  EGPQSGSLLSDN--GLTDFDVYIMETSSQQMKSELDQYLAESLLPRVQDFDLLGWWKQNK  605

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            MKYPTLS MARDIL++PV T P +S+F    KEMD YR SLRP TVEA++C +DW Q   
Sbjct  606  MKYPTLSTMARDILSIPVCTLPPESIFDMEIKEMDPYRSSLRPATVEAIICTRDWIQCGF  665

Query  210  VKSITAPIKMEV  175
             +   + +KME 
Sbjct  666  AEVSDSLVKMEC  677



>ref|XP_009363984.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X2 [Pyrus x bretschneideri]
Length=852

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 159/190 (84%), Gaps = 6/190 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+K+YGE+A T++++VD+GIHELF +Y+ LPLPLTPTY +E N   + T+
Sbjct  665  RFKMKLVEFSFNKVYGEEAPTHIKVVDDGIHELFHEYLTLPLPLTPTYADEGNN-YIKTE  723

Query  558  DAQ---ELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
            D+Q    L+ N  GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVH+FDV+GWWKLN+M
Sbjct  724  DSQGGANLTDN--GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHDFDVLGWWKLNKM  781

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            KYPTLSKMARDIL++PVST P+DSVF T  KEMD+YR SLRPETVEAL+CAKDW Q    
Sbjct  782  KYPTLSKMARDILSIPVSTVPSDSVFDTTVKEMDQYRTSLRPETVEALICAKDWLQYGSA  841

Query  207  KSITAPIKME  178
             + TA ++ME
Sbjct  842  DASTALVRME  851



>ref|XP_009363983.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X1 [Pyrus x bretschneideri]
Length=864

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 159/190 (84%), Gaps = 6/190 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+K+YGE+A T++++VD+GIHELF +Y+ LPLPLTPTY +E N   + T+
Sbjct  677  RFKMKLVEFSFNKVYGEEAPTHIKVVDDGIHELFHEYLTLPLPLTPTYADEGNN-YIKTE  735

Query  558  DAQ---ELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
            D+Q    L+ N  GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVH+FDV+GWWKLN+M
Sbjct  736  DSQGGANLTDN--GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHDFDVLGWWKLNKM  793

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            KYPTLSKMARDIL++PVST P+DSVF T  KEMD+YR SLRPETVEAL+CAKDW Q    
Sbjct  794  KYPTLSKMARDILSIPVSTVPSDSVFDTTVKEMDQYRTSLRPETVEALICAKDWLQYGSA  853

Query  207  KSITAPIKME  178
             + TA ++ME
Sbjct  854  DASTALVRME  863



>ref|XP_010687925.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1053

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 154/190 (81%), Gaps = 4/190 (2%)
 Frame = -3

Query  738   RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
             RFKMKLVEFSF+KI+ ++A  ++R+VD+GIHELF +Y+  PLPLTP  + + NGG V  +
Sbjct  866   RFKMKLVEFSFTKIFMDEAPHFIRVVDDGIHELFHEYMNHPLPLTP--VRDGNGGYVKGE  923

Query  558   DAQELST-NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             D++  +  N  GL+DFD +IMETSSQQ +SELDQYLEESLLPR+ +FDV+GWWKLN++KY
Sbjct  924   DSEGGNLLNSNGLSDFDMYIMETSSQQMKSELDQYLEESLLPRIQDFDVLGWWKLNKLKY  983

Query  381   PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
             PTLSKMARDIL++P+ST  A+SVF T  KEMD YRCSLRPET+EAL+CAKDW Q +  K+
Sbjct  984   PTLSKMARDILSMPLSTVSAESVFDTSFKEMDSYRCSLRPETLEALICAKDWLQPDSTKA  1043

Query  201   ITAP-IKMEV  175
              +   +KME+
Sbjct  1044  SSKELVKMEL  1053



>ref|XP_010687924.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1065

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 154/190 (81%), Gaps = 4/190 (2%)
 Frame = -3

Query  738   RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
             RFKMKLVEFSF+KI+ ++A  ++R+VD+GIHELF +Y+  PLPLTP  + + NGG V  +
Sbjct  878   RFKMKLVEFSFTKIFMDEAPHFIRVVDDGIHELFHEYMNHPLPLTP--VRDGNGGYVKGE  935

Query  558   DAQELST-NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             D++  +  N  GL+DFD +IMETSSQQ +SELDQYLEESLLPR+ +FDV+GWWKLN++KY
Sbjct  936   DSEGGNLLNSNGLSDFDMYIMETSSQQMKSELDQYLEESLLPRIQDFDVLGWWKLNKLKY  995

Query  381   PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
             PTLSKMARDIL++P+ST  A+SVF T  KEMD YRCSLRPET+EAL+CAKDW Q +  K+
Sbjct  996   PTLSKMARDILSMPLSTVSAESVFDTSFKEMDSYRCSLRPETLEALICAKDWLQPDSTKA  1055

Query  201   ITAP-IKMEV  175
              +   +KME+
Sbjct  1056  SSKELVKMEL  1065



>ref|XP_010250193.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nelumbo nucifera]
Length=667

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 150/199 (75%), Gaps = 23/199 (12%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE------EANG  577
            RFKMKLVEFSFSKIYG+DA  Y+R+VDEGIHELF +Y+A PLPLTPTY+E      E+ G
Sbjct  479  RFKMKLVEFSFSKIYGDDAGEYIRVVDEGIHELFLEYMAQPLPLTPTYVERETPKTESPG  538

Query  576  GAVNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
            G +       LS+ + GL DFD FI E +SSQ S+SELDQYLEESLLPR+ EFD++ WWK
Sbjct  539  GIL-------LSSGD-GLLDFDVFISEMSSSQNSKSELDQYLEESLLPRIQEFDILSWWK  590

Query  399  LNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            LN +KYPTLS+MARDIL +PVS A ADSVF T  K +D YR SLRPET+EAL+CAKDW  
Sbjct  591  LNNLKYPTLSRMARDILAIPVSPASADSVFDTEIKRLDSYRSSLRPETIEALICAKDWLP  650

Query  219  N-----ELVKSITAPIKME  178
            +     EL K+I   +KME
Sbjct  651  HGTPSAELSKAI---VKME  666



>ref|XP_010241568.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241570.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241571.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241572.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241573.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
Length=675

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 139/175 (79%), Gaps = 5/175 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKIYG+DA  YV+IVDEGIH+LF +YV+ PLPLTPTY+E        T+
Sbjct  484  RFKMKLVEFSFSKIYGDDAGEYVKIVDEGIHDLFLEYVSQPLPLTPTYVERETPLTPKTE  543

Query  558  ---DAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
                   LS  + GL DFD +I E +SSQQ++SELDQYLEESLLPR+ EFD++GWWKLN 
Sbjct  544  VSPGGTLLSAGD-GLLDFDVYISEISSSQQTKSELDQYLEESLLPRIQEFDILGWWKLNN  602

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            +KYPTLS+MARDIL + VS A ADSVF+T  K++D YR SLRPET+EAL+CAKDW
Sbjct  603  LKYPTLSRMARDILVITVSPATADSVFNTELKKLDPYRSSLRPETIEALICAKDW  657



>ref|XP_010535860.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
Length=641

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 134/179 (75%), Gaps = 12/179 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +YVALPLPLTP Y   A GG+    
Sbjct  473  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFNEYVALPLPLTPAY---AEGGSNPKP  529

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
            D          L DFD +IMET+ Q  +SELDQYL+E+L+PRV EFDV+ WWK N++KYP
Sbjct  530  DR---------LLDFDMYIMETTGQNLKSELDQYLDETLMPRVQEFDVLDWWKQNKLKYP  580

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            TLSKMARDIL++PVS A   +VF    +EMD Y+ SLRPETVEAL+CAKDW Q+  VK+
Sbjct  581  TLSKMARDILSIPVSAAAFGNVFEGEPREMDEYKTSLRPETVEALICAKDWLQSSDVKT  639



>ref|XP_010541714.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Tarenaya hassleriana]
Length=648

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 132/182 (73%), Gaps = 11/182 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALPLPLTPTY E   G      
Sbjct  473  RFKMKLVEFSFSKIFGEDAPKNIKTVDDGIHELFNEYIALPLPLTPTYAEGGGGDPKPDG  532

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                       L DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  533  -----------LIDFDMYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  581

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  199
            TLSKMARDIL++PVS A    VF    +EMD Y+ SLRPETVEAL+CAK+W Q+E   + 
Sbjct  582  TLSKMARDILSIPVSAAALGYVFDMEPREMDDYKTSLRPETVEALICAKEWIQSEAFAAQ  641

Query  198  TA  193
            +A
Sbjct  642  SA  643



>ref|XP_010541713.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Tarenaya hassleriana]
Length=665

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 132/182 (73%), Gaps = 11/182 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALPLPLTPTY E   G      
Sbjct  490  RFKMKLVEFSFSKIFGEDAPKNIKTVDDGIHELFNEYIALPLPLTPTYAEGGGGDPKPDG  549

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                       L DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  550  -----------LIDFDMYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  598

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  199
            TLSKMARDIL++PVS A    VF    +EMD Y+ SLRPETVEAL+CAK+W Q+E   + 
Sbjct  599  TLSKMARDILSIPVSAAALGYVFDMEPREMDDYKTSLRPETVEALICAKEWIQSEAFAAQ  658

Query  198  TA  193
            +A
Sbjct  659  SA  660



>ref|XP_011014817.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=813

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 143/188 (76%), Gaps = 7/188 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RF+MKL+EFSF K YG++AS Y++IV++ +HELF +Y ALPLPLTP + E+ N   + T+
Sbjct  628  RFRMKLIEFSFVKFYGKEASKYIKIVNDALHELFLEYAALPLPLTPAHAEDGNFENMKTE  687

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
               E+S NEL  TDFDA++ ET+SQ  +SEL+QYLEESLLPR  E DV+ WW+ NR++YP
Sbjct  688  ---EISYNEL--TDFDAYV-ETTSQNMKSELEQYLEESLLPRFQEMDVLKWWEENRLQYP  741

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  199
             LSKMARDILT+ VSTA  DSVF T  KE+D YR SLRPETVEALVCAKDW Q      +
Sbjct  742  VLSKMARDILTMQVSTADPDSVFDTEIKELDEYRSSLRPETVEALVCAKDWLQYRFATEV  801

Query  198  T-APIKME  178
            + A +K+E
Sbjct  802  SNALVKVE  809



>ref|XP_010496529.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=655

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 129/171 (75%), Gaps = 16/171 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG V+  
Sbjct  479  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFSEYMALPAPLKPT----SQGGKVD--  532

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  533  ----------GLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  582

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  583  TLSKMARDILSIPVSAAAFDYVFDMEPREMDEYKMSLRPETVEALICAREW  633



>ref|XP_010514702.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=655

 Score =   219 bits (557),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 129/171 (75%), Gaps = 16/171 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG V+  
Sbjct  479  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFSEYMALPAPLKPT----SEGGKVD--  532

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  533  ----------GLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  582

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  583  TLSKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  633



>ref|NP_001241846.1| uncharacterized protein LOC100857052 [Zea mays]
 gb|ACR37953.1| unknown [Zea mays]
Length=313

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 133/181 (73%), Gaps = 9/181 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVN  565
            RFKMKLVEFS+SKIYG  A+ YV++VD+ +HEL+++YVA PLPLTP Y++  E N G  N
Sbjct  115  RFKMKLVEFSYSKIYGAGAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVDQGEGNNGPAN  174

Query  564  TQDAQ--ELSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
               +Q    ST + GL DFD ++ E  SSQ S+SEL+QYL+ESL PR+ EFD++ WWKLN
Sbjct  175  ANSSQGAPASTGD-GLLDFDMYLSEIQSSQPSKSELEQYLDESLTPRIQEFDILNWWKLN  233

Query  393  RMKYPTLSKMARDILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQ  223
             +K+PTLSKMARDIL +PVS  +   S+F   T    +D YR SLRPE VEALVCAKDW 
Sbjct  234  TVKFPTLSKMARDILAIPVSMVSSGSSIFCAGTGSHMLDDYRSSLRPEIVEALVCAKDWL  293

Query  222  Q  220
            Q
Sbjct  294  Q  294



>gb|ABA18109.1| hAT-like transposase [Arabidopsis arenosa]
Length=654

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 128/171 (75%), Gaps = 16/171 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG  +  
Sbjct  478  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFSEYMALPSPLKPT----SEGGKAD--  531

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  532  ----------GLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  581

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  582  TLSKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  632



>ref|XP_002875576.1| hypothetical protein ARALYDRAFT_323059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51835.1| hypothetical protein ARALYDRAFT_323059 [Arabidopsis lyrata subsp. 
lyrata]
Length=654

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 128/171 (75%), Gaps = 16/171 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG  +  
Sbjct  478  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFSEYMALPSPLKPT----SEGGKAD--  531

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  532  ----------GLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  581

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  582  TLSKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  632



>ref|XP_006279357.1| hypothetical protein CARUB_v10008021mg [Capsella rubella]
 gb|ABA18106.1| hAT-like transposase [Capsella rubella]
 gb|EOA12255.1| hypothetical protein CARUB_v10008021mg [Capsella rubella]
Length=665

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 128/171 (75%), Gaps = 19/171 (11%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA+  ++ VD+GIHELF +Y+ALP PL PT   EA+G      
Sbjct  493  RFKMKLVEFSFSKIFGEDATKNIKTVDDGIHELFSEYMALPAPLKPT--SEADG------  544

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                       L+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  545  -----------LSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  593

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CAK+W
Sbjct  594  TLSKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAKEW  644



>ref|XP_006385302.1| hypothetical protein POPTR_0003s02610g [Populus trichocarpa]
 gb|ERP63099.1| hypothetical protein POPTR_0003s02610g [Populus trichocarpa]
Length=668

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 132/175 (75%), Gaps = 2/175 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHEL   Y+     L  T +EE     ++TQ
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELLVGYLTPNFHLPATDVEEGLPQELHTQ  544

Query  558  DAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            D   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDV+GWWKLNR+KY
Sbjct  545  DLPMLSIGD-GLSDFDIYISEITSGQHFKSELDQYLEESLLPRVHEFDVLGWWKLNRLKY  603

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            PTLSKMA DIL++PVST   DSVF T +K +D YR SLRP T+EAL+CAKDW Q+
Sbjct  604  PTLSKMAVDILSIPVSTVTPDSVFDTENKRIDSYRSSLRPVTLEALICAKDWLQH  658



>ref|XP_006384324.1| hypothetical protein POPTR_0004s12760g [Populus trichocarpa]
 gb|ERP62121.1| hypothetical protein POPTR_0004s12760g [Populus trichocarpa]
Length=842

 Score =   218 bits (555),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 134/173 (77%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RF+MKL+EFSF K YG++AS Y++IVD+ +HELF +Y ALP PLTP + E+ N   + T+
Sbjct  657  RFRMKLIEFSFVKFYGKEASKYIKIVDDALHELFLEYAALPFPLTPAHAEDGNFENMKTE  716

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
               E+S NEL  TDFDA++ ET+SQ  +SEL+QYLEESLLPR  E DV+ WW+ N+++YP
Sbjct  717  ---EISYNEL--TDFDAYV-ETTSQNKKSELEQYLEESLLPRFQEMDVLKWWEENKLQYP  770

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
             LS MARDILT+ VSTA  DSVF T  KE+D YR SLRPETVEALVCAKDW Q
Sbjct  771  VLSTMARDILTMQVSTADPDSVFDTEIKELDEYRSSLRPETVEALVCAKDWLQ  823



>ref|XP_010425789.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Camelina sativa]
Length=654

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 128/171 (75%), Gaps = 16/171 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG V+  
Sbjct  478  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFSEYMALPAPLKPT----SEGGKVD--  531

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  532  ----------GLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  581

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++ VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  582  TLSKMARDILSISVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  632



>ref|XP_006419173.1| hypothetical protein EUTSA_v10002435mg [Eutrema salsugineum]
 gb|ESQ37609.1| hypothetical protein EUTSA_v10002435mg [Eutrema salsugineum]
Length=657

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 128/171 (75%), Gaps = 16/171 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ LP PL PT    + GG  +  
Sbjct  480  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFSEYMTLPSPLKPT----SEGGKTD--  533

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  534  ----------GLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  583

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++PVS A  D+VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  584  TLSKMARDILSIPVSAAAFDNVFDMEPREMDEYKTSLRPETVEALICAREW  634



>gb|AAS16893.2| putative hAT family dimerisation domain containing protein [Oryza 
sativa Japonica Group]
Length=313

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%), Gaps = 13/183 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+  G   N  
Sbjct  115  RFKMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGEG---NNA  171

Query  558  DAQELSTNEL------GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
             A E ST         GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWK
Sbjct  172  PASENSTQTTAPSTGDGLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWK  231

Query  399  LNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKD  229
            LN +K+PTLSKMARDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEAL CAKD
Sbjct  232  LNTLKFPTLSKMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALFCAKD  291

Query  228  WQQ  220
            W Q
Sbjct  292  WLQ  294



>ref|XP_006384329.1| hypothetical protein POPTR_0004s12810g [Populus trichocarpa]
 gb|ERP62126.1| hypothetical protein POPTR_0004s12810g [Populus trichocarpa]
Length=842

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 134/173 (77%), Gaps = 6/173 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RF+MKL+EFSF K YG++A  Y++IVD+ +HELF +Y ALPLPLTP + E+ N   + T+
Sbjct  657  RFRMKLIEFSFVKFYGKEAGKYIKIVDDALHELFLEYAALPLPLTPAHAEDGNFENMKTE  716

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
               E+S NEL  TDFDA++ ET+SQ  +SEL+QYLEESLLPR  E DV+ WW+ N+++YP
Sbjct  717  ---EISYNEL--TDFDAYV-ETTSQNMKSELEQYLEESLLPRFQEMDVLKWWEENKLQYP  770

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
             LSKMARDILT+ VSTA  DS+F T  KE+D YR SLRPE VEALVCAKDW Q
Sbjct  771  VLSKMARDILTMQVSTADPDSIFDTEIKELDEYRSSLRPEAVEALVCAKDWLQ  823



>emb|CBI36351.3| unnamed protein product [Vitis vinifera]
Length=295

 Score =   205 bits (521),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 140/209 (67%), Gaps = 24/209 (11%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEEANGGAVN  565
            RFKMKLVEFSFSKIYG +A  +++IVDEGI ELF DYV  P  L + P Y+EE  G  V 
Sbjct  88   RFKMKLVEFSFSKIYGAEAEMWIKIVDEGIRELFVDYVTQPPLLSIQPAYVEE--GTEVI  145

Query  564  TQ----------------DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLP  436
            +Q                D   L ++   L+DFD +I E S  Q  RSELDQYL+ESL+P
Sbjct  146  SQTYMEEGTEVIPKTEMTDGGPLLSDSDRLSDFDVYISEISGGQDMRSELDQYLDESLMP  205

Query  435  RVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPET  256
            R  +FDV+ WWKLN++KYPTLS+MA DIL++P++T   D+VF TV +++D YR SLRP T
Sbjct  206  RSQDFDVLAWWKLNKLKYPTLSRMASDILSIPITTVGPDNVFDTVGRKIDSYRSSLRPLT  265

Query  255  VEALVCAKDWQQNELVK---SITAPIKME  178
            +EAL+CAKDW QN   +   S+   +KME
Sbjct  266  LEALICAKDWLQNGATEPDMSVPPIVKME  294



>ref|XP_002325201.2| hypothetical protein POPTR_0018s12680g [Populus trichocarpa]
 gb|EEF03766.2| hypothetical protein POPTR_0018s12680g [Populus trichocarpa]
Length=716

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF + YGE+A  YVRI+D G+H+LF +YV LPLPLT  Y E+ N    N  
Sbjct  528  RFKMKLIEFSFLRFYGEEAGKYVRIIDGGLHKLFLEYVRLPLPLTSAYAEDGN--FENNT  585

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
              +E+S N  GLTD D ++ ET+SQ ++SEL+QYLEESLLPR  E DV+ WW+ N++KYP
Sbjct  586  KTEEISDN--GLTDCDVYV-ETTSQNTKSELEQYLEESLLPRHQEMDVLKWWEENKLKYP  642

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDILT+ VSTA  D+VF T  KE+D Y  SLRPETVEALVCAKDW
Sbjct  643  TLSKMARDILTMQVSTAEPDTVFDTEIKELDSYWSSLRPETVEALVCAKDW  693



>ref|XP_010236763.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
Length=262

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 136/183 (74%), Gaps = 11/183 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVN  565
            RFKMKLVEFS+SKIYG +A+ YV++VD+ IHEL+++YVA PLPLTP Y+E  EAN     
Sbjct  64   RFKMKLVEFSYSKIYGMEAAKYVKVVDDAIHELYKEYVAQPLPLTPAYVEQGEANKNVHA  123

Query  564  TQDAQEL---STNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKL  397
            +Q+   +   ST + GL DFD ++ E + SQ S+SEL+QYLEE+L PR+ +F++V WWKL
Sbjct  124  SQNNNTVTPPSTGD-GLLDFDIYLSEIAVSQPSKSELEQYLEEALTPRIQDFEIVDWWKL  182

Query  396  NRMKYPTLSKMARDILTVPVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKD  229
            N +K+PTLSKMARDIL +P+S  +   S+FS   T  + +D YR SLRPETVEAL C KD
Sbjct  183  NTLKFPTLSKMARDILAIPMSMVSRGSSIFSAATTGSRMLDDYRSSLRPETVEALFCTKD  242

Query  228  WQQ  220
            W Q
Sbjct  243  WLQ  245



>ref|XP_011081954.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Sesamum indicum]
Length=651

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 134/177 (76%), Gaps = 3/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKM+LVEFSFS+IYGED  T++ IVDEG+HEL+ +Y+   LP  PT+IE  N   V T+
Sbjct  455  RFKMRLVEFSFSRIYGEDVETWINIVDEGLHELYLEYLVQSLP-APTFIEGENDTLVKTE  513

Query  558  DAQE-LSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
              +E L +N  G +DFD +I +  S+Q  +SELDQYLEE LLPRV +FDV+GWWK+NR K
Sbjct  514  PQEEGLLSNTDGFSDFDIYISDIMSAQHMKSELDQYLEEPLLPRVQDFDVLGWWKMNRSK  573

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YPTLSK+A D+L++P+ST  A+SVF    K++D YR SLRP  ++ALVC+KDW Q+E
Sbjct  574  YPTLSKLASDVLSIPLSTISAESVFDMREKKIDSYRSSLRPSILQALVCSKDWLQHE  630



>emb|CDO98171.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 137/178 (77%), Gaps = 4/178 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFS+IY  +A T++++VDEG+HEL+ DYV   LP  PT+++EA+   +  +
Sbjct  481  RFKMKLVEFSFSRIYENEAETWIKLVDEGLHELYLDYVLESLP-PPTFLDEASESIIKAE  539

Query  558  DAQE--LSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
             +Q+  L ++  GL+DFD +I E  SS Q +SELDQYLEESLLPRV +FD +GWWKLNR+
Sbjct  540  ISQDDCLLSSADGLSDFDIYISEIMSSNQMKSELDQYLEESLLPRVQDFDALGWWKLNRL  599

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            KYPTLS+MA D+L++PVST   DSVF T  ++MD +R +L P T+EALVC+KDW + E
Sbjct  600  KYPTLSRMASDVLSIPVSTVAPDSVFDTAERKMDSFRSTLSPTTLEALVCSKDWLKYE  657



>dbj|BAK01733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=727

 Score =   212 bits (539),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 144/197 (73%), Gaps = 19/197 (10%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEE-------AN  580
            RFKMKLVEFS+SKIYG +A+ YV++V++ +H+LF+DYVA PLPLTP Y+E+       AN
Sbjct  531  RFKMKLVEFSYSKIYGVEAAKYVKVVNDSVHDLFKDYVAQPLPLTPAYVEQGKTDNVTAN  590

Query  579  GGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ-SRSELDQYLEESLLPRVHEFDVVGWW  403
            G   NTQ A + ST + GL DFD ++ E ++ Q S+SEL+QYL+ESL PR+ EFD++ WW
Sbjct  591  GN--NTQ-ATQPSTGD-GLQDFDIYLSEIATTQPSKSELEQYLDESLTPRIQEFDILNWW  646

Query  402  KLNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAK  232
            KLN +KYPTLSKMARDIL++PVS      S+FS  T    +D YR SLRPE VEALVCAK
Sbjct  647  KLNTLKYPTLSKMARDILSIPVSMVTGGSSIFSAGTGGHMLDDYRSSLRPEIVEALVCAK  706

Query  231  DWQQNELVKSITAPIKM  181
            DW    L  S TAP+ +
Sbjct  707  DW----LPYSTTAPVAL  719



>ref|XP_008776870.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776871.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776872.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776873.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=679

 Score =   211 bits (538),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 135/183 (74%), Gaps = 11/183 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVN  565
            RFKMKLVEFSFSKIYG DA+ YV++VD+ IHEL+ +YVA PLPLTP Y E  EA    +N
Sbjct  480  RFKMKLVEFSFSKIYGADAARYVKVVDDSIHELYLEYVAQPLPLTPAYEEQGEATTNNIN  539

Query  564  TQD----AQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
              D    A   ST + GL DFD ++ E + +Q ++SELDQYLEESL+PR+ EFD++ WWK
Sbjct  540  GNDSCRPATPASTGD-GLLDFDLYLSEMAVNQPTKSELDQYLEESLVPRIQEFDILNWWK  598

