BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048H13

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010450398.1|  PREDICTED: glutamine synthetase, chloroplast...    308   7e-103   Camelina sativa [gold-of-pleasure]
ref|XP_011090823.1|  PREDICTED: glutamine synthetase leaf isozyme...    317   1e-102   Sesamum indicum [beniseed]
ref|NP_001284439.1|  glutamine synthetase leaf isozyme, chloropla...    316   3e-102   Cucumis melo [Oriental melon]
ref|XP_008438737.1|  PREDICTED: glutamine synthetase leaf isozyme...    315   5e-102   Cucumis melo [Oriental