Query  399  LNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKD  229
            LN +KYPTLSKMARDIL +P+S  +   S+F+  T  + +D YR SLRPETVEAL CAKD
Sbjct  599  LNNLKYPTLSKMARDILAIPMSMVSTGSSIFASGTGSRVLDEYRSSLRPETVEALFCAKD  658

Query  228  WQQ  220
            W Q
Sbjct  659  WLQ  661



>ref|XP_011081945.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Sesamum indicum]
Length=679

 Score =   211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 134/177 (76%), Gaps = 3/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKM+LVEFSFS+IYGED  T++ IVDEG+HEL+ +Y+   LP  PT+IE  N   V T+
Sbjct  483  RFKMRLVEFSFSRIYGEDVETWINIVDEGLHELYLEYLVQSLP-APTFIEGENDTLVKTE  541

Query  558  DAQE-LSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
              +E L +N  G +DFD +I +  S+Q  +SELDQYLEE LLPRV +FDV+GWWK+NR K
Sbjct  542  PQEEGLLSNTDGFSDFDIYISDIMSAQHMKSELDQYLEEPLLPRVQDFDVLGWWKMNRSK  601

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YPTLSK+A D+L++P+ST  A+SVF    K++D YR SLRP  ++ALVC+KDW Q+E
Sbjct  602  YPTLSKLASDVLSIPLSTISAESVFDMREKKIDSYRSSLRPSILQALVCSKDWLQHE  658



>gb|AAW28145.1| hAT-like transposase [Arabidopsis thaliana]
Length=696

 Score =   211 bits (538),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 126/171 (74%), Gaps = 16/171 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP P   T    + GG  +  
Sbjct  519  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFTEYMALPSPQNTT----SEGGKAD--  572

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  573  ----------GLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  622

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  623  TLSKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  673



>ref|NP_001056444.1| Os05g0583100 [Oryza sativa Japonica Group]
 dbj|BAF18358.1| Os05g0583100, partial [Oryza sativa Japonica Group]
Length=473

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%), Gaps = 13/183 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+  G   N  
Sbjct  275  RFKMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGEG---NNA  331

Query  558  DAQELSTNEL------GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
             A E ST         GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWK
Sbjct  332  PASENSTQTTAPSTGDGLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWK  391

Query  399  LNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKD  229
            LN +K+PTLSKMARDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEAL CAKD
Sbjct  392  LNTLKFPTLSKMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALFCAKD  451

Query  228  WQQ  220
            W Q
Sbjct  452  WLQ  454



>ref|XP_009390780.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390781.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390782.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=673

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 133/180 (74%), Gaps = 7/180 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKIYGED++ YV++V++ IHEL+ +YVA PLPLTP YI++     VN  
Sbjct  476  RFKMKLVEFSFSKIYGEDSARYVKVVNDSIHELYIEYVAQPLPLTPAYIDQGEANHVNGN  535

Query  558  DAQELST-NEL--GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            D    +T N +  GL DFD ++ ET+ +Q ++SELDQYLEESL+PR+  FD++ WWKLN 
Sbjct  536  DNNPHTTPNPMGDGLLDFDIYLSETAVNQATKSELDQYLEESLVPRIQGFDILNWWKLNN  595

Query  390  MKYPTLSKMARDILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            +KYP LSKMA+DIL +PVS      S+F   T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  596  LKYPILSKMAKDILGIPVSIVGTGCSIFGSGTGSRVLDEYRSSLRPETVEALFCAKDWLQ  655



>ref|NP_189803.1| BED zinc finger and hAT dimerization domain-containing protein 
[Arabidopsis thaliana]
 sp|Q9M2N5.1|DSLE_ARATH RecName: Full=Zinc finger BED domain-containing protein DAYSLEEPER; 
AltName: Full=Transposase-like protein DAYSLEEPER [Arabidopsis 
thaliana]
 emb|CAB68118.1| putative transposase [Arabidopsis thaliana]
 gb|AAO24589.1| At3g42170 [Arabidopsis thaliana]
 dbj|BAE99632.1| putative transposase [Arabidopsis thaliana]
 gb|AEE77728.1| BED zinc finger and hAT dimerization domain-containing protein 
[Arabidopsis thaliana]
Length=696

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 126/171 (74%), Gaps = 16/171 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP P   T    + GG  +  
Sbjct  519  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFTEYMALPSPQNTT----SEGGKAD--  572

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  573  ----------GLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  622

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  623  TLSKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  673



>ref|XP_009415017.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009415018.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=669

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 141/195 (72%), Gaps = 9/195 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFK+KLVEFSFSK+YG D++ YV++VD+ IHEL+ +YVA PLPLTP Y+++     +N  
Sbjct  477  RFKIKLVEFSFSKVYGADSARYVKLVDDSIHELYLEYVAQPLPLTPAYVDQGEANHINGN  536

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            D+   + +  GL DFD ++ E S +Q S+ E+DQYLEESL+PR+ +FD++ WWKLN +KY
Sbjct  537  DSNVPTVD--GLQDFDMYLSELSVNQPSKPEIDQYLEESLVPRIQDFDILNWWKLNYLKY  594

Query  381  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            PTLSKMARDIL +PVS  +   S+FS  T  + +D YR SLRPETVEAL CAKDW Q   
Sbjct  595  PTLSKMARDILAIPVSMVSTGCSIFSSGTGSRVLDEYRSSLRPETVEALFCAKDWLQYLP  654

Query  210  VKS---ITAPIKMEV  175
              +    TA +KME+
Sbjct  655  TMAEPPSTAIVKMEI  669



>gb|ABA18094.1| hAT-like transposase [Olimarabidopsis pumila]
Length=672

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 132/191 (69%), Gaps = 17/191 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+ IHELF +Y+ALP P  PT    + GG  +  
Sbjct  493  RFKMKLVEFSFSKIFGEDAGKNIKTVDDSIHELFSEYMALPEPTKPT----SEGGKAD--  546

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                      GL+DFD +IMET+ Q  +SELDQYLEE+L PRV EFDV+ WWK N++KYP
Sbjct  547  ----------GLSDFDTYIMETTGQNLKSELDQYLEETLFPRVQEFDVLDWWKQNKLKYP  596

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW-QQNELVKS  202
            TL KMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA+ W  +N+ + S
Sbjct  597  TLLKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICARVWLLENDAIAS  656

Query  201  ITAPIKMEVPI  169
              A  +M   I
Sbjct  657  SAATQQMSSAI  667



>gb|ACN26356.1| unknown [Zea mays]
Length=510

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 133/177 (75%), Gaps = 4/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A  YV++V++ +HEL+++YVA PLPLTP Y+E  N  A  + 
Sbjct  315  RFKMKLVEFSYSKIYGAEAMKYVKVVNDSLHELYKEYVAQPLPLTPAYVEANNVAANASV  374

Query  558  DAQELSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +    S+   GL DFD ++ E  S+Q ++ +L+QYLEESL PR+ EFD++ WWKLN +K+
Sbjct  375  NQGNPSSTGDGLLDFDMYLSEIQSTQPAKCDLEQYLEESLTPRIQEFDILNWWKLNTLKF  434

Query  381  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARDIL +P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  435  PTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  491



>ref|XP_009139828.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=647

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 125/171 (73%), Gaps = 19/171 (11%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP PL P    EA+G      
Sbjct  476  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFNEYMALPAPLKPA--SEADG------  527

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                       L+DFD +I+ET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  528  -----------LSDFDNYILETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  576

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TL KMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  577  TLCKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  627



>ref|XP_008643588.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
 ref|XP_008643589.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
 ref|XP_008643590.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
Length=719

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 133/181 (73%), Gaps = 9/181 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVN  565
            RFKMKLVEFS+SKIYG  A+ YV++VD+ +HEL+++YVA PLPLTP Y++  E N G  N
Sbjct  521  RFKMKLVEFSYSKIYGAGAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVDQGEGNNGPAN  580

Query  564  TQDAQEL--STNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
               +Q    ST + GL DFD ++ E  SSQ S+SEL+QYL+ESL PR+ EFD++ WWKLN
Sbjct  581  ANSSQGAPASTGD-GLLDFDMYLSEIQSSQPSKSELEQYLDESLTPRIQEFDILNWWKLN  639

Query  393  RMKYPTLSKMARDILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQ  223
             +K+PTLSKMARDIL +PVS  +   S+F   T    +D YR SLRPE VEALVCAKDW 
Sbjct  640  TVKFPTLSKMARDILAIPVSMVSSGSSIFCAGTGSHMLDDYRSSLRPEIVEALVCAKDWL  699

Query  222  Q  220
            Q
Sbjct  700  Q  700



>ref|NP_001147437.1| LOC100281046 [Zea mays]
 gb|ACG27513.1| transposon protein [Zea mays]
Length=719

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 133/181 (73%), Gaps = 9/181 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVN  565
            RFKMKLVEFS+SKIYG  A+ YV++VD+ +HEL+++YVA PLPLTP Y++  E N G  N
Sbjct  521  RFKMKLVEFSYSKIYGAGAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVDQGEGNNGPAN  580

Query  564  TQDAQEL--STNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
               +Q    ST + GL DFD ++ E  SSQ S+SEL+QYL+ESL PR+ EFD++ WWKLN
Sbjct  581  ANSSQGAPASTGD-GLLDFDMYLSEIQSSQPSKSELEQYLDESLTPRIQEFDILNWWKLN  639

Query  393  RMKYPTLSKMARDILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQ  223
             +K+PTLSKMARDIL +PVS  +   S+F   T    +D YR SLRPE VEALVCAKDW 
Sbjct  640  TVKFPTLSKMARDILAIPVSMVSSGSSIFCAGTGSHMLDDYRSSLRPEIVEALVCAKDWL  699

Query  222  Q  220
            Q
Sbjct  700  Q  700



>emb|CDX74476.1| BnaA04g09130D [Brassica napus]
Length=732

 Score =   209 bits (532),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 125/171 (73%), Gaps = 19/171 (11%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP PL P    EA+G      
Sbjct  561  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFNEYMALPAPLKPA--SEADG------  612

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                       L+DFD +I+ET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  613  -----------LSDFDNYILETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  661

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TL KMARDIL++PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  662  TLCKMARDILSIPVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  712



>gb|EPS65666.1| hypothetical protein M569_09109, partial [Genlisea aurea]
Length=690

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 133/181 (73%), Gaps = 16/181 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYI----------E  589
            RFKMKLVEFSFSKIYG++A++ V++VD+GIHELF++YV LP P  P             +
Sbjct  514  RFKMKLVEFSFSKIYGDEAASQVKVVDDGIHELFREYVTLPSPPPPPPPLAHPAHAAEDD  573

Query  588  EANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVG  409
            EA+G    + +      +ELG  DFDA+IMET++Q  +SELD+YLEESLLPRV +FDV  
Sbjct  574  EADGARAASSNG----GSELG--DFDAYIMETTNQMEKSELDRYLEESLLPRVQDFDVTR  627

Query  408  WWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKD  229
            WWK NRM YPTLS+MARDIL++PV T P  +VF    KEMD YRCSLRPETVEAL CAKD
Sbjct  628  WWKANRMNYPTLSRMARDILSIPVCTVPPWAVFDATGKEMDGYRCSLRPETVEALECAKD  687

Query  228  W  226
            W
Sbjct  688  W  688



>ref|NP_001174288.1| Os05g0239150 [Oryza sativa Japonica Group]
 sp|B9FJG3.1|RSLE1_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
1; AltName: Full=Transposase-like protein RICESLEEPER 
1 [Oryza sativa Japonica Group]
 gb|EEE62941.1| hypothetical protein OsJ_17746 [Oryza sativa Japonica Group]
 dbj|BAH93016.1| Os05g0239150 [Oryza sativa Japonica Group]
Length=722

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 134/181 (74%), Gaps = 9/181 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV---  568
            RFKMKLVEFS+SKIYG +A+ YV++VD+ +HEL+ +YVA PLPLTP Y+E+  G      
Sbjct  524  RFKMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYNEYVAQPLPLTPAYVEQGGGNNAPAS  583

Query  567  -NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             N+  A   ST + GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN
Sbjct  584  ENSTQATAPSTGD-GLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLN  642

Query  393  RMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQ  223
             +KYPTLSKMARDIL +P+S  +  +S+FS  T  + +D YR S RPE VEALVCAKDW 
Sbjct  643  TLKYPTLSKMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSSRPEIVEALVCAKDWL  702

Query  222  Q  220
            Q
Sbjct  703  Q  703



>ref|NP_001051173.1| Os03g0733400 [Oryza sativa Japonica Group]
 sp|Q6AVI0.1|RSLE2_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
2; AltName: Full=Transposase-like protein RICESLEEPER 
2 [Oryza sativa Japonica Group]
 gb|AAT77879.1| putative hAT family dimerisation domain containing protein [Oryza 
sativa Japonica Group]
 gb|AAT78789.1| putative transposases [Oryza sativa Japonica Group]
 gb|ABF98716.1| hAT family dimerisation domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13087.1| Os03g0733400 [Oryza sativa Japonica Group]
 gb|EAZ28483.1| hypothetical protein OsJ_12466 [Oryza sativa Japonica Group]
 dbj|BAH00332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=722

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 136/181 (75%), Gaps = 9/181 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV---  568
            RFKMKLVEFS+SKIYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+ +G      
Sbjct  524  RFKMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGDGNNAPAS  583

Query  567  -NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             N   A   ST + GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN
Sbjct  584  ENGTQATAPSTGD-GLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLN  642

Query  393  RMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQ  223
             +K+PTLS+MARDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEALVCAKDW 
Sbjct  643  TLKFPTLSRMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALVCAKDWL  702

Query  222  Q  220
            Q
Sbjct  703  Q  703



>gb|EAY97185.1| hypothetical protein OsI_19106 [Oryza sativa Indica Group]
Length=409

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 133/180 (74%), Gaps = 9/180 (5%)
 Frame = -3

Query  735  FKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV----  568
            ++MKLVEFS+SKIYG +A+ YV++VD+ +HEL+ +YVA PLPLTP Y+E+  G       
Sbjct  212  WEMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYNEYVAQPLPLTPAYVEQGGGNNAPASE  271

Query  567  NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            N+  A   ST + GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN 
Sbjct  272  NSTQATAPSTGD-GLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLNT  330

Query  390  MKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            +KYPTLSKMARDIL +P+S  +  +S+FS  T  + +D YR S RPE VEALVCAKDW Q
Sbjct  331  LKYPTLSKMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSSRPEIVEALVCAKDWLQ  390



>gb|EAY91763.1| hypothetical protein OsI_13406 [Oryza sativa Indica Group]
Length=409

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 134/179 (75%), Gaps = 9/179 (5%)
 Frame = -3

Query  732  KMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV----N  565
            +MKLVEFS+SKIYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+ +G       N
Sbjct  213  EMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGDGNNAPASEN  272

Query  564  TQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
               A   ST + GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN +
Sbjct  273  GTQATAPSTGD-GLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLNTL  331

Query  387  KYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            K+PTLS+MARDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEALVCAKDW Q
Sbjct  332  KFPTLSRMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALVCAKDWLQ  390



>ref|XP_010097200.1| Putative AC transposase [Morus notabilis]
 gb|EXB67267.1| Putative AC transposase [Morus notabilis]
Length=682

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 134/184 (73%), Gaps = 11/184 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEF+FSKIYGE+A T+VRIVD+GIHELF DY+   L L    ++  N   ++++
Sbjct  478  RFKMKLVEFTFSKIYGENAETWVRIVDDGIHELFIDYMTQMLALPEPSMDNGNEHMIDSE  537

Query  558  DAQE---------LSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVG  409
              QE         +ST + GL+DF+ ++ E TSSQQ +SELDQYLEE LLPRV EFD++ 
Sbjct  538  THQEDVHDYEGPFISTGD-GLSDFEIYLSEITSSQQMKSELDQYLEEPLLPRVQEFDIMS  596

Query  408  WWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKD  229
            WW  NR KYPTLS+MA DIL++PVST   DSVF T  K +D+YR SL P T+EAL+CAKD
Sbjct  597  WWNQNRSKYPTLSRMASDILSIPVSTVAPDSVFDTNLKVVDKYRSSLHPVTLEALICAKD  656

Query  228  WQQN  217
            W Q+
Sbjct  657  WLQH  660



>ref|XP_010230409.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger BED domain-containing 
protein RICESLEEPER 2-like [Brachypodium distachyon]
Length=323

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 131/182 (72%), Gaps = 10/182 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++V++ +HEL++DYVA PLPLTP Y+E+         
Sbjct  126  RFKMKLVEFSYSKIYGIEAAKYVKVVNDSVHELYKDYVAQPLPLTPAYVEQGETTNNAAA  185

Query  558  D-----AQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKL  397
            +     A + ST + GL DFD ++ E  +SQ S+SEL+QYL+ESL PR+ EFD++ WWKL
Sbjct  186  NGNNPRATQPSTGD-GLLDFDMYLSEIATSQPSKSELEQYLDESLTPRIQEFDILNWWKL  244

Query  396  NRMKYPTLSKMARDILTVPVSTAP-ADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  226
            N +K+PTLSKMARDIL +P+S      S+FS  T    +D YR SLRPE VEALVC KDW
Sbjct  245  NTLKFPTLSKMARDILAIPMSMVTIGSSIFSAGTGSHMLDDYRSSLRPEIVEALVCTKDW  304

Query  225  QQ  220
             Q
Sbjct  305  LQ  306



>gb|EEE64835.1| hypothetical protein OsJ_19692 [Oryza sativa Japonica Group]
Length=722

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%), Gaps = 13/183 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+  G   N  
Sbjct  524  RFKMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGEG---NNA  580

Query  558  DAQELSTNEL------GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
             A E ST         GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWK
Sbjct  581  PASENSTQTTAPSTGDGLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWK  640

Query  399  LNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKD  229
            LN +K+PTLSKMARDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEAL CAKD
Sbjct  641  LNTLKFPTLSKMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALFCAKD  700

Query  228  WQQ  220
            W Q
Sbjct  701  WLQ  703



>gb|EEC79762.1| hypothetical protein OsI_21153 [Oryza sativa Indica Group]
Length=722

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%), Gaps = 13/183 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+  G   N  
Sbjct  524  RFKMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGEG---NNA  580

Query  558  DAQELSTNEL------GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
             A E ST         GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWK
Sbjct  581  PASENSTQTTAPSTGDGLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWK  640

Query  399  LNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKD  229
            LN +K+PTLSKMARDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEAL CAKD
Sbjct  641  LNTLKFPTLSKMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALFCAKD  700

Query  228  WQQ  220
            W Q
Sbjct  701  WLQ  703



>ref|XP_008675089.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008675096.1| PREDICTED: transposon protein isoform X1 [Zea mays]
Length=768

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 133/177 (75%), Gaps = 4/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A  YV++V++ +HEL+++YVA PLPLTP Y+E  N  A  + 
Sbjct  573  RFKMKLVEFSYSKIYGAEAMKYVKVVNDSLHELYKEYVAQPLPLTPAYVEANNVAANASV  632

Query  558  DAQELSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +    S+   GL DFD ++ E  S+Q ++ +L+QYLEESL PR+ EFD++ WWKLN +K+
Sbjct  633  NQGNPSSTGDGLLDFDMYLSEIQSTQPAKCDLEQYLEESLTPRIQEFDILNWWKLNTLKF  692

Query  381  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARDIL +P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  693  PTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  749



>ref|NP_001147988.1| transposon protein [Zea mays]
 gb|ACG29330.1| transposon protein [Zea mays]
Length=768

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 133/177 (75%), Gaps = 4/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A  YV++V++ +HEL+++YVA PLPLTP Y+E  N  A  + 
Sbjct  573  RFKMKLVEFSYSKIYGAEAMKYVKVVNDSLHELYKEYVAQPLPLTPAYVEANNVAANASV  632

Query  558  DAQELSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +    S+   GL DFD ++ E  S+Q ++ +L+QYLEESL PR+ EFD++ WWKLN +K+
Sbjct  633  NQGNPSSTGDGLLDFDMYLSEIQSTQPAKCDLEQYLEESLTPRIQEFDILNWWKLNTLKF  692

Query  381  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARDIL +P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  693  PTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  749



>emb|CDY37871.1| BnaC04g31350D [Brassica napus]
Length=647

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 124/171 (73%), Gaps = 19/171 (11%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   ++ VD+GIHELF +Y+ALP PL P    EA+G      
Sbjct  476  RFKMKLVEFSFSKIFGEDAGKNIKTVDDGIHELFNEYMALPEPLKPA--SEADG------  527

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
                       L+DFD +I+ET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYP
Sbjct  528  -----------LSDFDNYILETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYP  576

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TL KMARDIL++ VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  577  TLCKMARDILSISVSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  627



>ref|XP_009757867.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Nicotiana sylvestris]
Length=675

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTP-TYIEEANGGAVNT  562
            RFKMK+VEF+F+KIYGE+A T+++IVDEG+HELF DY+   LP  P  +++EAN   + +
Sbjct  480  RFKMKIVEFTFNKIYGEEAETWIKIVDEGVHELFCDYIVQSLPPPPPNFVDEANENIIKS  539

Query  561  QDAQE--LSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +  QE     N     DFD ++ +  ++QQ ++ELDQYLEESL+PR  +FDV+GWW++NR
Sbjct  540  EFCQEDNFLPNGDTFADFDVYLHDIMNNQQMKTELDQYLEESLMPRSQDFDVLGWWRINR  599

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
             KYPTLSKMA DIL++PV T   DSVF T  + +D +R SLRP T+EAL CAKDW Q E
Sbjct  600  SKYPTLSKMASDILSIPVCTVTLDSVFDTTPRNLDSHRSSLRPITLEALSCAKDWLQYE  658



>ref|XP_010654811.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Vitis vinifera]
Length=689

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 140/209 (67%), Gaps = 24/209 (11%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEEANGGAVN  565
            RFKMKLVEFSFSKIYG +A  +++IVDEGI ELF DYV  P  L + P Y+EE  G  V 
Sbjct  482  RFKMKLVEFSFSKIYGAEAEMWIKIVDEGIRELFVDYVTQPPLLSIQPAYVEE--GTEVI  539

Query  564  TQ----------------DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLP  436
            +Q                D   L ++   L+DFD +I E S  Q  RSELDQYL+ESL+P
Sbjct  540  SQTYMEEGTEVIPKTEMTDGGPLLSDSDRLSDFDVYISEISGGQDMRSELDQYLDESLMP  599

Query  435  RVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPET  256
            R  +FDV+ WWKLN++KYPTLS+MA DIL++P++T   D+VF TV +++D YR SLRP T
Sbjct  600  RSQDFDVLAWWKLNKLKYPTLSRMASDILSIPITTVGPDNVFDTVGRKIDSYRSSLRPLT  659

Query  255  VEALVCAKDWQQNELVK---SITAPIKME  178
            +EAL+CAKDW QN   +   S+   +KME
Sbjct  660  LEALICAKDWLQNGATEPDMSVPPIVKME  688



>ref|XP_009757855.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009757861.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Nicotiana sylvestris]
Length=697

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTP-TYIEEANGGAVNT  562
            RFKMK+VEF+F+KIYGE+A T+++IVDEG+HELF DY+   LP  P  +++EAN   + +
Sbjct  502  RFKMKIVEFTFNKIYGEEAETWIKIVDEGVHELFCDYIVQSLPPPPPNFVDEANENIIKS  561

Query  561  QDAQE--LSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +  QE     N     DFD ++ +  ++QQ ++ELDQYLEESL+PR  +FDV+GWW++NR
Sbjct  562  EFCQEDNFLPNGDTFADFDVYLHDIMNNQQMKTELDQYLEESLMPRSQDFDVLGWWRINR  621

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
             KYPTLSKMA DIL++PV T   DSVF T  + +D +R SLRP T+EAL CAKDW Q E
Sbjct  622  SKYPTLSKMASDILSIPVCTVTLDSVFDTTPRNLDSHRSSLRPITLEALSCAKDWLQYE  680



>ref|XP_009594303.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
 ref|XP_009594304.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
 ref|XP_009594305.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=675

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 132/179 (74%), Gaps = 4/179 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTP-TYIEEANGGAVNT  562
            RFKMK+VEF+F+KIYGE+A T+++IVDEG+HE+F DY+   LP  P  +++EAN   + +
Sbjct  480  RFKMKIVEFTFNKIYGEEAETWIKIVDEGVHEVFCDYIVQSLPPPPPNFVDEANENIIKS  539

Query  561  QDAQELS--TNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            +  QE S   N     DFD ++ +  ++QQ ++ELDQYLEESL+PR  +FDV+GWW++NR
Sbjct  540  EFCQEDSFLPNGDTFADFDVYLHDIMNNQQMKTELDQYLEESLMPRSQDFDVLGWWRINR  599

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
             KYPTLSKMA DIL++PV T   DSVF T  + +D +R SLRP T+EAL CAKDW Q E
Sbjct  600  SKYPTLSKMASDILSIPVCTVTPDSVFDTTPRNLDSHRSSLRPITLEALSCAKDWLQYE  658



>ref|XP_002463929.1| hypothetical protein SORBIDRAFT_01g009090 [Sorghum bicolor]
 gb|EER90927.1| hypothetical protein SORBIDRAFT_01g009090 [Sorghum bicolor]
Length=770

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 135/187 (72%), Gaps = 4/187 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++V++ +HEL+++YVA PLPLTP Y+E  N  A    
Sbjct  575  RFKMKLVEFSYSKIYGAEATKYVKVVNDSLHELYKEYVAQPLPLTPAYVEANNVAANTNV  634

Query  558  DAQELSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +     +   GL DFD ++ E  SSQ ++ EL+QYLEESL PR+ EFD++ WWKLN +K+
Sbjct  635  NQGNPPSTSDGLLDFDMYLSEIQSSQPAKCELEQYLEESLTPRIQEFDILNWWKLNTLKF  694

Query  381  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            PTLSKMARDIL +P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q   
Sbjct  695  PTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQYSP  754

Query  210  VKSITAP  190
              +  AP
Sbjct  755  PAATEAP  761



>ref|XP_011017830.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=716

 Score =   203 bits (517),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 128/171 (75%), Gaps = 5/171 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF + YGE+A  +V+I+D G+HELF +YV LP PL   Y E+  G   N  
Sbjct  528  RFKMKLIEFSFLRFYGEEAGKHVKIIDGGLHELFLEYVRLPHPLNSAYAED--GNFENNT  585

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
              +E+S N  GL D D ++ +T+SQ ++SEL+QYLE+SL PR  E DV+ WW+ N++KYP
Sbjct  586  KTEEISDN--GLADCDVYV-KTTSQDTKSELEQYLEDSLSPRHQEMDVLKWWEENKLKYP  642

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMARDILT+ VSTA  ++VF T  KE+D YR SLRPETVEALVCAKDW
Sbjct  643  TLSKMARDILTIQVSTAEPNTVFDTEIKELDSYRSSLRPETVEALVCAKDW  693



>ref|XP_009392578.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=671

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 129/180 (72%), Gaps = 7/180 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKIYG D++ YV++VD+ +HEL+ +YV  PLP T  Y+++      N  
Sbjct  474  RFKMKLVEFSFSKIYGADSARYVKLVDDSVHELYLEYVEQPLPQTLAYVDQGEANHANGD  533

Query  558  DAQELSTN---ELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            D    +T+     GL DFD ++ E + +Q S+SE+DQYLEESL+PR+ EFD++ WWKLN 
Sbjct  534  DKNVPTTSMPAADGLQDFDMYLSELAVNQSSKSEIDQYLEESLMPRIQEFDILNWWKLNY  593

Query  390  MKYPTLSKMARDILTVPVSTAPAD-SVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            +KYPTLSKMARDIL +PVS      S+FS  T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  594  LKYPTLSKMARDILAIPVSMVDTGCSIFSSGTGSRVLDEYRSSLRPETVEALFCAKDWLQ  653



>ref|XP_010063482.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Eucalyptus grandis]
 gb|KCW70722.1| hypothetical protein EUGRSUZ_F03885 [Eucalyptus grandis]
Length=789

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 139/206 (67%), Gaps = 18/206 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFS+I+GEDA T++ +VDEGI ELF DY +  LPL    +E      + ++
Sbjct  584  RFKMKLVEFSFSRIFGEDAETWIGLVDEGIRELFLDYFSPILPLPEAPMENGTESIIKSE  643

Query  558  DAQE------LSTNEL-----------GLTDFDAFIME-TSSQQSRSELDQYLEESLLPR  433
               E      +S  EL           GL+DFD +I E TS QQ++SELDQYLEESLLPR
Sbjct  644  LPNEGMPQEGVSHEELPHDGTVISFGDGLSDFDVYISEITSGQQTKSELDQYLEESLLPR  703

Query  432  VHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETV  253
            V +FD++GWWKLN +KYP LSKMA D+L++P+S     +VF T  K++D YR SLRP T+
Sbjct  704  VQDFDLLGWWKLNNLKYPILSKMAADVLSIPISIVDPGAVFDTQSKKIDGYRSSLRPVTL  763

Query  252  EALVCAKDWQQNELVKSITAPIKMEV  175
            EALVCAK+W Q+   ++  A +K EV
Sbjct  764  EALVCAKNWLQSGSSETSNAFVKAEV  789



>ref|XP_010906913.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=687

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 132/190 (69%), Gaps = 17/190 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFK+KLVEFSFSKIYGE+A  Y+++V++ IHEL+ +YVA PLPLTP Y E+    A N  
Sbjct  480  RFKLKLVEFSFSKIYGEEAVRYIKVVNDSIHELYLEYVAQPLPLTPAYEEQGEATANNIN  539

Query  558  DAQE-------------LSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEF  421
              +              L TN  GL DFD ++ E + +Q ++SEL+QYLEESL+PR+ EF
Sbjct  540  GNENGSGSGNDNDRPATLVTNGDGLLDFDLYLSEMAVNQPTKSELEQYLEESLVPRIQEF  599

Query  420  DVVGWWKLNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVE  250
            D++ WWKLN +KYPTLSKMARD+L +P+S  +   S+F+  T  + +D Y  SLRPETVE
Sbjct  600  DILNWWKLNNLKYPTLSKMARDVLAIPMSMVSTGSSIFASGTGSRVLDDYHSSLRPETVE  659

Query  249  ALVCAKDWQQ  220
            AL CAKDW Q
Sbjct  660  ALFCAKDWLQ  669



>ref|XP_009379900.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X3 [Musa acuminata subsp. malaccensis]
Length=648

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 130/181 (72%), Gaps = 9/181 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGED++ ++++V++ IHEL+ +YV+ PL L P Y++E     +N  
Sbjct  451  RFKMKLVEFSFAKIYGEDSARFIKVVNDSIHELYLEYVSQPLQLMPAYVDEGEANHMNGN  510

Query  558  D----AQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLN  394
            D    A   ST + GL DFD ++ E +  QS +SELDQYLEESL+PR+  FD++ WWKLN
Sbjct  511  DNNPPATPNSTGD-GLLDFDVYLSEMAVNQSTKSELDQYLEESLVPRIQGFDILNWWKLN  569

Query  393  RMKYPTLSKMARDILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQ  223
             +KYPTLSKMARD+L +PVS      S+F   T  + +D YR SLRPETVEAL CAKDW 
Sbjct  570  NLKYPTLSKMARDVLAIPVSMVGTGCSIFGSGTGSRVLDDYRSSLRPETVEALFCAKDWL  629

Query  222  Q  220
            Q
Sbjct  630  Q  630



>emb|CAN81954.1| hypothetical protein VITISV_014020 [Vitis vinifera]
Length=1045

 Score =   204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 140/209 (67%), Gaps = 24/209 (11%)
 Frame = -3

Query  738   RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEEANGGAVN  565
             RFKMKLVEFSFSKIYG +A  +++IVDEGI ELF DYV  P  L + P Y+EE  G  V 
Sbjct  838   RFKMKLVEFSFSKIYGAEAEMWIKIVDEGIRELFVDYVTQPPLLSIQPAYVEE--GTEVI  895

Query  564   TQ----------------DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLP  436
             +Q                D   L ++   L+DFD +I E S  Q  RSELDQYL+ESL+P
Sbjct  896   SQTYMEEGTEVIPKTEMTDGGPLLSDSDRLSDFDVYISEISGGQDMRSELDQYLDESLMP  955

Query  435   RVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPET  256
             R  +FDV+ WWKLN++KYPTLS+MA DIL++P++T   D+VF TV +++D YR SLRP T
Sbjct  956   RSQDFDVLAWWKLNKLKYPTLSRMASDILSIPITTVGPDNVFDTVGRKIDSYRSSLRPVT  1015

Query  255   VEALVCAKDWQQNELVK---SITAPIKME  178
             +EAL+CAKDW QN   +   S+   +KME
Sbjct  1016  LEALICAKDWLQNGATEPDMSVPPIVKME  1044



>ref|XP_009379897.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009379898.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009379899.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=678

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 130/181 (72%), Gaps = 9/181 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGED++ ++++V++ IHEL+ +YV+ PL L P Y++E     +N  
Sbjct  481  RFKMKLVEFSFAKIYGEDSARFIKVVNDSIHELYLEYVSQPLQLMPAYVDEGEANHMNGN  540

Query  558  D----AQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLN  394
            D    A   ST + GL DFD ++ E +  QS +SELDQYLEESL+PR+  FD++ WWKLN
Sbjct  541  DNNPPATPNSTGD-GLLDFDVYLSEMAVNQSTKSELDQYLEESLVPRIQGFDILNWWKLN  599

Query  393  RMKYPTLSKMARDILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQ  223
             +KYPTLSKMARD+L +PVS      S+F   T  + +D YR SLRPETVEAL CAKDW 
Sbjct  600  NLKYPTLSKMARDVLAIPVSMVGTGCSIFGSGTGSRVLDDYRSSLRPETVEALFCAKDWL  659

Query  222  Q  220
            Q
Sbjct  660  Q  660



>ref|XP_009379895.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009379896.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=685

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 130/181 (72%), Gaps = 9/181 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSF+KIYGED++ ++++V++ IHEL+ +YV+ PL L P Y++E     +N  
Sbjct  488  RFKMKLVEFSFAKIYGEDSARFIKVVNDSIHELYLEYVSQPLQLMPAYVDEGEANHMNGN  547

Query  558  D----AQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLN  394
            D    A   ST + GL DFD ++ E +  QS +SELDQYLEESL+PR+  FD++ WWKLN
Sbjct  548  DNNPPATPNSTGD-GLLDFDVYLSEMAVNQSTKSELDQYLEESLVPRIQGFDILNWWKLN  606

Query  393  RMKYPTLSKMARDILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQ  223
             +KYPTLSKMARD+L +PVS      S+F   T  + +D YR SLRPETVEAL CAKDW 
Sbjct  607  NLKYPTLSKMARDVLAIPVSMVGTGCSIFGSGTGSRVLDDYRSSLRPETVEALFCAKDWL  666

Query  222  Q  220
            Q
Sbjct  667  Q  667



>ref|XP_010906914.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=687

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 133/190 (70%), Gaps = 17/190 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEA--------  583
            RFK+KLVEFSFSKIYG DA  Y+ +V++ IHEL+ +YVA PLPLTP Y E+         
Sbjct  480  RFKLKLVEFSFSKIYGADAVRYINVVNDSIHELYLEYVAQPLPLTPAYEEQGEVTTSNIN  539

Query  582  ---NGGAVNTQDAQ--ELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEF  421
               NG  +   + +   L +N  GL DFD ++ E + +Q ++SEL+QYLEESL+PR+ EF
Sbjct  540  GNENGSGIGNDNNRPTTLVSNGDGLQDFDLYLSEMAVNQPTKSELEQYLEESLVPRIQEF  599

Query  420  DVVGWWKLNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVE  250
            D++ WWKLN +KYPTLSK+ARD+L +P+S  +   S+F+  T  + +D YR SLRPETVE
Sbjct  600  DILNWWKLNNLKYPTLSKLARDVLAIPMSMVSTGSSIFASGTGSRVLDDYRSSLRPETVE  659

Query  249  ALVCAKDWQQ  220
            AL CAKDW Q
Sbjct  660  ALFCAKDWLQ  669



>gb|KDO48633.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
 gb|KDO48634.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
 gb|KDO48635.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
Length=694

 Score =   200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 134/196 (68%), Gaps = 24/196 (12%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEA--------  583
            RFKMKL+EFSFS+IYGEDA  +++ VD+G+HELF +Y+   L L  T+++E         
Sbjct  491  RFKMKLIEFSFSRIYGEDAGMWIKAVDDGLHELFHEYLVQMLALPDTFMDEGLEVIPKSE  550

Query  582  -------NGGAV-------NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEE  448
                   + G +       ++QD   +S  + GL+DF+ +I E TS Q  RSELDQYLEE
Sbjct  551  ASREETLHAGNIEEGTPQEHSQDLSLISIGD-GLSDFEVYISEDTSGQPMRSELDQYLEE  609

Query  447  SLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSL  268
             LLPR  +FD++ WW+LN+ KYPTLS+MA DIL++P ST P DSVF TV K++D YR SL
Sbjct  610  FLLPRTQDFDILDWWRLNQAKYPTLSRMASDILSIPFSTVPTDSVFDTVSKKIDSYRSSL  669

Query  267  RPETVEALVCAKDWQQ  220
            RP T+EAL+CAKDW Q
Sbjct  670  RPVTLEALICAKDWLQ  685



>ref|XP_010691104.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Beta vulgaris subsp. vulgaris]
Length=719

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 140/197 (71%), Gaps = 10/197 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+K+KLVEFSFSK+YGE+A  ++R V +GIHEL+ +YVA  LPL   ++E+   G +  +
Sbjct  521  RYKLKLVEFSFSKVYGEEADMWLRAVYDGIHELYFEYVAQTLPLPSIHVEQRYEGFIKAE  580

Query  558  DAQELST--NELGLTDFDAFIMETSS-QQSRSELDQYLEESLLPR-VHEFDVVGWWKLNR  391
              Q+ +T     GL+DFD +I E SS  Q++SELDQYL+ESLLPR   +FD++ WWKLNR
Sbjct  581  ALQDEATLPPSDGLSDFDVYISEISSNHQTKSELDQYLDESLLPRGSQDFDILEWWKLNR  640

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW-----  226
            +KYPTLSKMA DIL++P +T   DSVF TV K++D +R SL+P T+EALVCA DW     
Sbjct  641  IKYPTLSKMAADILSIPFATVSRDSVFDTVGKKLDSHRSSLKPVTLEALVCANDWLQCGM  700

Query  225  -QQNELVKSITAPIKME  178
             Q + L+   T  IKME
Sbjct  701  RQSSPLLDISTMCIKME  717



>ref|XP_006427320.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 ref|XP_006427321.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 gb|ESR40560.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 gb|ESR40561.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
Length=699

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 134/201 (67%), Gaps = 29/201 (14%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEA--------  583
            RFKMKL+EFSFS+IYGEDA  +++ VD+G+HELF +Y+   L L  T+++E         
Sbjct  491  RFKMKLIEFSFSRIYGEDAGMWIKAVDDGLHELFHEYLVQMLALPDTFMDEGLEVIPKSE  550

Query  582  -------NGGAV------------NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELD  463
                   + G +            ++QD   +S  + GL+DF+ +I E TS Q  RSELD
Sbjct  551  ASREETLHAGNIEEGTPQEGHPQEHSQDLSLISIGD-GLSDFEVYISEDTSGQPMRSELD  609

Query  462  QYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDR  283
            QYLEE LLPR  +FD++ WW+LN+ KYPTLS+MA DIL++P ST P DSVF TV K++D 
Sbjct  610  QYLEEFLLPRTQDFDILDWWRLNQAKYPTLSRMASDILSIPFSTVPTDSVFDTVSKKIDS  669

Query  282  YRCSLRPETVEALVCAKDWQQ  220
            YR SLRP T+EAL+CAKDW Q
Sbjct  670  YRSSLRPVTLEALICAKDWLQ  690



>ref|XP_008790202.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008790203.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=682

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 130/186 (70%), Gaps = 13/186 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFK+KLVEFSFSKIYG DA  Y ++V++ IHEL+ +YVA PLPLTP Y E+      N  
Sbjct  479  RFKLKLVEFSFSKIYGADAGRYAKVVNDSIHELYLEYVAQPLPLTPAYEEQGEATGNNIN  538

Query  558  DAQ---------ELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVG  409
              +          L +N  GL DFD ++ E + +Q ++SEL+QYLEESL+PR+ EFD++ 
Sbjct  539  GNENGNDNNRPANLVSNGDGLLDFDLYLSEMAVNQPTKSELEQYLEESLVPRIQEFDILN  598

Query  408  WWKLNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVC  238
            WWKLN +KYPTLSKMARD+L +P+S  +   S+F+  T  + +D Y+ SLRPETVEAL C
Sbjct  599  WWKLNNLKYPTLSKMARDVLAIPMSMVSTGSSIFASGTGSRVLDEYKSSLRPETVEALFC  658

Query  237  AKDWQQ  220
            AKDW Q
Sbjct  659  AKDWLQ  664



>ref|NP_001151544.1| transposon protein [Zea mays]
 gb|ACG43259.1| transposon protein [Zea mays]
Length=764

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 129/177 (73%), Gaps = 4/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++V++ +HEL+++YVA  LPL P Y+E  N  A    
Sbjct  569  RFKMKLVEFSYSKIYGAEAAKYVKVVNDSLHELYKEYVAQTLPLAPAYVEANNVAANTNV  628

Query  558  DAQELSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +         GL DFD ++ E  SSQ ++ EL+QYLEESL PR+ EFD++ WWKLN +K+
Sbjct  629  NQGNPPPTSDGLLDFDMYLSEIQSSQPAKCELEQYLEESLTPRIQEFDILNWWKLNTLKF  688

Query  381  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARDIL +P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  689  PTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  745



>ref|XP_008643805.1| PREDICTED: transposon protein isoform X1 [Zea mays]
Length=764

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 129/177 (73%), Gaps = 4/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++V++ +HEL+++YVA  LPL P Y+E  N  A    
Sbjct  569  RFKMKLVEFSYSKIYGAEAAKYVKVVNDSLHELYKEYVAQTLPLAPAYVEANNVAANTNV  628

Query  558  DAQELSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +         GL DFD ++ E  SSQ ++ EL+QYLEESL PR+ EFD++ WWKLN +K+
Sbjct  629  NQGNPPPTSDGLLDFDMYLSEIQSSQPAKCELEQYLEESLTPRIQEFDILNWWKLNTLKF  688

Query  381  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARDIL +P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  689  PTLSKMARDILAIPMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  745



>ref|XP_010230399.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
 ref|XP_010230403.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
 ref|XP_010230404.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
Length=769

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 132/183 (72%), Gaps = 11/183 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++VD+ IHE++++YVA PL LTP Y+E+      N  
Sbjct  570  RFKMKLVEFSYSKIYGMEAAKYVKVVDDAIHEIYKEYVAQPLTLTPAYVEQGEANK-NVH  628

Query  558  DAQELSTNEL-----GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKL  397
             +Q  +T  L     GL DFD ++ E + SQ S+SEL+QYLEE+L PR+ +F+++ WWKL
Sbjct  629  ASQNNNTVTLPSAGDGLLDFDKYLSEIAVSQPSKSELEQYLEEALTPRIQDFEILDWWKL  688

Query  396  NRMKYPTLSKMARDILTVPVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKD  229
            N +K+PTLSKMARDIL +P+S  +   S+FS   T  + +D YR SLRPETVEAL C KD
Sbjct  689  NTLKFPTLSKMARDILAIPMSMVSRGSSIFSAATTGSRMLDDYRSSLRPETVEALFCTKD  748

Query  228  WQQ  220
            W Q
Sbjct  749  WLQ  751



>ref|NP_001136571.1| uncharacterized protein LOC100216693 [Zea mays]
 gb|ACF82192.1| unknown [Zea mays]
Length=503

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 132/182 (73%), Gaps = 10/182 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVN--  565
            RFKMKLVEFS++KIYG +A+ +V++V++ +HEL+++YVA PLPLTP Y+E+  GG     
Sbjct  315  RFKMKLVEFSYTKIYGAEAAKHVKVVNDAVHELYEEYVAHPLPLTPAYVEQGEGGNNGAA  374

Query  564  ---TQDAQELSTNELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKL  397
               +      S  + GL DFD ++ E  SSQ S+ EL+QYL+ESL PR  EFD++ WWKL
Sbjct  375  NANSSQGSPASAGD-GLLDFDMYLSEIQSSQPSKPELEQYLDESLTPRTQEFDILNWWKL  433

Query  396  NRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  226
            NR+K+PTLS+MA DIL +P+S  +   S+F+  T  + +D YR SLRPETVEALVCAKDW
Sbjct  434  NRVKFPTLSRMACDILAIPMSMVSSGSSIFTAGTGSRMLDDYRSSLRPETVEALVCAKDW  493

Query  225  QQ  220
             Q
Sbjct  494  LQ  495



>dbj|BAK03580.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   187 bits (476),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 128/175 (73%), Gaps = 8/175 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++V++ +HEL+++Y+A PLP  P Y+ ++  G  NTQ
Sbjct  140  RFKMKLVEFSYSKIYGVEAAKYVKVVNDSLHELYKEYLAQPLPARPVYVGQSASGNNNTQ  199

Query  558  DAQELSTNELGLTDFDAFIMETSSQQ-SRSELDQYLEESLLPR-VHEFDVVGWWKLNRMK  385
                   +  GL DFD ++ E ++ Q S+SEL+QYLEE L PR + EFD++ WWKLN ++
Sbjct  200  TTPPSIGD--GLLDFDMYLSEIATAQPSKSELEQYLEEPLTPRSIQEFDILSWWKLNTLR  257

Query  384  YPTLSKMARDILTVPVSTAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  226
            +PTLSKMARD+L +P++     S+FS  T  + +D YR SLRPE VEALVCAKDW
Sbjct  258  FPTLSKMARDVLAIPMTM--VSSIFSAETGIRTLDDYRSSLRPEIVEALVCAKDW  310



>gb|KHN03603.1| Putative AC transposase [Glycine soja]
Length=123

 Score =   180 bits (456),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  528  GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  349
            GLTDFD +IMETS+ Q +SELDQYLEESLLPRV +FDV+GWWKLN++KYPTLSKMARDIL
Sbjct  6    GLTDFDVYIMETSNHQMKSELDQYLEESLLPRVPDFDVLGWWKLNKLKYPTLSKMARDIL  65

Query  348  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  178
            +VPVS+ P +SVF T  KEMD+YR SLRPETVEALVCAKDW Q    ++  A +KME
Sbjct  66   SVPVSSLPPESVFDTKVKEMDQYRSSLRPETVEALVCAKDWMQYGAAEASNALVKME  122



>ref|XP_007215012.1| hypothetical protein PRUPE_ppa002495mg [Prunus persica]
 gb|EMJ16211.1| hypothetical protein PRUPE_ppa002495mg [Prunus persica]
Length=666

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 127/178 (71%), Gaps = 7/178 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KMK+VE  F++IYGE+A T++RIVD+GIHELF DY+   L L  T ++E N   + T+
Sbjct  477  RYKMKIVELEFNRIYGENAETWIRIVDDGIHELFLDYMMQMLTLPETPMDEGNDSIIKTE  536

Query  558  DAQELS------TNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
              +E S      ++  GL DF+ +I + T  QQ +SELDQYLEE+   RV +FDV+ WW+
Sbjct  537  APEEASQEGSLLSSVDGLQDFELYISDITGGQQMKSELDQYLEEAFTDRVEDFDVLVWWR  596

Query  399  LNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            LNRMKYPTLS+MA DIL++ VST  +DSVF T  K MD Y+ SL P T+EAL+CAKDW
Sbjct  597  LNRMKYPTLSRMASDILSISVSTVASDSVFDTEIKRMDSYQTSLGPATLEALICAKDW  654



>emb|CDY48867.1| BnaA06g03150D [Brassica napus]
Length=659

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 119/172 (69%), Gaps = 21/172 (12%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   +  VD+GIHELF +YVAL   + P   +E         
Sbjct  485  RFKMKLVEFSFSKIFGEDAGKNINTVDDGIHELFSEYVALSALVKPASEDE---------  535

Query  558  DAQELSTNELGLTDFDAFIM-ETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                       L++FD FI+ E + +  +SELDQYLEE+LLPRV EFDV+ WWK N++K+
Sbjct  536  -----------LSEFDKFIIKERAGKNLKSELDQYLEETLLPRVQEFDVLEWWKQNKLKF  584

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            PTLSKMARDIL +PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  585  PTLSKMARDILAIPVSAAAFDYVFHVEPREMDEYKTSLRPETVEALICAREW  636



>ref|XP_009147901.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=659

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 118/172 (69%), Gaps = 21/172 (12%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   +  VD+GIHELF +YVAL   + P   +E         
Sbjct  485  RFKMKLVEFSFSKIFGEDAGKNINTVDDGIHELFSEYVALSALVKPASEDE---------  535

Query  558  DAQELSTNELGLTDFDAF-IMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                       L++FD F I E + +  +SELDQYLEE+LLPRV EFDV+ WWK N++K+
Sbjct  536  -----------LSEFDKFMIKERAGKNLKSELDQYLEETLLPRVQEFDVLEWWKQNKLKF  584

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            PTLSKMARDIL +PVS A  D VF    +EMD Y+ SLRPETVEAL+CAK+W
Sbjct  585  PTLSKMARDILAIPVSAAAFDYVFDVEPREMDEYKTSLRPETVEALICAKEW  636



>emb|CDY60307.1| BnaUnng00680D [Brassica napus]
Length=663

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 120/172 (70%), Gaps = 21/172 (12%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFSKI+GEDA   +  VD+GIHELF +YVAL  P+                
Sbjct  489  RFKMKLVEFSFSKIFGEDAGKNINTVDDGIHELFSEYVALSAPVK---------------  533

Query  558  DAQELSTNELGLTDFDAFIM-ETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                 + +E  L++FD +I+ ET+ +  +SELDQYLEE+LLPRV EFDV+ WWK N++K+
Sbjct  534  -----AASEDELSEFDKYIIKETAGKNLKSELDQYLEETLLPRVQEFDVLEWWKQNKLKF  588

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            PTLSKMARDIL +PVS A  D VF    +EMD Y+ SLRPETVEAL+ A++W
Sbjct  589  PTLSKMARDILAIPVSAAAFDYVFDVEPREMDEYKTSLRPETVEALISAREW  640



>dbj|BAJ88673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 128/175 (73%), Gaps = 8/175 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++V++ +HEL+++Y+A PLP  P Y+ ++  G  NTQ
Sbjct  573  RFKMKLVEFSYSKIYGVEAAKYVKVVNDSLHELYKEYLAQPLPARPVYVGQSASGNNNTQ  632

Query  558  DAQELSTNELGLTDFDAFIMETSSQQ-SRSELDQYLEESLLPR-VHEFDVVGWWKLNRMK  385
                   +  GL DFD ++ E ++ Q S+SEL+QYLEE L PR + EFD++ WWKLN ++
Sbjct  633  TTPPSIGD--GLLDFDMYLSEIATAQPSKSELEQYLEEPLTPRSIQEFDILSWWKLNTLR  690

Query  384  YPTLSKMARDILTVPVSTAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  226
            +PTLSKMARD+L +P++     S+FS  T  + +D YR SLRPE VEALVCAKDW
Sbjct  691  FPTLSKMARDVLAIPMTM--VSSIFSAETGIRTLDDYRSSLRPEIVEALVCAKDW  743



>ref|XP_010520572.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
Length=641

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 126/178 (71%), Gaps = 16/178 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KMKLVEFSFSK++ EDA   ++ VD+ +HELF  Y+ALP PLT  Y E          
Sbjct  461  RYKMKLVEFSFSKLFREDARKNIKAVDDRLHELFNGYLALPQPLTLAYAE----------  510

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPR-VHEFDVVGWWKLNRMKY  382
               E S N  GL DFD +IMET  +  +SELD+YL+E+LLPR V EF+V+ WWK N+++Y
Sbjct  511  --GESSLNPDGLADFDVYIMETMGRNLKSELDRYLDETLLPRHVKEFNVLEWWKHNKLRY  568

Query  381  PTLSKMARDILTVPVSTAPAD--SVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            PTLS MARDIL++P+S A AD  +VF    +EMD Y+  LRPETVEAL+CAKDW Q++
Sbjct  569  PTLSGMARDILSIPMSAA-ADFGNVFDIESREMDAYKTLLRPETVEALICAKDWFQSQ  625



>dbj|BAJ96825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 128/175 (73%), Gaps = 8/175 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKIYG +A+ YV++V++ +HEL+++Y+A PLP  P Y+ ++  G  NTQ
Sbjct  589  RFKMKLVEFSYSKIYGVEAAKYVKVVNDSLHELYKEYLAQPLPARPVYVGQSASGNNNTQ  648

Query  558  DAQELSTNELGLTDFDAFIMETSSQQ-SRSELDQYLEESLLPR-VHEFDVVGWWKLNRMK  385
                   +  GL DFD ++ E ++ Q S+SEL+QYLEE L PR + EFD++ WWKLN ++
Sbjct  649  TTPPSIGD--GLLDFDMYLSEIATAQPSKSELEQYLEEPLTPRSIQEFDILSWWKLNTLR  706

Query  384  YPTLSKMARDILTVPVSTAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  226
            +PTLSKMARD+L +P++     S+FS  T  + +D YR SLRPE VEALVCAKDW
Sbjct  707  FPTLSKMARDVLAIPMTM--VSSIFSAETGIRTLDDYRSSLRPEIVEALVCAKDW  759



>ref|XP_009336302.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Pyrus x bretschneideri]
Length=679

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 126/183 (69%), Gaps = 11/183 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMK VE +FS+IYGE+A T++RIVD GIH+LF +Y+   L L    IEE N G + T+
Sbjct  477  RFKMKHVESTFSEIYGENAETWIRIVDGGIHDLFLEYMMQMLTLPEIPIEEGNDGIMKTE  536

Query  558  DAQELSTNEL------GLTDFDAFIME-TSSQQSRSELDQYLEES---LLPRVHEFDVVG  409
               E+ + E+      GL DFD F+ + T  QQ +SELDQYLEE    L+  V +FDV+G
Sbjct  537  -LPEIPSQEILLSSADGLQDFDFFMPDITGGQQMKSELDQYLEEEEFLLVDGVEDFDVLG  595

Query  408  WWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKD  229
            WW+LNR KYPTLS+MA DIL++PVST   D+VF T  K MD YR SL   T+EAL+CAKD
Sbjct  596  WWRLNRHKYPTLSRMASDILSIPVSTVAPDAVFDTEIKRMDSYRTSLGTATLEALICAKD  655

Query  228  WQQ  220
            W Q
Sbjct  656  WIQ  658



>gb|KHN22430.1| Putative AC transposase [Glycine soja]
Length=543

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 128/179 (72%), Gaps = 6/179 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNT  562
            R+KMKLVE +F+KI+GE+A  ++RIV++G+HELF +Y +   LP T T  +E N   + T
Sbjct  348  RYKMKLVESTFAKIFGENADQWIRIVEDGLHELFLEYNIIQVLPFTATNDDEGNEAMIKT  407

Query  561  QDAQE----LSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKL  397
            +  QE    L   + GL+DF+ +I + T +QQ ++ELD+YLEE L PRV EFD++ WW++
Sbjct  408  EPFQEFDGSLFAADDGLSDFEFYISDFTCNQQFKTELDEYLEEPLEPRVQEFDILSWWRI  467

Query  396  NRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            N +KYPTLS++A DIL +P+ST  AD+VF T  ++MD YR SL   T+EAL+C KDW Q
Sbjct  468  NGLKYPTLSRLASDILCMPISTLSADAVFDTEIRKMDSYRSSLDSLTLEALICTKDWLQ  526



>ref|XP_011457838.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Fragaria vesca subsp. vesca]
Length=735

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 116/174 (67%), Gaps = 29/174 (17%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGED-ASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT  562
            R+KMK VEF+F KIY E+ A T +++VD+ IHELFQ+Y  +PLPL P Y EE        
Sbjct  586  RYKMKYVEFTFKKIYNEEEAQTCIKMVDDRIHELFQEYSTMPLPLAPNYAEE--------  637

Query  561  QDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                           FD +IM    +  +++LDQYL E  + RVHEFDV+ WWKLN+M Y
Sbjct  638  ---------------FDVYIM----KNLKTQLDQYLAEPPI-RVHEFDVLAWWKLNQMMY  677

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLS+MARD+L+ PVST P DSVF T  KEMD+YR SL+ ETVEAL+C KDW Q
Sbjct  678  PTLSQMARDMLSFPVSTVPCDSVFDTNAKEMDQYRSSLQAETVEALICTKDWMQ  731



>ref|XP_002442948.1| hypothetical protein SORBIDRAFT_08g005330 [Sorghum bicolor]
 gb|EES16786.1| hypothetical protein SORBIDRAFT_08g005330 [Sorghum bicolor]
Length=762

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 131/183 (72%), Gaps = 10/183 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYG-EDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV--  568
            RFKMK+VEFS+SKIYG    S YV++VD+ +HEL+++YV  PLP TP ++E+   GA+  
Sbjct  575  RFKMKIVEFSYSKIYGLMKGSKYVKLVDDAVHELYKEYVRQPLPSTPAHVEQEVTGALPD  634

Query  567  --NTQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKL  397
              N       ST  L L+ FD ++ E + SQ S+SELDQYLEE+L+PR+ EFD++ WWK+
Sbjct  635  NKNNIPTDPTSTGNL-LSGFDTYLSEVALSQISKSELDQYLEEALVPRMLEFDILMWWKV  693

Query  396  NRMKYPTLSKMARDILTVPVST-APADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  226
            N ++YPTLS+MA+D+L +PVST     SVF+  T  K +D Y+ SL PET+EAL CAKDW
Sbjct  694  NAVRYPTLSRMAQDVLAIPVSTVGRGSSVFAAGTEAKMLDDYQSSLHPETLEALFCAKDW  753

Query  225  QQN  217
             Q+
Sbjct  754  LQH  756



>gb|KGN52935.1| hypothetical protein Csa_4G006420 [Cucumis sativus]
Length=692

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 122/180 (68%), Gaps = 7/180 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFK+KLVEF FSKI+ ++A  ++RIVD G+H+LF  +    L L+ T+ E+ N G   T+
Sbjct  492  RFKLKLVEFIFSKIFVQNAEEWIRIVDYGLHDLFLQFTMETLTLSETFGEDGNIGISITE  551

Query  558  DAQELSTNEL------GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
               E    E+      GL+DFD +I E S  QQ++SELD+YLEE L P+  EFDV+ WW+
Sbjct  552  LQDEEHQGEIFLTTGDGLSDFDVYISEISEGQQTKSELDRYLEEELSPKSQEFDVLSWWR  611

Query  399  LNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            LN+ +YPTL+KMA DIL++PVST   DSVF T  + MD YR SL   T+EAL+C +DW Q
Sbjct  612  LNKYRYPTLAKMACDILSMPVSTVTRDSVFDTEIRRMDSYRRSLPSATLEALICTRDWLQ  671



>ref|XP_006851229.1| hypothetical protein AMTR_s00180p00017340 [Amborella trichopoda]
 gb|ERN12810.1| hypothetical protein AMTR_s00180p00017340 [Amborella trichopoda]
Length=841

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 130/190 (68%), Gaps = 12/190 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY---VALPLPLTPTYIEEANGGAV  568
            RFKMK VEFSFSK+YG +A  Y R+V E I +L+  Y   +  P+PL  TY    NG   
Sbjct  465  RFKMKFVEFSFSKVYGTNAFMYTRVVIEAIRDLYSQYARNIPGPVPLA-TY----NGDQS  519

Query  567  NTQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
            ++ ++ +++    GL DFD F+ E S SQQ++SELDQYLEE L PR  EFD++ WWK++ 
Sbjct  520  SSNNSFQIND---GLQDFDQFLSELSGSQQTKSELDQYLEEPLFPRNQEFDILRWWKMSA  576

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
             KYP LS+MARDIL + V+T  ++S+F+T  K +D+Y+ SL PET+EAL+CA+DW  +EL
Sbjct  577  PKYPVLSEMARDILAIRVTTVDSESMFNTGGKVLDQYQSSLSPETIEALICARDWLHHEL  636

Query  210  VKSITAPIKM  181
              S+   + M
Sbjct  637  ETSLDTVLNM  646



>gb|KHN44191.1| Putative AC transposase [Glycine soja]
Length=656

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 126/179 (70%), Gaps = 6/179 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNT  562
            R+KMK+VE +F+KI+GE+A  ++RIV++G+ ELF +Y +   LP   T  +E N   + T
Sbjct  461  RYKMKIVESTFAKIFGENADQWIRIVEDGLQELFLEYNIIQVLPFAATNDDEGNEAMIKT  520

Query  561  QDAQELSTNELG----LTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKL  397
            + +QE   +  G    L+DF+ +I + T +QQ ++ELD+YLEE L PRV EFD++ WW++
Sbjct  521  ETSQEFDGSLFGADDGLSDFEFYISDFTCNQQFKTELDEYLEEPLEPRVQEFDILSWWRI  580

Query  396  NRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            N +KYPTLS++A DIL +P+ST  AD+VF T  ++MD YR SL   T+EAL+C KDW Q
Sbjct  581  NGLKYPTLSRLASDILCMPISTLSADAVFDTEIRKMDSYRTSLDSLTLEALICTKDWFQ  639



>gb|EEC79764.1| hypothetical protein OsI_21155 [Oryza sativa Indica Group]
Length=212

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 130/196 (66%), Gaps = 18/196 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKI+  +A+ YV++VD+ IHEL+ +Y             EAN  A  T 
Sbjct  25   RFKMKLVEFSYSKIHSVEAAKYVKVVDDAIHELYSEYATQ---------GEANRDAHVTD  75

Query  558  DAQELST-NELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            ++  ++  N   L DFD ++ E  +SQ S SEL+QYLEE+L+PR+ +F+++ WWKLN +K
Sbjct  76   NSAAVTPPNGDELLDFDIYLSEIATSQPSISELEQYLEEALMPRIQDFEILEWWKLNTIK  135

Query  384  YPTLSKMARDILTVPVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            +PTLSKMARD+L +P+S  +   S+FS   T  + +D YR SLRPETVE+L CAKDW Q 
Sbjct  136  FPTLSKMARDVLAIPMSMVSSGSSIFSATATGSQMLDDYRSSLRPETVESLFCAKDWLQY  195

Query  216  ELVKS---ITAPIKME  178
                +    TA +KME
Sbjct  196  PPATTEAPSTALVKME  211



>ref|XP_011467072.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Fragaria vesca subsp. vesca]
Length=673

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 122/177 (69%), Gaps = 6/177 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+K + V+F+FSKIYG++A T+V++VD+G+HELF +Y+   L L  T +EE N   + + 
Sbjct  472  RYKKQFVDFTFSKIYGDNAETWVKLVDDGLHELFMEYMMQMLSLPGTLMEEGNEDIIKSD  531

Query  558  DAQELSTNEL----GLTDFDAFIME-TSSQQSRSELDQYLEESLL-PRVHEFDVVGWWKL  397
              +    +      G+++FD ++ + T  QQ +SEL+QYLEE +L PR  +FD++GWWK 
Sbjct  532  PPEAAEASHEEATDGISEFDIYLSDVTGGQQMKSELEQYLEEIILAPRGQDFDILGWWKE  591

Query  396  NRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
               KYPTLSKMA D+L++PVST  ADSVF+T  K MD YR SL    +EAL+CAKDW
Sbjct  592  KSTKYPTLSKMASDVLSIPVSTVAADSVFNTEIKRMDSYRTSLGASNLEALICAKDW  648



>ref|XP_007150768.1| hypothetical protein PHAVU_005G179200g [Phaseolus vulgaris]
 gb|ESW22762.1| hypothetical protein PHAVU_005G179200g [Phaseolus vulgaris]
Length=657

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 128/191 (67%), Gaps = 9/191 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALP-LPLTPTYIEEANGGAVNT  562
            R+KMK VE +F KI+GE+A  ++R+V++G++ELF DY  +  LP T     E +   + T
Sbjct  460  RYKMKFVESTFGKIFGENAEYWIRVVEDGLNELFLDYNIIEVLPFTARSDNEGDETMIKT  519

Query  561  QDAQE------LSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWW  403
            +   E      L   + GL+D + +I + T +QQ +SELD+YLEE L  RV EFDV+ WW
Sbjct  520  ESFDEAGFDGSLFAADDGLSDIEFYISDLTCNQQFKSELDEYLEEPLESRVQEFDVLSWW  579

Query  402  KLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQ  223
            ++NR+KYPTLS++A DIL VPVST  AD+VF T  ++MD YR SL   T+EAL+C+KDW 
Sbjct  580  RINRLKYPTLSRLASDILCVPVSTLSADAVFDTQIRKMDNYRSSLDSLTLEALICSKDWF  639

Query  222  QNELVKSITAP  190
            Q + +  IT P
Sbjct  640  QYKSL-PITVP  649



>ref|NP_001056445.1| Os05g0583200 [Oryza sativa Japonica Group]
 sp|Q75HY5.1|RSLE3_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
3; AltName: Full=Transposase-like protein RICESLEEPER 
3 [Oryza sativa Japonica Group]
 gb|AAS16892.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF18359.1| Os05g0583200 [Oryza sativa Japonica Group]
 dbj|BAG95453.1| unnamed protein product [Oryza sativa Japonica Group]
Length=752

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 121/178 (68%), Gaps = 13/178 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKI+  +A+ YV++VD+ IHEL+ +Y          ++ + N  AV   
Sbjct  565  RFKMKLVEFSYSKIHSVEAAKYVKVVDDAIHELYSEYATQGEANRDAHVTD-NSAAVTPP  623

Query  558  DAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +  EL        DFD ++ E  +SQ S SEL+QYLEE+L+PR+ +F+++ WWKLN +K+
Sbjct  624  NGDEL-------LDFDIYLSEIATSQPSISELEQYLEEALMPRIQDFEILEWWKLNTIKF  676

Query  381  PTLSKMARDILTVPVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARD+L +P+S  +   S+FS   T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  677  PTLSKMARDVLAIPMSMVSSGSSIFSATATGSQMLDDYRSSLRPETVEALFCAKDWLQ  734



>gb|EEE64837.1| hypothetical protein OsJ_19694 [Oryza sativa Japonica Group]
Length=879

 Score =   168 bits (426),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 121/178 (68%), Gaps = 13/178 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFS+SKI+  +A+ YV++VD+ IHEL+ +Y          ++ + N  AV   
Sbjct  692  RFKMKLVEFSYSKIHSVEAAKYVKVVDDAIHELYSEYATQGEANRDAHVTD-NSAAVTPP  750

Query  558  DAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +  EL        DFD ++ E  +SQ S SEL+QYLEE+L+PR+ +F+++ WWKLN +K+
Sbjct  751  NGDEL-------LDFDIYLSEIATSQPSISELEQYLEEALMPRIQDFEILEWWKLNTIKF  803

Query  381  PTLSKMARDILTVPVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTLSKMARD+L +P+S  +   S+FS   T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  804  PTLSKMARDVLAIPMSMVSSGSSIFSATATGSQMLDDYRSSLRPETVEALFCAKDWLQ  861



>emb|CDX89026.1| BnaA04g01600D [Brassica napus]
Length=628

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 113/171 (66%), Gaps = 9/171 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY       +    E+    A++  
Sbjct  452  RFKMKLIEFSFSKAYGEDAEKWIRSVDDAVHELYHDYAEQRD--SNLLNEKPRDHALDGH  509

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  379
            ++QE +       + D   +  S +Q +SELDQYLEESL+PR  +F+V+GWW LNR KYP
Sbjct  510  ESQEAA-------ETDQTQLVGSREQMKSELDQYLEESLIPRSPDFEVLGWWSLNRTKYP  562

Query  378  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            TLSKMA D+L++P  T   DSVF T  K+MD YR SL   T+EAL CAKDW
Sbjct  563  TLSKMAADVLSLPFCTVSPDSVFDTDVKKMDNYRSSLGHVTLEALFCAKDW  613



>emb|CDY00623.1| BnaC04g23020D [Brassica napus]
Length=1270

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 112/177 (63%), Gaps = 21/177 (12%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY            E+ +   +N +
Sbjct  549  RFKMKLIEFSFSKAYGEDAEKWIRSVDDAVHELYHDYA-----------EQRDSNLLNEK  597

Query  558  ------DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKL  397
                  D  E  + E   TD    +   S +Q +SELDQYLEESL+PR  +F+V+GWW L
Sbjct  598  PRDHALDGHE--SQEAAQTDRTQLV--GSREQMKSELDQYLEESLIPRSPDFEVLGWWSL  653

Query  396  NRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            NR KYPTLSKMA D+L++P  T   DSVF T  K+MD YR SL   T+EAL CAKDW
Sbjct  654  NRTKYPTLSKMAADVLSLPFCTVSPDSVFDTDVKKMDNYRSSLGHVTLEALFCAKDW  710



>gb|KHN01319.1| Putative AC transposase, partial [Glycine soja]
Length=647

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 123/183 (67%), Gaps = 19/183 (10%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANG------  577
            R KMKLVEF+F+KI+GE+A  +++IV++G+ ELF +Y ++ + LT T  +E +       
Sbjct  472  RHKMKLVEFTFAKIFGENAEEWIKIVEDGLRELFIEY-SMQMFLTTTNGDEGDDIMIKKT  530

Query  576  ---GAVNTQ---DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDV  415
               G+++     D  E S  E  ++DF      T + Q +SELD+YLEE LL RV EFD+
Sbjct  531  FLEGSIDCSLFVDGDEFSDYEFYISDF------TGNPQFKSELDEYLEEPLLTRVEEFDI  584

Query  414  VGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCA  235
            + WW++N +KYPTLS++A DIL++PVST  ADS+F    ++MD YR SL   T+EAL+CA
Sbjct  585  LSWWRVNGLKYPTLSRIASDILSLPVSTLSADSIFDMQIRKMDSYRSSLSSLTLEALICA  644

Query  234  KDW  226
            KDW
Sbjct  645  KDW  647



>ref|XP_006369306.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 ref|XP_006369307.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65875.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65876.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
Length=1024

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = -3

Query  570   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  887   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  945

Query  393   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
             R+KYPTLSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  946   RLKYPTLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1004


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSD  544

Query  558  DAQEL  544
              QE+
Sbjct  545  TLQEV  549



>ref|XP_011044854.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Populus euphratica]
Length=843

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
            ++TQD   LS  + GL+DFD +I E T  Q  +SELDQYLEESLLPRVHEFDV+GWWKLN
Sbjct  716  LHTQDLPMLSIGD-GLSDFDIYISEITCGQHFKSELDQYLEESLLPRVHEFDVLGWWKLN  774

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            R+KYPTLSKMA DIL++PVST   DSVF T ++ +D YR SLRP T+EAL+CAKDW Q+
Sbjct  775  RLKYPTLSKMAVDILSIPVSTVTPDSVFDTENRRIDSYRSSLRPVTLEALICAKDWLQH  833


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHEL   Y+     L  T +EE       + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELLVGYLTPNFHLPATDVEEGLVSIPQSD  544

Query  558  DAQEL  544
            + QE+
Sbjct  545  NLQEI  549



>gb|EYU24629.1| hypothetical protein MIMGU_mgv1a023531mg [Erythranthe guttata]
Length=691

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 116/179 (65%), Gaps = 12/179 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R KM  V F+ ++IYGEDA T+V+IV++ +HELF  YV +   L P + EE    A++  
Sbjct  495  RMKMDYVAFNSTRIYGEDAGTWVKIVNDSLHELFLQYV-MHSHLGPAFAEEE---AIDPL  550

Query  558  DAQELSTNELGL-TDFDAFIMET-------SSQQSRSELDQYLEESLLPRVHEFDVVGWW  403
               E+   E  L +  D  I              ++ E+DQYLEES+LPRV EFDV+GWW
Sbjct  551  VKMEMPCQEDALLSSVDGLIDFDIDISDIMGESHTKLEIDQYLEESILPRVQEFDVLGWW  610

Query  402  KLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            ++N  +YPTLS+MA D+L++P+ST P +SVF T  +++D YR SLRP T++AL CAKDW
Sbjct  611  RVNTYRYPTLSRMAFDVLSIPMSTTPTESVFDTRERKVDDYRSSLRPSTLDALFCAKDW  669



>ref|XP_011044853.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Populus euphratica]
Length=851

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
            ++TQD   LS  + GL+DFD +I E T  Q  +SELDQYLEESLLPRVHEFDV+GWWKLN
Sbjct  724  LHTQDLPMLSIGD-GLSDFDIYISEITCGQHFKSELDQYLEESLLPRVHEFDVLGWWKLN  782

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            R+KYPTLSKMA DIL++PVST   DSVF T ++ +D YR SLRP T+EAL+CAKDW Q+
Sbjct  783  RLKYPTLSKMAVDILSIPVSTVTPDSVFDTENRRIDSYRSSLRPVTLEALICAKDWLQH  841


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHEL   Y+     L  T +EE       + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELLVGYLTPNFHLPATDVEEGLVSIPQSD  544

Query  558  DAQEL  544
            + QE+
Sbjct  545  NLQEI  549



>ref|XP_006857388.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda]
 gb|ERN18855.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda]
Length=685

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFK+K VE+S+S+IYG DA  ++R+V +G+++L  +Y +   PL     E +   + +T 
Sbjct  500  RFKLKFVEYSYSQIYGNDAEHHIRMVRQGVYDLCNEYESKE-PLASNS-ESSLAVSASTS  557

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                 +  +L   +F+ F+ E+SS Q+R SELD+YLEE + PR  +F++  WW+LN  ++
Sbjct  558  SGGVDTHGKLWAMEFEKFVRESSSNQARKSELDRYLEEPIFPRNLDFNIRNWWQLNAPRF  617

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            PTLSKMARDIL +PVST  +DS F    + +D+YR SL PET++AL+CA+DW  NEL
Sbjct  618  PTLSKMARDILGIPVSTVTSDSTFDIGGQVLDQYRSSLLPETIQALMCAQDWLWNEL  674



>ref|XP_011044850.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011044851.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011044852.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
Length=886

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
            ++TQD   LS  + GL+DFD +I E T  Q  +SELDQYLEESLLPRVHEFDV+GWWKLN
Sbjct  759  LHTQDLPMLSIGD-GLSDFDIYISEITCGQHFKSELDQYLEESLLPRVHEFDVLGWWKLN  817

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            R+KYPTLSKMA DIL++PVST   DSVF T ++ +D YR SLRP T+EAL+CAKDW Q+
Sbjct  818  RLKYPTLSKMAVDILSIPVSTVTPDSVFDTENRRIDSYRSSLRPVTLEALICAKDWLQH  876


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHEL   Y+     L  T +EE       + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELLVGYLTPNFHLPATDVEEGLVSIPQSD  544

Query  558  DAQEL  544
            + QE+
Sbjct  545  NLQEI  549



>ref|XP_006369308.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65877.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
Length=1099

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = -3

Query  570   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  962   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  1020

Query  393   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
             R+KYPTLSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  1021  RLKYPTLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1079


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSD  544

Query  558  DAQEL  544
              QE+
Sbjct  545  TLQEV  549



>ref|XP_011007707.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X5 [Populus euphratica]
Length=920

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
            ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  783  LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  841

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  842  RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  900


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSD  544

Query  558  DAQEL  544
              QE+
Sbjct  545  TLQEV  549



>ref|XP_011007708.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X6 [Populus euphratica]
Length=902

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
            ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  765  LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  823

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  824  RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  882


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSD  544

Query  558  DAQEL  544
              QE+
Sbjct  545  TLQEV  549



>ref|XP_011007706.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X4 [Populus euphratica]
Length=1017

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
            ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  880  LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  938

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
            R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  939  RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  997


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSD  544

Query  558  DAQEL  544
              QE+
Sbjct  545  TLQEV  549



>ref|XP_011007705.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Populus euphratica]
Length=1024

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  887   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  945

Query  393   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
             R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  946   RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1004


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSD  544

Query  558  DAQEL  544
              QE+
Sbjct  545  TLQEV  549



>ref|XP_011007704.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Populus euphratica]
Length=1027

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  890   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  948

Query  393   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
             R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  949   RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1007


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSD  544

Query  558  DAQEL  544
              QE+
Sbjct  545  TLQEV  549



>ref|XP_011007700.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007701.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007702.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007703.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
Length=1042

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  570   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  905   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  963

Query  393   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  217
             R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  964   RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1022


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSF K++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     + 
Sbjct  485  RFKMKLLEFSFPKVFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSD  544

Query  558  DAQEL  544
              QE+
Sbjct  545  TLQEV  549



>gb|KJB66355.1| hypothetical protein B456_010G137500 [Gossypium raimondii]
Length=746

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = -3

Query  528  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
            GL+DF+ +I E S S Q +SELDQYLEESLLPRV +FD++GWWKLN+ KYPTLS+MA DI
Sbjct  627  GLSDFEVYISEISGSHQMKSELDQYLEESLLPRVQDFDILGWWKLNKTKYPTLSRMASDI  686

Query  351  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW-QQNELVKSITAPIKME  178
            L++P ST   DSVF T  K+MD Y  SLRP T+EAL+CAKDW Q   L +S    +KME
Sbjct  687  LSMPFSTVGPDSVFDTERKKMDNYHSSLRPVTLEALICAKDWLQYGGLSQSCDGNVKME  745


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEFSFS+IYG+DA  +++IVD+GIHEL+ +Y+A  LP   T++EE NG  +  Q
Sbjct  481  RFKMKLVEFSFSRIYGDDAGMWIKIVDDGIHELYLEYIAQALPPPETFVEERNGSIIPEQ  540

Query  558  DA  553
            + 
Sbjct  541  NG  542



>ref|XP_007023276.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
 gb|EOY25898.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
Length=764

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = -3

Query  528  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
            GL+DF+ +I E S SQQ +SELDQYLEESLLPRV +FD++GWWKLN+ KYPTLS+MA DI
Sbjct  648  GLSDFEVYISEISGSQQMKSELDQYLEESLLPRVQDFDILGWWKLNKTKYPTLSRMAADI  707

Query  351  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            L++P ST   DSVF T  K MD YR SLRP T+EAL+CAKDW Q
Sbjct  708  LSIPFSTVGPDSVFDTERKRMDNYRSSLRPVTLEALICAKDWLQ  751


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGG  574
            RFKMKLVEFSFS+IYGEDA  +++IVD+GIHEL+ +Y+A  LP   T++EE NGG
Sbjct  487  RFKMKLVEFSFSRIYGEDAGMWIKIVDDGIHELYLEYIAQALPPPETFMEEGNGG  541



>ref|XP_009596751.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
3-like [Nicotiana tomentosiformis]
 ref|XP_009596752.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
3-like [Nicotiana tomentosiformis]
Length=226

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 113/191 (59%), Gaps = 11/191 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVA-LPLPLTPTYIEEANGGAVNT  562
            R+KM+LVEF    IYGE+AST ++ V    ++LFQDY + L  P         +  A ++
Sbjct  28   RYKMRLVEFFLPLIYGEEASTKIQEVRSNCYDLFQDYKSKLSAP--------HDSLASSS  79

Query  561  QDAQELSTNELGLTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
             +    +  +  L+ FD F+  T +  + RSELD YLEE LLPR   FD + WWK N  K
Sbjct  80   SEVTSFTQGD-RLSSFDRFVASTGATVEKRSELDMYLEEDLLPRTPSFDNLSWWKTNGWK  138

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            +PTL KMARD+L +PVST  ++S FST  + +  +R  L P T+EAL+CA+ W  N+L+ 
Sbjct  139  FPTLQKMARDLLAIPVSTVASESAFSTSGRLISPHRSRLHPTTLEALMCARTWLWNDLIG  198

Query  204  SITAPIKMEVP  172
              +   K+  P
Sbjct  199  LTSTIDKVSCP  209



>gb|EPS64824.1| hypothetical protein M569_09955 [Genlisea aurea]
Length=692

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 120/192 (63%), Gaps = 6/192 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEF+F +I+G+D+S +++ V EG+HEL  +YV   LPLT    E ++     T+
Sbjct  490  RFKMKLVEFNFQRIFGDDSSLWIKAVSEGLHELSVEYVVQSLPLTFIQKEGSDPPHPKTE  549

Query  558  DAQELSTNELGLTD-FDAFIMETSSQQS--RSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
            D  E    E       D ++ +   + +    ELD YLE+ +LPR+ +FDV+GWWK    
Sbjct  550  DDGEDEEEEEEEFGGIDVYVSDIPVEHNFKTEELDHYLEDGVLPRIQDFDVLGWWKGKAS  609

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTV--HKEMDRYRCSLRPETVEALVCAKDW-QQN  217
            +YPTLSK+A D+L++PVST   +SVF T    +++D YR  L   TV+ALVCAKDW  QN
Sbjct  610  RYPTLSKLAVDVLSIPVSTVFGESVFDTGRRRRQLDAYRSGLGASTVQALVCAKDWLLQN  669

Query  216  ELVKSITAPIKM  181
            +  ++   P ++
Sbjct  670  DGDRTSDVPYRI  681



>gb|EEC70768.1| hypothetical protein OsI_02196 [Oryza sativa Indica Group]
Length=392

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 123/189 (65%), Gaps = 16/189 (8%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYG-EDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEE--ANG-  577
            RFKMK+VEF++SKIYG  DA+ YV++VD+ I +L+++Y A P  LPL+P Y+++  A+G 
Sbjct  201  RFKMKMVEFAYSKIYGPTDAAKYVKLVDDAILDLYKEYAAQPELLPLSPIYVDQVPADGL  260

Query  576  -----GAVNTQDAQELSTNELGLTDFDAFIME--TSSQQSRSELDQYLEESLLPRVHEFD  418
                 G      +   +    GL DFD ++ E  T  Q  + EL+ YLEE+L  R  +FD
Sbjct  261  PFIETGGAPATASPSTAAAGAGLVDFDMYLSEVTTMGQPFKHELELYLEEALTQRTPDFD  320

Query  417  VVGWWKLNRMKYPTLSKMARDILTVPVST-APADSVF--STVHKEMDRYRCSLRPETVEA  247
            V+ WW+ N +KYPTLS+MARD+L +P+ST     SVF      + +D YR SLRPE VEA
Sbjct  321  VLKWWQDNTLKYPTLSRMARDVLAIPMSTVGVGSSVFLPDNGSRSLDDYRSSLRPELVEA  380

Query  246  LVCAKDWQQ  220
            L+CAKDW Q
Sbjct  381  LLCAKDWLQ  389



>sp|Q0JMB2.3|RSLE4_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
4; AltName: Full=Transposase-like protein RICESLEEPER 
4 [Oryza sativa Japonica Group]
 gb|EAZ12126.1| hypothetical protein OsJ_02008 [Oryza sativa Japonica Group]
Length=684

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 123/189 (65%), Gaps = 16/189 (8%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYG-EDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEE--ANG-  577
            RFKMK+VEF++SKIYG  DA+ YV++VD+ I +L+++Y A P  LPL+P Y+++  A+G 
Sbjct  493  RFKMKMVEFAYSKIYGPTDAAKYVKLVDDAILDLYKEYAAQPELLPLSPIYVDQVPADGL  552

Query  576  -----GAVNTQDAQELSTNELGLTDFDAFIME--TSSQQSRSELDQYLEESLLPRVHEFD  418
                 G      +   +    GL DFD ++ E  T  Q  + EL+ YLEE+L  R  +FD
Sbjct  553  PFIETGGAPATASPSTAAAGAGLVDFDMYLSEVTTMGQPFKHELELYLEEALTQRTPDFD  612

Query  417  VVGWWKLNRMKYPTLSKMARDILTVPVST-APADSVF--STVHKEMDRYRCSLRPETVEA  247
            V+ WW+ N +KYPTLS+MARD+L +P+ST     SVF      + +D YR SLRPE VEA
Sbjct  613  VLKWWQDNTLKYPTLSRMARDVLAIPMSTVGVGSSVFLPDNGSRSLDDYRSSLRPELVEA  672

Query  246  LVCAKDWQQ  220
            L+CAKDW Q
Sbjct  673  LLCAKDWLQ  681



>ref|NP_001043202.2| Os01g0518400 [Oryza sativa Japonica Group]
 dbj|BAF05116.2| Os01g0518400, partial [Oryza sativa Japonica Group]
Length=688

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 123/189 (65%), Gaps = 16/189 (8%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYG-EDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEE--ANG-  577
            RFKMK+VEF++SKIYG  DA+ YV++VD+ I +L+++Y A P  LPL+P Y+++  A+G 
Sbjct  497  RFKMKMVEFAYSKIYGPTDAAKYVKLVDDAILDLYKEYAAQPELLPLSPIYVDQVPADGL  556

Query  576  -----GAVNTQDAQELSTNELGLTDFDAFIME--TSSQQSRSELDQYLEESLLPRVHEFD  418
                 G      +   +    GL DFD ++ E  T  Q  + EL+ YLEE+L  R  +FD
Sbjct  557  PFIETGGAPATASPSTAAAGAGLVDFDMYLSEVTTMGQPFKHELELYLEEALTQRTPDFD  616

Query  417  VVGWWKLNRMKYPTLSKMARDILTVPVST-APADSVF--STVHKEMDRYRCSLRPETVEA  247
            V+ WW+ N +KYPTLS+MARD+L +P+ST     SVF      + +D YR SLRPE VEA
Sbjct  617  VLKWWQDNTLKYPTLSRMARDVLAIPMSTVGVGSSVFLPDNGSRSLDDYRSSLRPELVEA  676

Query  246  LVCAKDWQQ  220
            L+CAKDW Q
Sbjct  677  LLCAKDWLQ  685



>ref|XP_009800989.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=667

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 115/177 (65%), Gaps = 12/177 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KMKLVE+ + +IYG+ A   + IV + +  L+  + A+  PL P      NG A    
Sbjct  483  RYKMKLVEYYYPQIYGDSAPDCINIVSDCMKALYNGH-AIYSPLAP------NGQA----  531

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +A ++  N   LT +D FI ETS S   +S+LD+YLEE L PR  +F ++ WWK++  +Y
Sbjct  532  EASQVGGNNDRLTGYDKFIYETSQSNNIKSDLDKYLEEPLFPRKADFSILNWWKVHTPRY  591

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS MAR+IL +P+S A  + VF+T +K +++YR SLR +T++AL+CA+DW ++E 
Sbjct  592  PILSMMARNILGMPMSKASLEFVFNTGNKALEQYRSSLRSDTLQALMCAQDWMRDEF  648



>ref|XP_010649234.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Vitis vinifera]
Length=219

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 113/178 (63%), Gaps = 6/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KMK++EF F  +YG +AS+ +  + +  ++L   Y +     +    + ++ GA +  
Sbjct  29   RYKMKILEFYFPIMYGSEASSEIGKIRQLCYDLLSKYQSK----SKMGQQTSSHGASSVS  84

Query  558  DAQELSTNELG-LTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            +  EL+ +E   L+ FD F+  TS +  ++SELD YLEE++LPR+ +FDV+ WWK N +K
Sbjct  85   NLFELTYDEQDPLSKFDLFVHSTSEEGHAKSELDYYLEETVLPRILDFDVLSWWKTNGIK  144

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YPTL  + RDI  +PVST  ++S FST  + + ++R  L P T+EAL+CA+ W  NE+
Sbjct  145  YPTLQMIVRDIYAIPVSTVASESAFSTGGRMVSKHRSRLHPNTLEALMCAQSWLGNEM  202



>ref|XP_009624222.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
 ref|XP_009624230.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
 ref|XP_009624235.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
Length=670

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 114/179 (64%), Gaps = 13/179 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN--GGAVN  565
            R+KMKLVE+ + +IYG+ A   + IV + +  L+  + A+  PL P    EA+  GGA  
Sbjct  483  RYKMKLVEYYYPQIYGDSAPDCINIVSDCMKALYNGH-AIYSPLAPNGQAEASQVGGAGA  541

Query  564  TQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
              D          LT +D FI ETS S   +S+LD+YLEE L PR  +F ++ WWK++  
Sbjct  542  NNDR---------LTGYDKFIYETSQSNNIKSDLDKYLEEPLFPRKADFSILNWWKVHTP  592

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            +YP LS MAR+IL +P+S A  + VF+T +K +++YR SLR +T++AL+CA+DW ++E 
Sbjct  593  RYPILSMMARNILGMPMSKASLEFVFNTGNKALEQYRSSLRSDTLQALMCAQDWMRDEF  651



>emb|CAN60218.1| hypothetical protein VITISV_006612 [Vitis vinifera]
Length=667

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 106/177 (60%), Gaps = 7/177 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IYG DA+  ++ V +GI ELF  Y +    L        +     + 
Sbjct  483  RFKMKLVEYYYPQIYGNDAADRIKDVSDGIKELFNVYCSTSASLHQGVALPGSSLPSTSN  542

Query  558  DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            D+++       L  FD FI ETS  Q+  S+LD+YLEE + PR  +F ++ WWK+ + +Y
Sbjct  543  DSRD------RLKGFDKFIHETSQNQNIVSDLDKYLEEPVFPRNCDFHILNWWKVQKPRY  596

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS M RD+L +P+ST   + VFST  + +D YR SL P+T +AL+C +DW Q  L
Sbjct  597  PILSMMVRDVLGIPMSTVAPEVVFSTGARVLDHYRSSLNPDTRQALICTQDWLQTGL  653



>ref|XP_010656943.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X2 [Vitis vinifera]
Length=687

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 107/178 (60%), Gaps = 5/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNT  562
            RFKMKLVE+ +SKIYG +A+ ++  +   I  LF ++ +  PL      +    GG+   
Sbjct  484  RFKMKLVEYYYSKIYGSNATVHIDDISVSIKALFNEHAICSPLASLDQGLAWQVGGSGRL  543

Query  561  QDAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                      LG   FD F+ ETS  QS +S+LD+YLEE L PR  +F ++ WWK++  K
Sbjct  544  SAGNYSRDRLLG---FDKFLHETSQSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPK  600

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YP LS MAR++L +P+S    DS F+   + +D  R SL P TV+ALVCA+DW +NEL
Sbjct  601  YPILSMMARNVLGIPMSKVALDSAFNMEGRVLDHDRSSLSPATVQALVCAQDWMRNEL  658



>gb|KHN26291.1| Putative AC transposase [Glycine soja]
Length=671

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 111/191 (58%), Gaps = 8/191 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S IYG  A   ++ V +GI ELF  Y      +  T I++  G A+   
Sbjct  485  RFKMKLVEYYYSLIYGSTALERIKEVSDGIKELFNAY-----SICSTMIDQ--GSALPGS  537

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                   +   L  FD F+ ETS  QS  S+LD+YLEE + PR  +F+++ WWK++  +Y
Sbjct  538  SLPSTCGSRDRLKGFDRFLHETSQSQSIISDLDKYLEEPIFPRNSDFNILNWWKVHMPRY  597

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            P LS MARD+L  P+ST   +  FST  + +D  R SL P+T EAL+C +DW QNE    
Sbjct  598  PILSMMARDVLGTPMSTLAPELAFSTGGRVLDSSRSSLNPDTREALICTQDWLQNESGNL  657

Query  201  ITAPIKMEVPI  169
              +PI   +P+
Sbjct  658  NPSPIHSALPL  668



>ref|XP_010644074.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 ref|XP_010644075.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 ref|XP_010644076.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 emb|CBI20108.3| unnamed protein product [Vitis vinifera]
Length=677

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 106/177 (60%), Gaps = 7/177 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IYG DA+  ++ V +GI ELF  Y +    L        +     + 
Sbjct  483  RFKMKLVEYYYPQIYGTDAADRIKDVSDGIKELFNVYCSTSASLHQGVALPGSSLPSTSN  542

Query  558  DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            D+++       L  FD FI ETS  Q+  S+LD+YLEE + PR  +F ++ WWK+ + +Y
Sbjct  543  DSRD------RLKGFDKFIHETSQNQNIVSDLDKYLEEPVFPRNCDFHILNWWKVQKPRY  596

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS M RD+L +P+ST   + VFST  + +D YR SL P+T +AL+C +DW Q  L
Sbjct  597  PILSMMVRDVLGIPMSTVAPEVVFSTGARVLDHYRSSLNPDTRQALICTQDWLQTGL  653



>ref|XP_010656944.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X3 [Vitis vinifera]
Length=685

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 107/178 (60%), Gaps = 5/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNT  562
            RFKMKLVE+ +SKIYG +A+ ++  +   I  LF ++ +  PL      +    GG+   
Sbjct  484  RFKMKLVEYYYSKIYGSNATVHIDDISVSIKALFNEHAICSPLASLDQGLAWQVGGSGRL  543

Query  561  QDAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                      LG   FD F+ ETS  QS +S+LD+YLEE L PR  +F ++ WWK++  K
Sbjct  544  SAGNYSRDRLLG---FDKFLHETSQSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPK  600

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YP LS MAR++L +P+S    DS F+   + +D  R SL P TV+ALVCA+DW +NEL
Sbjct  601  YPILSMMARNVLGIPMSKVALDSAFNMEGRVLDHDRSSLSPATVQALVCAQDWMRNEL  658



>ref|XP_010656941.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Vitis vinifera]
 ref|XP_010656942.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Vitis vinifera]
Length=690

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 107/178 (60%), Gaps = 5/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNT  562
            RFKMKLVE+ +SKIYG +A+ ++  +   I  LF ++ +  PL      +    GG+   
Sbjct  484  RFKMKLVEYYYSKIYGSNATVHIDDISVSIKALFNEHAICSPLASLDQGLAWQVGGSGRL  543

Query  561  QDAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                      LG   FD F+ ETS  QS +S+LD+YLEE L PR  +F ++ WWK++  K
Sbjct  544  SAGNYSRDRLLG---FDKFLHETSQSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPK  600

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YP LS MAR++L +P+S    DS F+   + +D  R SL P TV+ALVCA+DW +NEL
Sbjct  601  YPILSMMARNVLGIPMSKVALDSAFNMEGRVLDHDRSSLSPATVQALVCAQDWMRNEL  658



>ref|XP_010327097.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Solanum lycopersicum]
Length=669

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 113/177 (64%), Gaps = 11/177 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKM+LV++ + +IYG+ A   + IV + +  L+  + A+  PL P      NG A   +
Sbjct  484  RFKMQLVKYYYPQIYGDSAPDCINIVSDCMKALYNGH-AIYSPLAP------NGQA---E  533

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +Q    N   LT FD FI ETS S   +S+LD YLEE L PR  +F+++ WWK++  +Y
Sbjct  534  ASQVGGVNNDRLTGFDKFIYETSVSNNIKSDLDNYLEEKLFPRKDDFNILNWWKVHTPRY  593

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS MAR+IL +P+S A  + VF+T +K ++ YR SLR +T++AL+CA+DW ++E 
Sbjct  594  PILSMMARNILGMPMSKASLEYVFNTGNKALEPYRSSLRSDTLQALMCAQDWMRDEF  650



>ref|XP_010521534.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
 ref|XP_010521535.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
Length=1202

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -3

Query  528   GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
             G +DF+ +I + SS QQ +SELDQYLEESL+PR  +FDV+GWWKLNR KYPTLSKMA D+
Sbjct  1085  GFSDFELYISDISSHQQMKSELDQYLEESLMPRSQDFDVLGWWKLNRTKYPTLSKMAADV  1144

Query  351   LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  178
             L+VP  T   DSVF T  K+MD YR SLR  T+EAL+CAKDW ++    S  + +K E
Sbjct  1145  LSVPFCTVAPDSVFDTKMKKMDCYRSSLRSVTLEALICAKDWFKHGSSPSNDSSVKRE  1202


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK+YGEDA  +++ VD+ +H+L+ DY A   PL   Y+   N     ++
Sbjct  516  RFKMKLIEFSFSKMYGEDAGKWIKTVDDAVHDLYHDYAAQNFPLLDAYVGHGNHDVPGSE  575

Query  558  DAQEL  544
             +QE+
Sbjct  576  MSQEV  580



>ref|XP_007135765.1| hypothetical protein PHAVU_010G156900g [Phaseolus vulgaris]
 gb|ESW07759.1| hypothetical protein PHAVU_010G156900g [Phaseolus vulgaris]
Length=658

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 126/187 (67%), Gaps = 19/187 (10%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANG------  577
            R KMKLVEF+F+K +GE+A+ +++IV++G+ +LF +Y +  + LT T  ++ +       
Sbjct  479  RHKMKLVEFTFAKTFGENAAAWIKIVEDGLRDLFIEY-STQMFLTATNDDDGDDIMIKET  537

Query  576  ---GAVNTQ---DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDV  415
               G+++     D  ELS  E  ++DF      T + Q +SEL++YLEE LL R  EFD+
Sbjct  538  YQEGSIDCSLFVDGDELSDYEFYISDF------TGNPQFKSELEEYLEEPLLSRAEEFDI  591

Query  414  VGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCA  235
            + WW++N +KYPTLS++A DIL++PVST  ADSVF T  +++D YR SL   T+EAL+CA
Sbjct  592  LSWWRVNGLKYPTLSRIASDILSLPVSTLSADSVFDTQIRKIDSYRSSLSSLTLEALICA  651

Query  234  KDWQQNE  214
            KDW Q+E
Sbjct  652  KDWFQSE  658



>ref|XP_010273438.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273439.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273440.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273441.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
Length=678

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 118/195 (61%), Gaps = 9/195 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV-NT  562
            RFKMKLVE+ + +IYG  A   +++V + + EL+ +Y       T   +++  G  V N 
Sbjct  469  RFKMKLVEYYYPQIYGSSAPERIKVVSDSVKELYNEYAICS---TLASLDQGLGWEVRNN  525

Query  561  QDAQELSTNELG---LTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
                  S   +    L+ FD F+ ET+ SQ+S+S+LD+YLEE + PR  +F+++ WWK++
Sbjct  526  SGFSGTSVPNVSNDRLSGFDKFLNETTNSQRSKSDLDKYLEEPVFPRNVDFNILNWWKVH  585

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
              +YP LS MARD+L VP++T P  S F+   + +D YR SL P+T++AL+C +DW + E
Sbjct  586  MPRYPILSMMARDVLGVPMATVPLGSTFNAGDRVLDPYRSSLNPDTLQALICTQDWLRTE  645

Query  213  LVKSITAPIKMEVPI  169
             V+   +     +P+
Sbjct  646  -VQDCRSSSNHSIPV  659



>gb|KDP34464.1| hypothetical protein JCGZ_11935 [Jatropha curcas]
Length=672

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 109/176 (62%), Gaps = 7/176 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +GI ELF  Y      +  T +++ +    N+ 
Sbjct  486  RFKMKLVEYYYSQIYGSTALDRIKEVSDGIKELFNAY-----SICSTLVDQGSALPGNSL  540

Query  558  DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +    + +  L  FD F+ E S  QS  S+LD+YLEE + PR  +F+++ WWK++  +Y
Sbjct  541  PSTSSDSRD-RLKGFDKFLHENSQSQSVASDLDKYLEEPVFPRNCDFNILNWWKVHTPRY  599

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            P LS MARD+L  P+ST   +S FST  + +D +R SL P+T +AL+CA+DW + E
Sbjct  600  PILSMMARDVLGTPMSTISPESAFSTGGRVLDSHRSSLNPDTRQALICARDWLRGE  655



>ref|XP_011468523.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Fragaria vesca subsp. vesca]
Length=310

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 110/182 (60%), Gaps = 7/182 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKM+L+E+ F K++G +A  Y+  V   + +LF +Y       +     E+N     + 
Sbjct  127  RFKMQLIEYYFEKLHGSEAYEYIERVRTAMFDLFTEYE----DDSSQSEMESNLQFSGSC  182

Query  558  DAQELSTNELGLTDFDAFIMETSSQ---QSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
            + + +++ +  L+ FDAF+ E SS    + +SEL+QYLEE L PR   F+V+ WWK+N  
Sbjct  183  NDKTVASRDDELSGFDAFVREGSSHIVAKKKSELEQYLEEPLFPRAEPFNVLNWWKINSA  242

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            K PTL++MARDIL VP +T  +++ FS   + +D  R S+ PETVEALV  KDW  +   
Sbjct  243  KCPTLARMARDILAVPATTVASEAAFSVGGRVIDESRASMLPETVEALVTTKDWLPSRKR  302

Query  207  KS  202
            KS
Sbjct  303  KS  304



>emb|CDP06055.1| unnamed protein product [Coffea canephora]
Length=685

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 110/186 (59%), Gaps = 27/186 (15%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYV----------ALPLPLTPTYIE  589
            RFKMKLVE+ + +IYG DA  +++ V  GI  LF +Y           ALP    P+ I 
Sbjct  488  RFKMKLVEYYYPQIYGSDAVGHIKEVSNGIRGLFSEYAVSSSSVDQDSALPDGSLPSTI-  546

Query  588  EANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVV  412
              NG    T+D          L  FD F+ ETS  QS  S+LD+YLEE + PR ++F+++
Sbjct  547  --NG----TRDR---------LRGFDKFLHETSISQSMISDLDKYLEEPVFPRNNDFNIL  591

Query  411  GWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAK  232
             WWK++  +YP LS MARD+L +PV+T   D VFS   + +D +R SL P+T EALVC +
Sbjct  592  NWWKVHTPRYPILSMMARDVLGLPVATLGRDLVFSNRGRVLDHHRSSLNPDTREALVCGQ  651

Query  231  DWQQNE  214
            DW + E
Sbjct  652  DWLRVE  657



>ref|XP_011460363.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Fragaria vesca subsp. vesca]
Length=209

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 109/183 (60%), Gaps = 7/183 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKM+L+E+ F K++G +A  Y+  V   + +LF +Y       +     E+N     + 
Sbjct  29   RFKMQLIEYYFEKLHGSEAYEYIERVRTAMFDLFTEYE----DDSSQSEMESNLEFSGSC  84

Query  558  DAQELSTNELGLTDFDAFIMETSSQ---QSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
            + + +++ +  L+ FDAF+ E SS    + +SEL+QYLEE L PR   F+V+ WWK+N  
Sbjct  85   NDKTVASRDDELSGFDAFVREGSSHIVAKKKSELEQYLEEPLFPRAEPFNVLNWWKINGA  144

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            K PTL++MARDIL VP +T  +++ FS   + +D    S+ PETVEALV  KDW  +   
Sbjct  145  KCPTLARMARDILAVPATTVASEAAFSVGGRVIDESHASMLPETVEALVTTKDWLPSRKR  204

Query  207  KSI  199
            KS 
Sbjct  205  KSF  207



>gb|KHN23048.1| Putative AC transposase [Glycine soja]
Length=672

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 109/176 (62%), Gaps = 7/176 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ FS IYG  A  +++ V +GI ELF  Y      +  T I++ +    ++ 
Sbjct  485  RFKMKLVEYYFSLIYGSTALEHIKEVSDGIKELFNVY-----SICSTMIDQGSALPGSSL  539

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +   S+ +  L  FD F+ ETS  QS  S+LD+YLEE + PR  +F+++ WWK++  +Y
Sbjct  540  PSTSCSSRD-RLKGFDRFLHETSQGQSMISDLDKYLEEPIFPRNSDFNILNWWKVHMPRY  598

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            P LS MARD+L  P+ST   +  FST  + +D  R SL P+T EAL+C +DW QNE
Sbjct  599  PILSMMARDVLGTPMSTMAPELAFSTGGRVLDSSRSSLNPDTREALICTQDWLQNE  654



>ref|XP_009601856.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=220

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 110/190 (58%), Gaps = 16/190 (8%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KMK+V+F  ++IYGE AS       + I E+ ++Y +  L  T     +A+   V   
Sbjct  29   RYKMKVVKFYLAQIYGEKASL------DKIQEVRKEYQSRAL--TSHESSQASNEVVGIV  80

Query  558  DAQELSTNELGLTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            D   LS+       FD F+  + +   +RSELD YLEESLLPR   FD + WWK N +K+
Sbjct  81   DGDRLSS-------FDQFVASSRANVDTRSELDVYLEESLLPRTPSFDSLSWWKTNGLKF  133

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
             TL KMARD+L +PVST  ++S FST  + +  +R  L P T+EAL+CA+ W  NE+   
Sbjct  134  STLQKMARDLLAIPVSTVTSESAFSTSGRLISPHRSRLYPTTLEALMCARTWLWNEINGL  193

Query  201  ITAPIKMEVP  172
             ++  K+  P
Sbjct  194  TSSVDKVSCP  203



>gb|EPS60750.1| hypothetical protein M569_14050, partial [Genlisea aurea]
Length=647

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 109/177 (62%), Gaps = 14/177 (8%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KMKLVE+ + +IYG+ A   + IV   +  L+  ++    PL     E  NGGA    
Sbjct  483  RYKMKLVEYYYPQIYGDSAPECIEIVSNCMKSLYNGHIIYS-PLAAHASE--NGGAAAKD  539

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                       LT FD F+ ETS SQ ++S+L++YLE+ L PR ++ +++ WWK+N  +Y
Sbjct  540  R----------LTGFDRFLHETSVSQNTKSDLEKYLEDPLFPRNNDLNILSWWKVNEPRY  589

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS MAR+IL +P+S   +D+VF T +K +D    +L+ ET++AL+C++DW  NEL
Sbjct  590  PVLSMMARNILGIPISKVSSDAVFDTGNKPIDHCWATLKSETLQALMCSQDWLHNEL  646



>ref|XP_010272686.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
Length=664

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 112/181 (62%), Gaps = 8/181 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IYG  AS  +++V + I EL+ +Y    +  T   +++  G  V   
Sbjct  468  RFKMKLVEYYYPQIYGSSASERIKVVFDSIKELYNEY---SICSTLASLDQGLGWEVRGN  524

Query  558  D----AQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
            +        S N   L+ FD F+ ETS SQ+++S+LD+YLEE + PR  +F+++ WWK++
Sbjct  525  NRFTGTCLPSVNNDRLSGFDKFLNETSNSQRAKSDLDKYLEEPVFPRNLDFNILNWWKVH  584

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
              +YP LS MARD+L +P++T P  S  S   + +D YR SL P+ ++AL+  +DW Q E
Sbjct  585  MPRYPILSMMARDVLGIPMATVPLGSTISVGDRVLDPYRSSLNPDILQALISTQDWLQTE  644

Query  213  L  211
            L
Sbjct  645  L  645



>emb|CDY39631.1| BnaC05g11600D [Brassica napus]
Length=688

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 111/188 (59%), Gaps = 20/188 (11%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELF---------QDYVALPLPLTPTY---  595
            RFKMK ++ +F+  YGEDA  +++ V + +H+LF          +YV + +   P +   
Sbjct  506  RFKMKHIKDTFTNAYGEDAEDWIKSVSDAVHDLFLNYSGHNLLDEYVEIEVAEEPDFQQD  565

Query  594  -IEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFD  418
              ++AN G V + D    +   +G  D D   M+T       E+DQYL+++L+     FD
Sbjct  566  MPQDANTGDVQSVDETRSTLVTIGDFDIDMSDMKT-------EMDQYLDDTLVLMSDSFD  618

Query  417  VVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVC  238
            V+GWWKLN + YP LSK+A D+L+VP ST   DSVF T  K+MD Y+ SL   T+EAL+C
Sbjct  619  VLGWWKLNSINYPILSKIAVDLLSVPFSTVSPDSVFDTEVKQMDSYKASLPRVTLEALLC  678

Query  237  AKDWQQNE  214
             KDW +N+
Sbjct  679  TKDWLKNQ  686



>ref|XP_011045538.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011045539.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011045541.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
Length=673

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 106/177 (60%), Gaps = 9/177 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +GI ELF  Y      +  T ++E  G A+   
Sbjct  487  RFKMKLVEYYYSQIYGSTALDRIKEVSDGIKELFNAY-----SICSTLVDE--GSALPGS  539

Query  558  DAQELSTNELG-LTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                 ST+    L  FD F+ E+S  QS  S+LD+YLEE + PR  +F+++ WWK++  +
Sbjct  540  SLPSTSTDSRDRLKGFDKFLHESSQGQSAISDLDKYLEEPVFPRNCDFNILNWWKVHTPR  599

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YP LS MARDIL  PVST   +  F    + +D YR SL P+T +AL+C +DW + E
Sbjct  600  YPILSMMARDILGTPVSTVSPELAFGVGGRVLDSYRSSLNPDTRQALICTRDWLRVE  656



>gb|AAD55482.1|AC009322_22 Hypothetical protein [Arabidopsis thaliana]
 gb|AAG52234.1|AC011717_2 hypothetical protein; 281-3511 [Arabidopsis thaliana]
Length=1076

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -3

Query  528   GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
             G +DF+ +I E  S QQ +SELDQYLEESL+PR  +F+V+GWW LNR KYPTLSKMA D+
Sbjct  957   GFSDFELYISEVGSHQQMKSELDQYLEESLIPRSQDFEVLGWWSLNRTKYPTLSKMAADV  1016

Query  351   LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
             L+VP  T   DSVF T  K+MD YR SLR  T+EAL CAKDW
Sbjct  1017  LSVPFCTVSPDSVFDTEVKKMDNYRSSLRHVTLEALFCAKDW  1058


 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY      L   Y+   N G   T 
Sbjct  493  RFKMKLIEFSFSKAYGEDADKWIRSVDDAVHELYHDYAEQSHSLLDAYVVHGNDGFSETD  552

Query  558  DAQ  550
             +Q
Sbjct  553  MSQ  555



>emb|CDP18725.1| unnamed protein product [Coffea canephora]
Length=676

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 112/180 (62%), Gaps = 9/180 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA---V  568
            RFKMKLVE+ + +IYG  A   + IV   +  L+  + A+ LPLT     +  GGA   V
Sbjct  484  RFKMKLVEYYYPQIYGNSAPDCIDIVSNCMKALYNGH-AVCLPLT----SQGQGGATCQV  538

Query  567  NTQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR  391
             T     ++ +   LT FD F+ ETS SQ  +S+LD+YLEE L PR  +F ++ WWK++ 
Sbjct  539  GTFGTGAINDSRSRLTGFDKFVNETSQSQNVKSDLDKYLEEPLFPRNVDFSILNWWKVHT  598

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
             +YP LS MAR+IL +P+S   ++++F+T  + +D+    LR ET++A++C +DW  +EL
Sbjct  599  PRYPILSTMARNILGIPLSKVSSEALFNTGDRAIDQPWVPLRSETLQAVMCTQDWMSSEL  658



>ref|XP_011465798.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Fragaria vesca subsp. vesca]
Length=463

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 110/183 (60%), Gaps = 7/183 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKM+L+E+ F K++G +A  Y+  V   + +LF +Y       +     E+N     + 
Sbjct  283  RFKMQLIEYYFEKLHGSEAYEYIERVRTAMFDLFTEYE----DDSSQSEMESNLEFSGSC  338

Query  558  DAQELSTNELGLTDFDAFIMETSSQ---QSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
            + + +++ +  L+ FDAF+ E SS    + +SEL+QYLEE L PR   F+V+ WWK+N  
Sbjct  339  NDKTVASRDDELSGFDAFVREGSSHIVAKKKSELEQYLEEPLFPRAEPFNVLNWWKINSA  398

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELV  208
            K PTL++MARDIL VP +T  +++ FS   + +D  R S+ PETVEALV  KDW  +   
Sbjct  399  KCPTLARMARDILAVPATTVASEAAFSVGGRVIDESRASMLPETVEALVTTKDWLPSRKR  458

Query  207  KSI  199
            KS 
Sbjct  459  KSF  461



>emb|CAN68697.1| hypothetical protein VITISV_042570 [Vitis vinifera]
Length=1068

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 114/178 (64%), Gaps = 6/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KMK++EF F  +YG +AS+ +  + +  ++L  +Y +     +    + ++ GA +  
Sbjct  523  RYKMKILEFYFPIMYGSEASSEIGKIRQLCYDLLSEYQSK----SKMGQQTSSHGASSVS  578

Query  558  DAQELSTNELG-LTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            +  EL+ +E   L+ FD F+  TS +  ++SELD YLEE++LPR+ +FDV+ WWK N +K
Sbjct  579  NLFELTYDEQDPLSKFDLFVHSTSEEGHAKSELDYYLEETVLPRISDFDVLSWWKTNGIK  638

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YPTL  + RDI  +PVST  ++S FST  + + ++R  L P T+EAL+CA+ W  NE+
Sbjct  639  YPTLQMIVRDIYAIPVSTVASESAFSTGGRMVSKHRSRLHPNTLEALMCAQSWLGNEM  696



>ref|XP_007133312.1| hypothetical protein PHAVU_011G169000g [Phaseolus vulgaris]
 gb|ESW05306.1| hypothetical protein PHAVU_011G169000g [Phaseolus vulgaris]
Length=672

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 114/191 (60%), Gaps = 7/191 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S IYG  A   ++ V +GI ELF  Y      +  T I++ +    ++ 
Sbjct  485  RFKMKLVEYYYSLIYGSTALERIKEVSDGIKELFNAY-----SICSTMIDQGSALPGSSL  539

Query  558  DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +   S+ +  L  FD F+ ETS  QS  S+LD+YLEE + PR  +F+++ WWK++  +Y
Sbjct  540  PSTSCSSRD-RLKGFDRFLHETSQSQSMTSDLDKYLEEPIFPRNSDFNILNWWKVHMPRY  598

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            P LS MARD+L  P+ST   +  F+T  + +D  R SL P+T EAL+C +DW +NE    
Sbjct  599  PILSMMARDVLGTPMSTLAPELAFTTGGRVLDSSRSSLNPDTREALICTQDWLRNESGDL  658

Query  201  ITAPIKMEVPI  169
              +PI   +P+
Sbjct  659  NPSPIHSALPL  669



>emb|CAN80126.1| hypothetical protein VITISV_013417 [Vitis vinifera]
Length=1266

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 114/178 (64%), Gaps = 6/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KMK++EF F  +YG +AS+ +  + +  ++L  +Y +     +    + ++ GA +  
Sbjct  551  RYKMKILEFYFPIMYGSEASSEIGKIRQLCYDLLSEYQSK----SKMGQQTSSHGASSVS  606

Query  558  DAQELSTNELG-LTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
            +  EL+ +E   L+ FD F+  TS +  ++SELD YLEE++LPR+ +FDV+ WWK N +K
Sbjct  607  NLFELTYDEQDPLSKFDLFVHSTSEEGHAKSELDYYLEETVLPRISDFDVLSWWKTNGIK  666

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YPTL  + RDI  +PVST  ++S FST  + + ++R  L P T+EAL+CA+ W  NE+
Sbjct  667  YPTLQMIVRDIYAIPVSTVASESAFSTGGRMVSKHRSRLHPNTLEALMCAQSWLGNEM  724



>ref|XP_009600169.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=207

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 106/192 (55%), Gaps = 12/192 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYG-EDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT  562
            R+KM+LVEF  + IYG E AS  ++ V     +LFQ+Y +     +         G V  
Sbjct  10   RYKMRLVEFYLTHIYGGEAASNKIQEVQNYCVDLFQEYKSRGAESSQASSSSEVVGHVEG  69

Query  561  QDAQELSTNELGLTDFDAFIMETSSQQ-SRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                        L+ FD F+  +SS   +RSELD YLEE++LP    FD++ WWK NR+K
Sbjct  70   DR----------LSSFDRFVASSSSNMDTRSELDSYLEENVLPHTPSFDILSWWKTNRIK  119

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            +PTL KMARD+L +  ST  ++S FS   + +  +R  L P T+EAL+CA+ W  NE+  
Sbjct  120  FPTLQKMARDLLAILASTVTSESAFSISGRLISPHRSRLHPTTLEALMCARTWLWNEING  179

Query  204  SITAPIKMEVPI  169
              +   K+  PI
Sbjct  180  LASMVDKVSCPI  191



>ref|XP_010675272.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675273.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
Length=671

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 115/191 (60%), Gaps = 9/191 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IYG  A   ++ V +GI ELF +Y    + ++  +   ++ G + + 
Sbjct  484  RFKMKLVEYYYPQIYGSSAEDNIKEVSDGIRELFDEYSIGSVSVSVDHGVGSSNGGIGSD  543

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                L         FD F+ ETS  + + S+L++YLEE + PR ++F++  WWK++  +Y
Sbjct  544  SRDRLK-------GFDKFLHETSQGKNAVSDLEKYLEEPVFPRNYDFNIFTWWKVHTPRY  596

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            P LS MA+D+L VP+ST   +  F T  + +D+YR SL  +TV+AL+C +DW + E+ +S
Sbjct  597  PILSMMAQDVLGVPMSTVAPELAFRTGGRVLDQYRSSLSSDTVQALICTQDWLRTEVEES  656

Query  201  ITAPIKMEVPI  169
             + P    VP+
Sbjct  657  -SPPGHSAVPL  666



>ref|XP_010430022.1| PREDICTED: probable serine/threonine-protein kinase kinX, partial 
[Camelina sativa]
Length=395

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = -3

Query  528  GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
            G +DF+ +I E  S QQ +SELDQYLEESL+PR  +F+V+ WW LNR KYPTLSKMA D+
Sbjct  276  GFSDFELYISEVGSHQQMKSELDQYLEESLMPRSQDFEVLRWWSLNRTKYPTLSKMAADV  335

Query  351  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            L++P  T   DSVF T  K+MD YR SLR  T+EAL CAKDW
Sbjct  336  LSLPFCTVSPDSVFDTEVKKMDNYRSSLRHVTLEALFCAKDW  377



>ref|XP_007213601.1| hypothetical protein PRUPE_ppa002416mg [Prunus persica]
 gb|EMJ14800.1| hypothetical protein PRUPE_ppa002416mg [Prunus persica]
Length=675

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 108/177 (61%), Gaps = 7/177 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +GI ELF  Y      +  T +++ +    ++ 
Sbjct  485  RFKMKLVEYYYSQIYGSTALDRIKEVSDGIKELFDAY-----SICSTMVDQGSALPGSSL  539

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +    T +  L  FD F+ ETS SQ   S+LD+YLEE + PR  +F+++ WWK++  +Y
Sbjct  540  PSTSSDTRD-RLKGFDKFLYETSQSQNVISDLDKYLEEPVFPRNCDFNILNWWKVHTPRY  598

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS MARD+L  P+ST   +S FS   + +D+ R SL P+  +ALVC +DW Q EL
Sbjct  599  PILSMMARDVLGTPMSTVAPESAFSIGGRVLDQCRSSLNPDIRQALVCTQDWLQVEL  655



>ref|XP_009791292.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
Length=196

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 102/174 (59%), Gaps = 9/174 (5%)
 Frame = -3

Query  729  MKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQ  550
            M+LVEF    IYGE+AST ++ V    ++LFQDY +    L+  +   A+  +  T   Q
Sbjct  1    MRLVEFFLPLIYGEEASTKIQEVRSNWYDLFQDYKS---KLSAPHDSLASSSSEVTSFTQ  57

Query  549  ELSTNELGLTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTL  373
                    L+ FD F+  T +  + RSELD YLEE LLPR   FD + WWK N +K+PTL
Sbjct  58   GDR-----LSSFDRFVASTGATVEKRSELDMYLEEDLLPRTPSFDNLSWWKTNGLKFPTL  112

Query  372  SKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
             KMARD+L +PVS+  ++S FST  + +  +R  L P  +E L+C + W  N+L
Sbjct  113  QKMARDLLAIPVSSVASESAFSTSGRLISPHRSRLHPTILEDLMCDRTWLWNDL  166



>ref|XP_006370067.1| hypothetical protein POPTR_0001s39240g [Populus trichocarpa]
 gb|ERP66636.1| hypothetical protein POPTR_0001s39240g [Populus trichocarpa]
Length=673

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 106/177 (60%), Gaps = 9/177 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +GI ELF  Y      +  T +++  G A+   
Sbjct  487  RFKMKLVEYYYSQIYGSTALDRIKEVSDGIKELFNAY-----SICSTLVDQ--GSALPGS  539

Query  558  DAQELSTNELG-LTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                 ST+    L  FD F+ E+S  QS  S+LD+YLEE + PR  +F+++ WWK++  +
Sbjct  540  SLPSTSTDSRDRLKGFDKFLHESSQGQSSISDLDKYLEEPVFPRNCDFNILNWWKVHTPR  599

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YP LS MARDIL  P+ST   +  F    + +D YR SL P+T +AL+C +DW + E
Sbjct  600  YPILSMMARDILGTPMSTVSPELAFGVGGRVLDSYRSSLNPDTRQALICTRDWLRVE  656



>ref|XP_011098171.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098172.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098173.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098174.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=684

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 107/176 (61%), Gaps = 7/176 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ F +IYG  A   ++ V  G+ ELF +Y      +  +  +E +G   +  
Sbjct  495  RFKMKLVEYYFQQIYGSAAPCRIKEVSAGLRELFNEY-----SMASSSPDEDSGLPGSCL  549

Query  558  DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +   S+ +  L  FD F+ ETS  QS  S+LD+YLEE + PR ++F ++ WWK++  +Y
Sbjct  550  PSSSNSSRD-KLKGFDKFLFETSQSQSMSSDLDKYLEEPVFPRNYDFSILNWWKVHTPRY  608

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            P LS MARD+L +PVST   +  FS   + +D+Y  SL P+T EAL+C +DW + E
Sbjct  609  PILSMMARDVLGIPVSTLGPEVAFSNGGRVLDQYHSSLSPDTREALLCGQDWLRME  664



>ref|XP_006377715.1| hypothetical protein POPTR_0011s10500g [Populus trichocarpa]
 gb|ERP55512.1| hypothetical protein POPTR_0011s10500g [Populus trichocarpa]
Length=673

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 105/177 (59%), Gaps = 9/177 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +GI ELF  Y      +  T +++  G  +   
Sbjct  487  RFKMKLVEYYYSQIYGSTALDRIKEVSDGIKELFNAY-----SICSTLVDQ--GSTLPGS  539

Query  558  DAQELSTNELG-LTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                 ST+    L  FD F+ E+S  QS  S+LD+YLEE + PR  +F+++ WWK++  +
Sbjct  540  SLPSTSTDSRDRLKGFDKFLHESSQGQSAISDLDKYLEEPVFPRNCDFNILNWWKVHTPR  599

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YP LS MARDIL  P+ST   +  F    + +D YR SL P+T +AL+C +DW Q E
Sbjct  600  YPILSMMARDILGTPMSTIAPELAFGVGGRVLDSYRSSLNPDTRQALICTRDWLQVE  656



>ref|XP_009376729.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Pyrus x bretschneideri]
Length=677

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 110/192 (57%), Gaps = 9/192 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +G+ ELF  Y      +  T +++  G A+   
Sbjct  484  RFKMKLVEYYYSQIYGSTALDRIKEVSDGLKELFDAY-----SICSTMVDQ--GSALPGS  536

Query  558  DAQELSTNELG-LTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                 ST+    L  FD F+ ETS SQ   S+LD+YLEE + PR  +F+++ WWK++  +
Sbjct  537  SLPSTSTDSRDRLKGFDKFLYETSQSQNMISDLDKYLEEPVFPRNCDFNILNWWKVHTPR  596

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVK  205
            YP LS MARD+L  P+ST   +S F    + +D  R SL P+  EALVC +DW + EL  
Sbjct  597  YPILSMMARDVLGTPMSTVAPESAFDIGGRVLDECRSSLNPDIREALVCTQDWLRVELKD  656

Query  204  SITAPIKMEVPI  169
            + T       PI
Sbjct  657  ANTLSSHSARPI  668



>ref|XP_011044575.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011044576.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
Length=673

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 106/176 (60%), Gaps = 7/176 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +GI ELF  Y      +  T +++ +    ++ 
Sbjct  487  RFKMKLVEYYYSQIYGSTALDRIKEVSDGIKELFNAY-----SICSTLVDQGSTLPGSSL  541

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +    + +  L  FD F+ E+S  QS  S+LD+YLEE + PR  +F+++ WWK++  +Y
Sbjct  542  PSTSSDSRD-RLKGFDKFLHESSQGQSAISDLDKYLEEPVFPRNCDFNILNWWKVHTPRY  600

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            P LS MARDIL  P+ST   D  F    + +D YR SL P+T +AL+C +DW Q E
Sbjct  601  PILSMMARDILGTPMSTIAPDLAFGVGGRVLDSYRSSLNPDTRQALICTRDWLQVE  656



>ref|XP_009764968.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=388

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 108/190 (57%), Gaps = 8/190 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEF  ++IYGE+    ++ V      LFQ+Y +  +    ++   ++       
Sbjct  192  RFKMKLVEFYLAQIYGEETLHKIQEVRNHCFNLFQEYTSRVVASHESFQASSSNEVAGVV  251

Query  558  DAQELSTNELGLTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +   LS+       FD F+  +S+    RSEL+ YLEE +L R   FD + WWK N +K+
Sbjct  252  EGDRLSS-------FDRFVASSSANVDPRSELESYLEEGVLSRTPSFDSLSWWKTNILKF  304

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            PTL K+ARD+L +P+ST  ++S FST  + +  +R  L P T+EAL+ A+ W  NE+  S
Sbjct  305  PTLQKIARDLLAIPISTVASESAFSTSGRLISPHRSRLHPTTLEALMYARTWLWNEINGS  364

Query  201  ITAPIKMEVP  172
             ++  ++  P
Sbjct  365  CSSIDRVSCP  374



>ref|XP_011471014.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Fragaria vesca subsp. vesca]
Length=656

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 110/178 (62%), Gaps = 5/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEF++++I+G  A   +  V + + EL+ ++      L      +  GG     
Sbjct  480  RFKMKLVEFNYAQIFGSVAPGRISNVHDCVKELYDEHSISLASLDQGLAWQVGGGPRMPN  539

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPR-VHEFDVVGWWKLNRMK  385
              ++       LT FD ++ ET+ S+ S+S+LD+YLEE L PR    FDV+ WWK++  +
Sbjct  540  SGRDSRDR---LTGFDTYLQETTQSEGSKSDLDKYLEEPLFPRNAPGFDVLNWWKVHTPR  596

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YP LS MAR++L +P+S A  DS F+T  + +DR   SL+P T++AL+CA+DW ++EL
Sbjct  597  YPILSMMARNVLGMPMSKASLDSAFNTGGRVLDRDWSSLKPATIQALMCAQDWIRSEL  654



>ref|XP_009783770.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=675

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 106/191 (55%), Gaps = 7/191 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IYG DAS  ++ + + I EL  +Y      L P      +G   N  
Sbjct  486  RFKMKLVEYYYPQIYGSDASNQIKEISDAIRELSNEYAMGSSSLDPD-TAGTSGSLTNIS  544

Query  558  DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
                 S     L  FD F+ ETS   +  S+L++YLEE + PR ++F ++ WWK++  +Y
Sbjct  545  -----SGTRDRLRGFDKFLHETSQNHNITSDLEKYLEEPVFPRNYDFSILNWWKVHTPRY  599

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            P LS MARDIL VP ST   +  F+   K +D+ R SL P   EALVC +DW + E  ++
Sbjct  600  PILSMMARDILGVPASTLGPEVAFNNRGKVLDQDRSSLNPAAREALVCGQDWLRTETEET  659

Query  201  ITAPIKMEVPI  169
             +  I   VP+
Sbjct  660  NSPHIYTAVPL  670



>ref|XP_009610280.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
 ref|XP_009610281.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
 ref|XP_009610282.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
Length=675

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 107/191 (56%), Gaps = 7/191 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IYG DAS  ++ + + I EL  +Y      L P        G   + 
Sbjct  486  RFKMKLVEYYYPQIYGSDASNQIKEISDAIRELSNEYAMGSSSLDPD-----TAGTSGSL  540

Query  558  DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +    T +  L  FD F+ ETS   +  S L++YLEE + PR ++F ++ WWK++  +Y
Sbjct  541  TSISSGTRD-RLRGFDKFLHETSQNHNITSNLEKYLEEPVFPRNYDFSILNWWKVHTPRY  599

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            PTLS MARDIL VP ST   +  F+   K +D+ R SL P   EALVC +DW + E  ++
Sbjct  600  PTLSMMARDILGVPASTLGPEVAFNNRGKVLDQDRSSLNPAAREALVCGQDWLRVETEET  659

Query  201  ITAPIKMEVPI  169
             +  I   VP+
Sbjct  660  NSPHIYTAVPL  670



>ref|XP_009631898.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=519

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 113/198 (57%), Gaps = 25/198 (13%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDAST-YVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT  562
            R+K+KLVEF   +IYGE+AS   ++ V     +LFQ+Y +  L                +
Sbjct  321  RYKIKLVEFYLVQIYGEEASLDKIQEVRNHCFDLFQEYQSRKL---------------TS  365

Query  561  QDAQELSTNELGLTD------FDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWW  403
             ++ + S   +G+ D      FD F+  + +   +RSELD YLEESLLP    FD + W 
Sbjct  366  HESSQASNEVVGIVDGDWFYSFDQFVASSRANVDTRSELDVYLEESLLPSTPSFDSLSWQ  425

Query  402  KLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQ  223
            K N +K+PTL KMARD+L +PVST  ++S FST  + +  +R  L P T+EALVCA+ W 
Sbjct  426  KTNGLKFPTLQKMARDLLAIPVSTVASESAFSTSGRLISPHRSRLHPTTLEALVCARTWL  485

Query  222  QNELVKSITAPI-KMEVP  172
             NE +  +T+ I K+  P
Sbjct  486  WNE-INGLTSSIDKVSCP  502



>ref|XP_010417758.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Camelina sativa]
Length=1203

 Score =   132 bits (331),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = -3

Query  528   GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
             G +DF+ +I E  S QQ +SELDQYLEESL+PR  +F+V+ WW LNR KYPTLSKMA D+
Sbjct  1084  GFSDFELYISEVGSHQQMKSELDQYLEESLMPRSQDFEVLRWWSLNRTKYPTLSKMAADV  1143

Query  351   LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
             L++P  T   DSVF T  K+MD YR SLR  T+EAL CAKDW
Sbjct  1144  LSLPFCTVSPDSVFDTEVKKMDNYRSSLRHVTLEALFCAKDW  1185


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY      L   Y+   N G   T 
Sbjct  521  RFKMKLIEFSFSKAYGEDADKWIRSVDDAVHELYLDYTEQSHSLLDAYVGHGNDGFSETD  580

Query  558  DAQ  550
             +Q
Sbjct  581  ISQ  583



>ref|XP_010417759.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Camelina sativa]
Length=1203

 Score =   132 bits (331),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = -3

Query  528   GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
             G +DF+ +I E  S QQ +SELDQYLEESL+PR  +F+V+ WW LNR KYPTLSKMA D+
Sbjct  1084  GFSDFELYISEVGSHQQMKSELDQYLEESLMPRSQDFEVLRWWSLNRTKYPTLSKMAADV  1143

Query  351   LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
             L++P  T   DSVF T  K+MD YR SLR  T+EAL CAKDW
Sbjct  1144  LSLPFCTVSPDSVFDTEVKKMDNYRSSLRHVTLEALFCAKDW  1185


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY      L   Y+   N G   T 
Sbjct  521  RFKMKLIEFSFSKAYGEDADKWIRSVDDAVHELYLDYTEQSHSLLDAYVGHGNDGFSETD  580

Query  558  DAQ  550
             +Q
Sbjct  581  ISQ  583



>ref|XP_006300389.1| hypothetical protein CARUB_v10019720mg [Capsella rubella]
 gb|EOA33287.1| hypothetical protein CARUB_v10019720mg [Capsella rubella]
Length=984

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = -3

Query  528  GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
            G +DF+ +I E  S QQ +SELDQYLEESL+PR  +F+V+GWW LNR KYPTLSKMA D+
Sbjct  865  GFSDFELYISEVGSHQQMKSELDQYLEESLMPRSQDFEVLGWWSLNRTKYPTLSKMAADV  924

Query  351  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            L++P  T   DSVF T  K+MD YR SL   T+EAL CAKDW
Sbjct  925  LSLPFCTVSPDSVFDTEVKKMDNYRSSLPHVTLEALFCAKDW  966


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY      L   YI   N G   T 
Sbjct  500  RFKMKLIEFSFSKAYGEDADKWIRSVDDAVHELYLDYAEQSHSLLDAYIGHENDGFSETY  559

Query  558  DAQELSTNEL  529
             +Q    NE+
Sbjct  560  MSQVRFHNEM  569



>ref|XP_010472998.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Camelina sativa]
Length=1204

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 75/102 (74%), Gaps = 1/102 (1%)
 Frame = -3

Query  528   GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
             G  DF+ +I E  S QQ +SELDQYLEESL+PR  +F+V+ WW LNR KYPTLSKMA D+
Sbjct  1085  GFADFELYISEVGSHQQMKSELDQYLEESLIPRSQDFEVLRWWSLNRTKYPTLSKMAADV  1144

Query  351   LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
             L++P  T   DSVF T  K+MD YR SLR  T+EAL CAKDW
Sbjct  1145  LSLPFCTVSPDSVFDTEVKKMDNYRSSLRHVTLEALFCAKDW  1186


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY      L   Y+   N G   T 
Sbjct  520  RFKMKLIEFSFSKAYGEDADKWIRSVDDAVHELYLDYTEQGHSLLDAYVGHGNDGFSETD  579

Query  558  DAQ  550
             +Q
Sbjct  580  ISQ  582



>ref|XP_010472999.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Camelina sativa]
Length=1176

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 75/102 (74%), Gaps = 1/102 (1%)
 Frame = -3

Query  528   GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
             G  DF+ +I E  S QQ +SELDQYLEESL+PR  +F+V+ WW LNR KYPTLSKMA D+
Sbjct  1057  GFADFELYISEVGSHQQMKSELDQYLEESLIPRSQDFEVLRWWSLNRTKYPTLSKMAADV  1116

Query  351   LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
             L++P  T   DSVF T  K+MD YR SLR  T+EAL CAKDW
Sbjct  1117  LSLPFCTVSPDSVFDTEVKKMDNYRSSLRHVTLEALFCAKDW  1158


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY      L   Y+   N G   T 
Sbjct  520  RFKMKLIEFSFSKAYGEDADKWIRSVDDAVHELYLDYTEQGHSLLDAYVGHGNDGFSETD  579

Query  558  DAQ  550
             +Q
Sbjct  580  ISQ  582



>ref|XP_006409564.1| hypothetical protein EUTSA_v10022530mg [Eutrema salsugineum]
 gb|ESQ51017.1| hypothetical protein EUTSA_v10022530mg [Eutrema salsugineum]
Length=962

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 8/118 (7%)
 Frame = -3

Query  555  AQELSTNEL-------GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWK  400
            +QE S+ E        G +DF+ +I E  + QQ +SELDQYLEESL+PR  +F+V+GWW 
Sbjct  827  SQEASSQEFPLITIGDGFSDFEIYISEVGNHQQMKSELDQYLEESLIPRSEDFEVLGWWS  886

Query  399  LNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            LNR KYPTLSKMA D+L++P  T   DSVF T  K+MD YR SL   T+EAL CAKDW
Sbjct  887  LNRTKYPTLSKMAADVLSLPFCTVSPDSVFDTEVKKMDNYRSSLGHVTLEALFCAKDW  944


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 2/106 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  +++ VD+GI  L+ DY      L   Y+   N G   T 
Sbjct  517  RFKMKLIEFSFSKTYGEDAEKWIKSVDDGIRNLYHDYAEQSHSLLDAYVGHGNDGFSETD  576

Query  558  DAQELSTNELGLTDFDAFIMETSSQQ-SRSELDQYLEESLLPRVHE  424
             +Q    N L     D  +    SQ+ ++++++Q   ES +P   E
Sbjct  577  MSQPEDGNLLNKKPGDHILDGHESQEVAQTQVNQLAVES-VPHAQE  621



>ref|XP_010327109.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Solanum lycopersicum]
Length=676

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 107/191 (56%), Gaps = 7/191 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IY  DA   ++ + + I EL  +Y      L P        GA  + 
Sbjct  487  RFKMKLVEYYYPQIYDSDAPNQIKAISDAIRELSNEYAMGSSSLDPD-----TAGASGSL  541

Query  558  DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +  + T +  L  FD F+ ETS   +  S+LD+YLEE + PR ++F ++ WWK++  +Y
Sbjct  542  ASTTIGTRD-RLRGFDKFLHETSHNHNMTSDLDKYLEEPVFPRNYDFSILNWWKVHTPRY  600

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            P LS MARDIL VP ST   +  F+   + +D +R SL P+  EAL+C +DW + E  + 
Sbjct  601  PILSMMARDILGVPASTLGPELAFNNRGRVLDYHRSSLNPDAREALICGQDWLRMESEEY  660

Query  201  ITAPIKMEVPI  169
             +  I   VP+
Sbjct  661  NSPHIYTAVPL  671



>ref|XP_010551474.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Tarenaya hassleriana]
 ref|XP_010551476.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Tarenaya hassleriana]
 ref|XP_010551477.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Tarenaya hassleriana]
Length=667

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 106/177 (60%), Gaps = 1/177 (1%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+E+ +  +YG  AS  +  + E I  L+ ++    L ++     +         
Sbjct  488  RFKMKLIEYYYPLLYGASASELIDDISECIKALYNEHTVGSLLVSSEQAFDWQQQQQQQS  547

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +          LT+FD +I +T   Q ++S+L++YLEE L PR  +FD++ WW+++  +Y
Sbjct  548  NGVNGKGFSDRLTEFDRYINDTEPCQDTKSDLEKYLEEPLFPRNSDFDILNWWRVHTPRY  607

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS MAR++L VP+ST PA   F T  +++D+   SLRP TV+AL+CA+DW ++EL
Sbjct  608  PILSMMARNVLAVPMSTVPAGHAFGTRLRQVDQNWSSLRPSTVQALMCAQDWIRSEL  664



>ref|XP_011076819.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011076827.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011076835.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=670

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IYG+ A   + IV   +  L+  + A+  PL       A+G +  ++
Sbjct  483  RFKMKLVEYYYPQIYGDSAPDCIDIVSNCMRALYSGH-AIYSPLA------AHGQSSASE  535

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +  +  + L  T FD F+ ETS SQ ++S+LD+YLEE   PR  +F ++ WWK++  +Y
Sbjct  536  SSGSIVKDRL--TGFDRFLHETSLSQNTKSDLDKYLEEPFFPRSVDFSILNWWKVHEPRY  593

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS MAR+IL +P+S    +S+F T  + +D    SL+ +T++AL+C++DW +NEL
Sbjct  594  PVLSMMARNILGIPISKVAQESLFDTGDRALDHCWSSLKSDTLQALMCSQDWMRNEL  650



>gb|KGN55034.1| hypothetical protein Csa_4G624400 [Cucumis sativus]
Length=871

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 107/180 (59%), Gaps = 13/180 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEAN--GGAV  568
            RFKMKLVE+ +S+IYG  A   ++ V +GI EL+  Y +   + +  + +  +   G   
Sbjct  682  RFKMKLVEYYYSQIYGSMALDRIKEVSDGIKELYDQYSICFSMVVQGSTLHGSGLPGTGN  741

Query  567  NTQDAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNR  391
             ++D          L  FD F+ ETS  QS  S+LD+YLEE + PR  +F+++ WW ++ 
Sbjct  742  ESRDR---------LKGFDKFLHETSQSQSVMSDLDKYLEEPVFPRNCDFNILNWWNVHT  792

Query  390  MKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
             +YP LS MARD++  P+S+   +  F T  + +DRYR SL P+T +AL+CA+DW   EL
Sbjct  793  PRYPILSMMARDVIGTPMSSIVPEFAFCTTGRVLDRYRSSLSPDTRQALICAQDWLCIEL  852



>gb|ACF86826.1| unknown [Zea mays]
Length=109

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -3

Query  492  SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVS-TAPADS  316
            SSQ S+ EL+QYL+ESL PR  EFD++ WWKLNR+K+PTLS+MA DIL +P+S  +   S
Sbjct  8    SSQPSKPELEQYLDESLTPRTQEFDILNWWKLNRVKFPTLSRMACDILAIPMSMVSSGSS  67

Query  315  VFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            +F+  T  + +D YR SLRPETVEALVCAKDW Q
Sbjct  68   IFTAGTGSRMLDDYRSSLRPETVEALVCAKDWLQ  101



>ref|XP_011082939.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011082940.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011082941.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=670

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 110/177 (62%), Gaps = 10/177 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + +IYG+ A   + IV   +  L+  + A+  PL       A+G +  ++
Sbjct  483  RFKMKLVEYYYPQIYGDSAPDCIDIVSNCMRALYSGH-AIYSPLA------AHGQSSASE  535

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +     + L  T FD F+ ETS SQ ++S+LD+YLEE   PR  +F ++ WWK++  +Y
Sbjct  536  SSGSTVKDRL--TGFDRFLHETSLSQNTKSDLDKYLEEPFFPRSVDFSILNWWKVHEPRY  593

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS MAR+IL +P+S    +S+F T  + +D    SL+ +T++AL+C++DW +NEL
Sbjct  594  PVLSMMARNILGIPISKVAQESLFDTGDRALDHCWSSLKSDTLQALMCSQDWMRNEL  650



>ref|XP_010256080.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nelumbo nucifera]
 ref|XP_010256081.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nelumbo nucifera]
Length=680

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 106/181 (59%), Gaps = 11/181 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEE--ANGGAVN  565
            RFKM++VE+ ++KIYG +A  Y+  V   I +L+ +Y      L P+  +   A  G+ N
Sbjct  471  RFKMQIVEYYYNKIYGFEADKYISRVRTAIFDLYMEYGGELRDLLPSQSQASLAESGSSN  530

Query  564  TQ----DAQELSTNELGLTDFDAFIMETSSQQ----SRSELDQYLEESLLPRVHEFDVVG  409
                     E S NE  L DFD + +++        ++SELD YLEE+L PR  +FD++G
Sbjct  531  LSLRFGFEVEASDNE-ELADFDKWCIDSGIASNIALTKSELDVYLEENLFPRSKDFDILG  589

Query  408  WWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKD  229
            +WKL  +K P LS MARDIL +P +T  ++  F+T  + + +Y   LRPE +EAL+C + 
Sbjct  590  YWKLYHLKRPKLSAMARDILAIPATTIASEEAFNTSARAIHKYHTCLRPEVIEALMCGQS  649

Query  228  W  226
            W
Sbjct  650  W  650



>ref|XP_010256082.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nelumbo nucifera]
Length=679

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 106/181 (59%), Gaps = 11/181 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEE--ANGGAVN  565
            RFKM++VE+ ++KIYG +A  Y+  V   I +L+ +Y      L P+  +   A  G+ N
Sbjct  471  RFKMQIVEYYYNKIYGFEADKYISRVRTAIFDLYMEYGGELRDLLPSQSQASLAESGSSN  530

Query  564  TQ----DAQELSTNELGLTDFDAFIMETSSQQ----SRSELDQYLEESLLPRVHEFDVVG  409
                     E S NE  L DFD + +++        ++SELD YLEE+L PR  +FD++G
Sbjct  531  LSLRFGFEVEASDNE-ELADFDKWCIDSGIASNIALTKSELDVYLEENLFPRSKDFDILG  589

Query  408  WWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKD  229
            +WKL  +K P LS MARDIL +P +T  ++  F+T  + + +Y   LRPE +EAL+C + 
Sbjct  590  YWKLYHLKRPKLSAMARDILAIPATTIASEEAFNTSARAIHKYHTCLRPEVIEALMCGQS  649

Query  228  W  226
            W
Sbjct  650  W  650



>gb|KJB27004.1| hypothetical protein B456_004G271300 [Gossypium raimondii]
 gb|KJB27005.1| hypothetical protein B456_004G271300 [Gossypium raimondii]
Length=672

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 104/182 (57%), Gaps = 27/182 (15%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYV----------ALPLPLTPTYIE  589
            RFKMKLVE+ +S+IYG  A   ++ V +G+ ELF  Y           ALPL   P+   
Sbjct  483  RFKMKLVEYYYSQIYGSTALERIKEVSDGLKELFNTYSICSTLMDQGSALPLGSLPS---  539

Query  588  EANGGAVNTQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVV  412
                   ++ D ++       L  FD F+ ETS SQ + S+L++YL+E + PR   F+++
Sbjct  540  -------SSNDGRD------RLKGFDKFLHETSQSQTAISDLEKYLDEPVFPRNCNFNIL  586

Query  411  GWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAK  232
             WW+++  +YP LS MARD+L  P+ST   +S F    + +D  RC L PET +AL+C +
Sbjct  587  NWWRVHTPRYPILSMMARDVLGTPMSTVSQESAFHAGGRVLDSCRCPLTPETQQALICTQ  646

Query  231  DW  226
            DW
Sbjct  647  DW  648



>ref|XP_009138908.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=1013

 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = -3

Query  528  GLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  352
            G +DF+ +I E  S +Q +SELDQYLEESL+PR  +F+V+GWW LNR KYPTLSKMA D+
Sbjct  897  GFSDFELYISEVGSREQMKSELDQYLEESLIPRSPDFEVLGWWSLNRTKYPTLSKMAADV  956

Query  351  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            L++P  T   DSVF T  K+MD YR SL   T+EAL CAKDW
Sbjct  957  LSLPFCTVSPDSVFDTDVKKMDNYRSSLGHVTLEALFCAKDW  998


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKL+EFSFSK YGEDA  ++R VD+ +HEL+ DY      L   Y+   N G   T+
Sbjct  518  RFKMKLIEFSFSKAYGEDAEKWIRSVDDAVHELYHDYAEQSHSLLEAYVGHGNDGFSETE  577



>ref|XP_010655772.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Vitis vinifera]
Length=227

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 105/184 (57%), Gaps = 20/184 (11%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+K+K++EF F  +YG +AS  +  +    +EL  +Y +           ++N G   + 
Sbjct  29   RYKIKILEFYFPLMYGSEASNEIEKIRGMCYELLSEYQS-----------KSNLGQKTSS  77

Query  558  DAQ-------ELSTNELG-LTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGW  406
                      EL+ +E   L+ FD F+  T+ +  ++SELD YLEES+LPR   FDV+ W
Sbjct  78   YGTSSGSTLLELNYDEQDPLSKFDLFVHSTTGESHTKSELDYYLEESILPRNSNFDVLSW  137

Query  405  WKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            WK N +KYPTL  + RDI  +PVS   ++S FST  + + ++R  L P+T+EAL+CA+ W
Sbjct  138  WKTNGIKYPTLQMIVRDIYAIPVSIVASESAFSTGGRVVSKHRSRLHPDTLEALMCAQSW  197

Query  225  QQNE  214
               E
Sbjct  198  LWKE  201



>ref|XP_007021998.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 ref|XP_007021999.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 ref|XP_007022000.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13523.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13524.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13525.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
Length=672

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +GI ELF  Y      +  T I+E      ++ 
Sbjct  483  RFKMKLVEYYYSQIYGSTALERIKEVSDGIKELFNAY-----SICSTLIDEGTALPGSSL  537

Query  558  DAQELSTNELGLTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +    + +  L  FD F+ ET+  QS  S+L++YLEE++ PR  +F+++ WW+++  +Y
Sbjct  538  PSSSNDSRD-RLKGFDKFLHETAQSQSAISDLEKYLEEAVFPRNCDFNILNWWRVHTPRY  596

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            P LS MARD+L  P+ST   +S F+   + +D  R SL  +T +AL+C +DW
Sbjct  597  PILSMMARDVLGTPMSTVAQESAFNAGGRVLDSCRSSLTADTRQALICTRDW  648



>ref|XP_007022001.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 ref|XP_007022003.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 gb|EOY13526.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 gb|EOY13528.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
Length=689

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 105/172 (61%), Gaps = 7/172 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++ V +GI ELF  Y      +  T I+E      ++ 
Sbjct  483  RFKMKLVEYYYSQIYGSTALERIKEVSDGIKELFNAY-----SICSTLIDEGTALPGSSL  537

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +    + +  L  FD F+ ET+ SQ + S+L++YLEE++ PR  +F+++ WW+++  +Y
Sbjct  538  PSSSNDSRD-RLKGFDKFLHETAQSQSAISDLEKYLEEAVFPRNCDFNILNWWRVHTPRY  596

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            P LS MARD+L  P+ST   +S F+   + +D  R SL  +T +AL+C +DW
Sbjct  597  PILSMMARDVLGTPMSTVAQESAFNAGGRVLDSCRSSLTADTRQALICTRDW  648



>ref|XP_010060762.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Eucalyptus grandis]
Length=673

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 108/177 (61%), Gaps = 9/177 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFK+KLVE+ +S+IYG  A   ++ + +GI +LF  Y      +  + +++  G A+   
Sbjct  485  RFKVKLVEYYYSQIYGSTALDRIKEISDGIKQLFDAY-----SICSSLVDQ--GSALPGS  537

Query  558  DAQELSTNELG-LTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                + ++    L  FD F+ ETS  QS  S+LD+YLEE + PR  +F+++ WWK++  +
Sbjct  538  SLPSMCSDSRDRLKGFDKFLHETSQNQSGVSDLDKYLEEPVFPRNCDFNILNWWKVHTPR  597

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YP LS MARD+L  P+ST   +S F++  + +D+ + SL P+  +AL+C +DW Q E
Sbjct  598  YPILSMMARDVLGTPMSTGSPESTFTSGPRMLDQVQSSLDPDIHQALICTRDWLQME  654



>ref|XP_011460829.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011460830.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Fragaria vesca subsp. vesca]
Length=675

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 106/178 (60%), Gaps = 9/178 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV-NT  562
            RFKMKLVE+ +S+IYG  +   ++ V +GI ELF  Y      +  T +++  G A+  +
Sbjct  485  RFKMKLVEYYYSQIYGSQSLEKIKDVSDGIKELFDAY-----SICSTMVDQ--GSALPGS  537

Query  561  QDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                  S     L  FD F+ ETS SQ   S+L++YL+E   PR  +F+++ WWK++  +
Sbjct  538  SLPSTCSDPRDRLKGFDKFLYETSQSQNVSSDLEKYLQEPNFPRNCDFNILNWWKVHTPR  597

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YP LS MARD+L  P+ST   +S FS   + +D+ R  L P+T EAL+C +DW Q E+
Sbjct  598  YPILSMMARDVLGTPMSTIARESAFSIDGRVLDKCRSLLNPDTREALICTQDWLQMEV  655



>ref|XP_007216990.1| hypothetical protein PRUPE_ppa002590mg [Prunus persica]
 gb|EMJ18189.1| hypothetical protein PRUPE_ppa002590mg [Prunus persica]
Length=655

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 105/177 (59%), Gaps = 4/177 (2%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMK V++ +++ +G  A   +  V E +  L+ ++      +      +  G +    
Sbjct  480  RFKMKPVDYYYAQFFGSGAPGRISDVFECVKTLYNEHSTCLAYVDQGLAWQVGGSSRLPG  539

Query  558  DAQELSTNELGLTDFDAFIMETSS-QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
              ++L      LT FD F+ ET+    ++S+LD+YLEE L PR  EFD++ WWK++  +Y
Sbjct  540  SGRDLRDR---LTGFDKFLHETTEIDGTKSDLDKYLEEPLFPRNAEFDILNWWKVHAPRY  596

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            P LS MAR++L +PVS  P DS F+T  + +DR   S+ P T++AL+CA+DW ++EL
Sbjct  597  PILSMMARNVLGIPVSKVPIDSTFNTGGRVLDRDWSSMNPATIQALMCAQDWIRSEL  653



>emb|CAN83599.1| hypothetical protein VITISV_015691 [Vitis vinifera]
Length=570

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 102/177 (58%), Gaps = 6/177 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+K+K++EF F  +YG  AS  +  +    +EL  +Y +       T     + G+    
Sbjct  346  RYKIKILEFYFPLMYGSKASNEIEKIRGMCYELLSEYQSKSKLGQKTSFYGTSSGST---  402

Query  558  DAQELSTNELG-LTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
               EL+ +E   L+ FD F+  T  +  ++SELD YLEES+LPR   FDV+ WWK N +K
Sbjct  403  -LLELNYDEQDPLSKFDLFVHSTIGESHTKSELDYYLEESILPRTSNFDVLSWWKTNGIK  461

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YPTL  + RDI  + VST  ++S FST  K + ++R  L P+T+EAL+CA+ W   E
Sbjct  462  YPTLQMIVRDIYAILVSTVASESAFSTGGKVVSKHRSRLHPDTLEALMCAQSWLWKE  518



>gb|KJB75465.1| hypothetical protein B456_012G042700 [Gossypium raimondii]
Length=658

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE----EANGGA  571
            RFKMKL+E+ + ++YG+ A+  +  V E I  L+ ++ ++  PL  +  +    +A+G  
Sbjct  483  RFKMKLLEYYYPQLYGDSATELIDDVFECIKSLYNEH-SIVSPLASSINQGLDWQASGSP  541

Query  570  VNTQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             + +D+++       L  FD F+ ETS ++ S S+LD+YLEE L PR  +F+V+ WWK++
Sbjct  542  GSGKDSRD------RLMGFDKFLHETSQAEGSSSDLDKYLEEPLFPRNVDFNVLNWWKVH  595

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
              +YP LS MAR+IL +P+S   A+S F T  + ++    SL P T++AL+C++DW ++E
Sbjct  596  TPRYPILSMMARNILGIPISKVAAESRFDTGGRMLNHNWSSLPPTTIQALMCSQDWIRSE  655

Query  213  L  211
            L
Sbjct  656  L  656



>ref|XP_010684309.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
Length=423

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 101/173 (58%), Gaps = 7/173 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYG--EDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVN  565
            RFKM+ +++SF+K+YG   D  + +  V + +  L+  Y    +      +       V 
Sbjct  204  RFKMQFIKWSFNKVYGFGPDYESELFKVKDRLQHLYDGYAMSSVSAATNNVAGCRFAGVT  263

Query  564  TQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
                    T++  +TDFD F  E  S+  +S+L  YLEE L+PR    ++V +W+ + ++
Sbjct  264  CD-----GTSDEFMTDFDEFSNEQHSESVKSDLVSYLEEPLMPRSSNINIVSYWRTHEVR  318

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            YP ++KMA+D L +P+ST  ++S FST  + +D YR SL+P+TVEA++C +DW
Sbjct  319  YPIVAKMAKDFLAIPMSTVASESAFSTGGRVLDCYRSSLKPKTVEAIICLRDW  371



>gb|KGN47993.1| hypothetical protein Csa_6G423350 [Cucumis sativus]
Length=681

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 109/183 (60%), Gaps = 13/183 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLP-----LTPTYIEEANG  577
            RFKMKLVE+ + +IYG  A   +  V   +  L+ ++ +  PL      L       +  
Sbjct  503  RFKMKLVEYYYPQIYGVVALQRIDDVLNCVKALYNEHSICSPLASIDQGLAWQVGSSSGS  562

Query  576  GAVNTQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWK  400
               + +DA++       L  FD F+ E+S S+ S+S+LD+YLEE L PR  +F+V+ WWK
Sbjct  563  LPGSGKDARD------RLMGFDKFLHESSQSEGSKSDLDKYLEEPLFPRNVDFNVLNWWK  616

Query  399  LNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            ++  +YP LS MAR++L +P+S    DS F T  K +DR   SL+P T+EALVC++DW +
Sbjct  617  VHTPRYPILSMMARNVLGIPMSKVAPDSAFKTGRKVLDRDWSSLKPATIEALVCSQDWIR  676

Query  219  NEL  211
            +EL
Sbjct  677  SEL  679



>gb|KJB45835.1| hypothetical protein B456_007G331900 [Gossypium raimondii]
 gb|KJB45836.1| hypothetical protein B456_007G331900 [Gossypium raimondii]
 gb|KJB45837.1| hypothetical protein B456_007G331900 [Gossypium raimondii]
 gb|KJB45838.1| hypothetical protein B456_007G331900 [Gossypium raimondii]
Length=672

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++   +GI ELF  Y      +  T I++ +    ++ 
Sbjct  483  RFKMKLVEYYYSQIYGSTALERIKEASDGIKELFNAY-----SICSTLIDQGSALPGSSL  537

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +    T +  L  FD F+ ETS SQ + S+L++YL+E + PR  +F+++ WW+++  +Y
Sbjct  538  PSSSNDTRD-KLKGFDKFLHETSQSQTAISDLEKYLDEPMFPRNCDFNILNWWRVHTPRY  596

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            P LS MARD+L  P+ST   +  F+   + +D  + SL P+T +AL+C +DW
Sbjct  597  PILSMMARDVLGTPMSTVAQEFAFNAGGRILDSNQSSLPPDTRQALICTRDW  648



>gb|KHG11798.1| Putative AC transposase [Gossypium arboreum]
 gb|KHG17872.1| Putative AC transposase [Gossypium arboreum]
Length=658

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE----EANGGA  571
            RFKMKL+E+ + ++YG+ A+  +  V E I  L+ ++ ++  PL  +  +    +A+G +
Sbjct  483  RFKMKLLEYYYPQLYGDSATELIDDVFECIKSLYNEH-SIVSPLASSIDQGLDWQASGIS  541

Query  570  VNTQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             + +D+++       L  FD ++ ET  ++ S S+LD+YLEE L PR  +F+V+ WWK++
Sbjct  542  GSGKDSRD------RLMGFDKYLHETCQAEGSSSDLDKYLEEPLFPRNVDFNVLNWWKVH  595

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
              +YP LS MAR+IL +P+S   A+S F T  + +D    SL P T++AL+C++DW ++E
Sbjct  596  TPRYPILSMMARNILGIPISKVAAESRFDTGGRVLDHNWSSLPPTTIQALMCSQDWIRSE  655

Query  213  L  211
            L
Sbjct  656  L  656



>gb|KHG07030.1| Putative AC transposase [Gossypium arboreum]
Length=672

 Score =   122 bits (305),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +S+IYG  A   ++   +GI ELF  Y      +  T I++ +    ++ 
Sbjct  483  RFKMKLVEYYYSQIYGSTALERIKEASDGIKELFNAY-----SICSTLIDQGSALPGSSL  537

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +    T +  L  FD F+ ETS SQ + S+L++YL+E + PR  +F+++ WW+++  +Y
Sbjct  538  PSSSNDTRD-RLKGFDKFLHETSQSQTAISDLEKYLDEPVFPRNCDFNILNWWRVHTPRY  596

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            P LS MARD+L  P+ST   +  F+   + +D  + SL P+T +AL+C +DW
Sbjct  597  PILSMMARDVLGTPMSTIAQEFAFNAGGRMLDSNQSSLPPDTQQALICTRDW  648



>ref|XP_009356659.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Pyrus x bretschneideri]
Length=657

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 107/178 (60%), Gaps = 5/178 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ + K++G  A +++    E +  L+ ++      L      +  GG+ +  
Sbjct  481  RFKMKLVEYYYGKVFGSGAPSHISGAFECVKALYNEHSNCLASLDQIVPWQV-GGSSHFP  539

Query  558  DAQELSTNELGLTDFDAFIMETSS-QQSRSELDQYLEESLLPR-VHEFDVVGWWKLNRMK  385
             ++  S + L  + FD +I ET+    ++S+LD+YLEE   PR    FD++ WWK++  +
Sbjct  540  GSERESGDRL--SGFDKYIEETTQIDGTKSDLDKYLEEHAFPRHAPGFDILNWWKVHAPR  597

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            YP LS MAR++L +PVS    DS F+T  + +DR   S+ P TV+AL+CA+DW ++EL
Sbjct  598  YPVLSMMARNVLGIPVSKVAKDSAFNTGGRVLDRDWSSMNPATVQALMCARDWIRSEL  655



>ref|XP_009374223.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Pyrus x bretschneideri]
Length=284

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 99/182 (54%), Gaps = 31/182 (17%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDA-----------STYVRIVDEGIHELFQDYVALPLPLTPTYI  592
            R+K++ VE+ + K+YG++            + + R +DE  H L    V+ P+  TPT  
Sbjct  115  RYKLQFVEWGYDKLYGKELRKLKDVSGTLFALFARYMDEFSHLL----VSNPVNQTPT--  168

Query  591  EEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVV  412
                          ++   +    +FD      S+   ++EL  YLEE  L R  E D++
Sbjct  169  --------------QIKVGDKLFEEFDNIYQNRSTSVEKTELHLYLEEKRLDRKQELDIL  214

Query  411  GWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAK  232
             WWKL + +YP LS MA D+LT+P+ST  ++SVFS   + +D+YR SL PETV+AL+C +
Sbjct  215  SWWKLEQFRYPVLSCMASDVLTIPISTVASESVFSISGRVLDQYRSSLLPETVQALLCTR  274

Query  231  DW  226
            DW
Sbjct  275  DW  276



>ref|XP_009374222.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 99/182 (54%), Gaps = 31/182 (17%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDA-----------STYVRIVDEGIHELFQDYVALPLPLTPTYI  592
            R+K++ VE+ + K+YG++            + + R +DE  H L    V+ P+  TPT  
Sbjct  115  RYKLQFVEWGYDKLYGKELRKLKDVSGTLFALFARYMDEFSHLL----VSNPVNQTPT--  168

Query  591  EEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVV  412
                          ++   +    +FD      S+   ++EL  YLEE  L R  E D++
Sbjct  169  --------------QIKVGDKLFEEFDNIYQNRSTSVEKTELHLYLEEKRLDRKQELDIL  214

Query  411  GWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAK  232
             WWKL + +YP LS MA D+LT+P+ST  ++SVFS   + +D+YR SL PETV+AL+C +
Sbjct  215  SWWKLEQFRYPVLSCMASDVLTIPISTVASESVFSISGRVLDQYRSSLLPETVQALLCTR  274

Query  231  DW  226
            DW
Sbjct  275  DW  276



>emb|CDY20085.1| BnaA01g29170D [Brassica napus]
Length=675

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 100/177 (56%), Gaps = 8/177 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNT  562
            RFKMKLVE+ +SKIYG  A   ++ V  G+ EL   Y +   +    ++    +G     
Sbjct  490  RFKMKLVEYYYSKIYGSTALDRIKEVSNGVKELLDAYSICSAIGDDSSFSGGGSGLGRGG  549

Query  561  QDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
             DA++       L  FD F+ ETS +Q + S+LD+YL E + PR  EF+++ +WK++  +
Sbjct  550  MDARD------RLKGFDKFLHETSQNQNTTSDLDKYLSEPIFPRSGEFNILNYWKVHTPR  603

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YP LS MARDIL  P+S   ADS F +    +D  + SL P+  +AL CA DW   E
Sbjct  604  YPVLSMMARDILGTPMSILGADSAFDSGRPVVDESKSSLNPDIRQALFCAHDWLSTE  660



>ref|XP_008343867.1| PREDICTED: uncharacterized protein LOC103406660 [Malus domestica]
Length=435

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 100/179 (56%), Gaps = 25/179 (14%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY--------VALPLPLTPTYIEEA  583
            R+K++ VE+ + K+YG++ S  ++ V   +  LF  Y        V+ P+  TPT     
Sbjct  39   RYKLQFVEWGYDKLYGKE-SRELKDVSGTLFALFGSYMDKFSHLLVSNPVNQTPT-----  92

Query  582  NGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWW  403
                       E+   +    +FD    + S+   ++EL+ YLEE  L R  E D++ WW
Sbjct  93   -----------EIKVGDKLFEEFDNIYQDGSTLVEKTELNLYLEEKRLDRKQELDILSWW  141

Query  402  KLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            K  + +YP LS+MA D+LT+P+ST  ++S FS   + +D+YR SL PETV+AL+C +DW
Sbjct  142  KXEQFRYPVLSRMASDVLTIPISTVASESAFSISGRVLDQYRSSLLPETVQALLCTRDW  200



>emb|CAE04247.3| OSJNBa0089N06.8 [Oryza sativa Japonica Group]
 emb|CAJ86373.1| OSIGBa0117N13.17 [Oryza sativa Indica Group]
 emb|CAJ86423.1| H0303G06.12 [Oryza sativa Indica Group]
Length=802

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 100/174 (57%), Gaps = 12/174 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFK   +EF   + +G D+++Y+ ++ E + ELF +Y               N  +    
Sbjct  640  RFKFSFIEFRLKRAFGTDSASYLSVIRETVRELFNEYC-----------HSLNQASDVVS  688

Query  558  DAQELSTNEL-GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +++ L  ++   L D+D  + E +S+Q  SELD YLE+ L+PR  +FD++ WW  +  KY
Sbjct  689  NSEALCADDNDSLEDWDQHLHEQASRQLSSELDDYLEDGLVPRKDDFDILNWWMTHSTKY  748

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTL+ +ARDIL +P S   +++ FS+    + +++ +L   T+EALVC +DW +
Sbjct  749  PTLATIARDILAMPASAVQSEAAFSSSGPVIPKHQSTLNIRTIEALVCTRDWMR  802



>ref|XP_006407043.1| hypothetical protein EUTSA_v10020233mg [Eutrema salsugineum]
 gb|ESQ48496.1| hypothetical protein EUTSA_v10020233mg [Eutrema salsugineum]
Length=662

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 97/176 (55%), Gaps = 7/176 (4%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVE+ +SKIYG  A   ++ V  G+ EL   Y               +G A  + 
Sbjct  484  RFKMKLVEYYYSKIYGSVALDRIKEVSNGVKELLDAYSMCSSIDGEDSSFSGSGLARGSM  543

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            D ++       L  FD F+ ETS +Q + S+LD+YL E + PR  EF+++ +WK++  +Y
Sbjct  544  DTRD------RLKGFDKFLHETSQNQNTTSDLDKYLSEPIFPRSGEFNILNYWKVHTPRY  597

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            P LS MARDIL  P+S    DS F++    +D  + SL P+  +AL CA DW   E
Sbjct  598  PILSMMARDILGTPMSILAPDSTFNSGRPVIDESKSSLSPDIRQALFCAHDWLSTE  653



>ref|NP_001053960.1| Os04g0628400 [Oryza sativa Japonica Group]
 dbj|BAF15874.1| Os04g0628400 [Oryza sativa Japonica Group]
 dbj|BAG94042.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78067.1| hypothetical protein OsI_17533 [Oryza sativa Indica Group]
Length=811

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 100/174 (57%), Gaps = 12/174 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFK   +EF   + +G D+++Y+ ++ E + ELF +Y               N  +    
Sbjct  649  RFKFSFIEFRLKRAFGTDSASYLSVIRETVRELFNEYC-----------HSLNQASDVVS  697

Query  558  DAQELSTNEL-GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +++ L  ++   L D+D  + E +S+Q  SELD YLE+ L+PR  +FD++ WW  +  KY
Sbjct  698  NSEALCADDNDSLEDWDQHLHEQASRQLSSELDDYLEDGLVPRKDDFDILNWWMTHSTKY  757

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  220
            PTL+ +ARDIL +P S   +++ FS+    + +++ +L   T+EALVC +DW +
Sbjct  758  PTLATIARDILAMPASAVQSEAAFSSSGPVIPKHQSTLNIRTIEALVCTRDWMR  811



>ref|XP_010035892.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Eucalyptus grandis]
 ref|XP_010035893.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Eucalyptus grandis]
 ref|XP_010035894.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Eucalyptus grandis]
 gb|KCW47397.1| hypothetical protein EUGRSUZ_K01194 [Eucalyptus grandis]
 gb|KCW47398.1| hypothetical protein EUGRSUZ_K01194 [Eucalyptus grandis]
Length=663

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 113/184 (61%), Gaps = 15/184 (8%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEA--NGGAVN  565
            RFKMKLVE+ F +IYG  +   +  +   I  L+ ++ ++  PL+  +  +A   GG+  
Sbjct  485  RFKMKLVEYYFPQIYGSTSLERIDEISSRIKALYNEH-SIGSPLSTLHHGQAWQVGGSTG  543

Query  564  T-----QDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWW  403
            +      DA++       L  FD F+ ETS S  ++S+LD+YLEE L PR  +F+V+ WW
Sbjct  544  SLSGPGNDAKD------RLVGFDKFLNETSQSDGTKSDLDKYLEEPLFPRNVDFNVLNWW  597

Query  402  KLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQ  223
            K++  +YP LS MAR++L  P+S   ++SVF+   + ++R R SL   T++AL+C++DW 
Sbjct  598  KVHTPRYPILSMMARNVLGTPMSKVHSESVFNMGGRVLERDRSSLSSATLQALMCSQDWI  657

Query  222  QNEL  211
            ++EL
Sbjct  658  KSEL  661



>ref|XP_008784137.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Phoenix dactylifera]
 ref|XP_008784138.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Phoenix dactylifera]
Length=232

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 104/191 (54%), Gaps = 31/191 (16%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYG--EDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVN  565
            R+KMKL+++ F KIYG  + AS  ++ V + +  L+ DY  L             G  V+
Sbjct  30   RYKMKLIKYCFQKIYGNGDRASFEIKKVYDVLQNLYDDYTIL------------YGANVS  77

Query  564  TQDAQELSTNELG-------LTDFDAFIMETS-SQQSRSELDQYLEESLLPRVH-----E  424
                + + +   G       L D+  FI E   +Q  +SE++ YLEE    +VH      
Sbjct  78   HVQVEAMVSTSHGRGDESFFLQDYKKFIREKEVAQPFKSEIEMYLEE----KVHSLGDQN  133

Query  423  FDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEAL  244
            FD++ +W+ N  KYP LS+M RDIL +PVST   +S FST  + +D +R SL P+ VEAL
Sbjct  134  FDILDYWRFNESKYPILSRMVRDILAIPVSTVAFESAFSTTGRVLDDFRSSLSPDMVEAL  193

Query  243  VCAKDWQQNEL  211
            +C +DW ++ L
Sbjct  194  ICTQDWLRDTL  204



>ref|XP_009116606.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Brassica rapa]
 ref|XP_009116614.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Brassica rapa]
 ref|XP_009116622.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Brassica rapa]
 ref|XP_009116629.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Brassica rapa]
Length=675

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 100/177 (56%), Gaps = 8/177 (5%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNT  562
            RFKMKLVE+ +SKIYG  A   ++ V  G+ EL   Y +   +    ++    +G     
Sbjct  490  RFKMKLVEYYYSKIYGSTALDRIKEVSNGVKELLDAYSICSAIGDDSSFSGGGSGLGRGG  549

Query  561  QDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMK  385
             DA++       L  FD F+ ETS +Q + S+LD+YL E + PR  EF+++ +WK++  +
Sbjct  550  MDARD------RLKGFDKFLHETSQNQNTTSDLDKYLSEPIFPRSGEFNILNYWKVHTPR  603

Query  384  YPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
            YP LS MARDIL  P+S   ADS F +    +D  + SL P+  +AL CA DW   E
Sbjct  604  YPVLSMMARDILGTPMSILGADSAFDSGRPVVDDSKSSLNPDIRQALFCAHDWLSTE  660



>ref|XP_007048823.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
 gb|EOX92980.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
Length=657

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 111/181 (61%), Gaps = 12/181 (7%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE----EANGGA  571
            RFKMKL+E+ + ++YG+ AS  +  V E I  L+ ++ ++  PL  +  +    + +G  
Sbjct  482  RFKMKLLEYYYPQLYGDSASELIDDVFECIKSLYNEH-SMVSPLASSLDQGLSWQVSGIP  540

Query  570  VNTQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  394
             + +D+++       L  FD F+ ETS S  S S+LD+YLE+ L PR  +F+++ WWK++
Sbjct  541  GSGKDSRD------RLMGFDKFLHETSQSDGSNSDLDKYLEDPLFPRNVDFNILNWWKVH  594

Query  393  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  214
               YP LS MA +IL +P+S   A+S F T  + +D    SL P TV+AL+C++DW ++E
Sbjct  595  TPSYPILSMMAHNILGIPISKVAAESTFDTGGRVVDHNWSSLPPTTVQALMCSQDWIRSE  654

Query  213  L  211
            L
Sbjct  655  L  655



>gb|EYU28909.1| hypothetical protein MIMGU_mgv1a002591mg [Erythranthe guttata]
Length=656

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 109/172 (63%), Gaps = 10/172 (6%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            R+KM+LVE+ + +IYG+ A   + IV   +  L+  + A+  PL+      A+G +  ++
Sbjct  483  RYKMQLVEYYYPQIYGDSAPDCIDIVKNCMKALYSGH-AIYSPLS------AHGQSSASE  535

Query  558  DAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
             +  +  ++L  T FD F+ ETS SQ ++S+LD+YLEE L PR +   V+ WWK++  +Y
Sbjct  536  SSVSIVKDKL--TGFDRFLHETSVSQNTKSDLDKYLEEPLFPRKNVISVLNWWKVHEPRY  593

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  226
            P LS MAR+IL +P+S    +S+F T  + +D    +++ +T++AL+C++DW
Sbjct  594  PVLSMMARNILGIPISKVAVESLFDTGERALDHCWSTMKSDTLQALMCSRDW  645



>gb|KHN18108.1| Putative AC transposase [Glycine soja]
Length=527

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 111/179 (62%), Gaps = 5/179 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIE-EANGGAVN  565
            RFKMKLV++ + +I+G  ++  +  V +G+  L+ ++ +  PL      +  +   G++ 
Sbjct  349  RFKMKLVDYYYPQIFGSMSANRIEEVFDGVKALYNEHSICSPLASHDQGLAWQVGNGSLL  408

Query  564  TQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
             Q + + S + L    FD F+ ET+  + ++S+LD+YLEE L PR  +F+++ WW+++  
Sbjct  409  LQGSAKDSRDRL--MGFDKFLHETTQGEGTKSDLDKYLEEPLFPRNVDFNILNWWRVHTP  466

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            +YP LS MAR++L +P+S    +  F+   + +DR   SL P TV+ALVC++DW ++EL
Sbjct  467  RYPVLSMMARNVLGIPMSKVAPELAFNHSARVLDRDWSSLNPATVQALVCSQDWIRSEL  525



>ref|XP_007146367.1| hypothetical protein PHAVU_006G034500g [Phaseolus vulgaris]
 gb|ESW18361.1| hypothetical protein PHAVU_006G034500g [Phaseolus vulgaris]
Length=663

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 111/179 (62%), Gaps = 5/179 (3%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIE-EANGGAVN  565
            RFKMKLV++ + +IYG  +++ +  V +G+  L+ ++ +  PL      +  +   G + 
Sbjct  485  RFKMKLVDYYYPQIYGSMSASRIEEVFDGVKALYNEHSIGSPLASHDQGLAWQVGNGPLL  544

Query  564  TQDAQELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRM  388
             Q + + S + L    FD F+ ETS  + ++S+LD+YLEE L PR  +F+++ WW+++  
Sbjct  545  LQGSAKDSRDRL--MGFDKFLHETSQGEGTKSDLDKYLEEPLFPRNVDFNILNWWRVHTP  602

Query  387  KYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  211
            +YP LS MAR++L +P++    +  F+   + +DR   SL P TV+ALVC++DW ++EL
Sbjct  603  RYPVLSMMARNVLGIPMAKVAPELAFNHSGRVLDRDWSSLNPATVQALVCSQDWIRSEL  661



>ref|XP_011082213.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=236

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 104/200 (52%), Gaps = 18/200 (9%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYV--RIVDEGIHELFQDY-----VALPLPLTPTYIEEAN  580
            R K+  VEFSF K+YG      V    V +G+HELF DY      AL   L       ++
Sbjct  32   RHKLGFVEFSFDKLYGGIGQNDVMKERVRDGLHELFNDYKLRYGYALQGTLESPGSSSSH  91

Query  579  GGAVNTQDAQ------ELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFD  418
              + ++   +      E  T    L       M       +SEL++YL E +     +FD
Sbjct  92   VSSSSSSSKEMFMHDEESETRRFSLQQEYMMYMTGGKDHVKSELEKYLGEDVEEYREKFD  151

Query  417  VVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVC  238
            ++ WWK+N  ++P LSKMARDIL VPVST  +++ FST    +D +R SL P+ V+A++C
Sbjct  152  ILKWWKVNTQRFPILSKMARDILAVPVSTVASEAAFSTGGHVLDAFRSSLSPKIVQAIIC  211

Query  237  AKDWQQNELVKSITAPIKME  178
            A+DW     ++  + PI +E
Sbjct  212  AQDW-----IRKDSKPISIE  226



>ref|XP_008804919.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=134

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 82/120 (68%), Gaps = 5/120 (4%)
 Frame = -3

Query  519  DFDAFIMETSSQQ-SRSELDQYLEESLLPRVH--EFDVVGWWKLNRMKYPTLSKMARDIL  349
            DF  F  ++SS++  RSELD YL++ +LP +   EFD++ WWK N   YP LS+MARD+L
Sbjct  2    DFAQFRSQSSSKRLKRSELDNYLDDDVLPDLENKEFDILAWWKSNAAVYPILSRMARDVL  61

Query  348  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW--QQNELVKSITAPIKMEV  175
             +PVST  ++S FST  + +D+YR SL P TVEALVC +DW  +Q + V + ++ + + V
Sbjct  62   AIPVSTVSSESAFSTGGRVVDQYRSSLSPSTVEALVCTQDWLREQYDEVANCSSSVTLNV  121



>ref|XP_009759412.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=364

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 103/191 (54%), Gaps = 15/191 (8%)
 Frame = -3

Query  738  RFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ  559
            RFKMKLVEF  ++IYGE+    ++ V      LFQ+Y +  +    ++   ++       
Sbjct  163  RFKMKLVEFYLAQIYGEETLHKIQEVRNHCFNLFQEYTSRVVASHESFQASSSNEVAGVV  222

Query  558  DAQELSTNELGLTDFDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  382
            +   LS+       FD F+  +S+    RSEL+ YLEE +L R   FD + WWK N +K+
Sbjct  223  EGDRLSS-------FDRFVASSSANVDPRSELESYLEEGVLSRTPSFDSLSWWKTNILKF  275

Query  381  PTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  202
            PTL K+ARD+L +P+ST  ++S FST  + +  +R  L P T+E  +       N L + 
Sbjct  276  PTLQKIARDLLAIPISTVASESAFSTSGRLISPHRSRLHPTTLECGL-------NFLPQK  328

Query  201  ITAPIKMEVPI  169
               PI+  +P+
Sbjct  329  QLLPIEQTIPV  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515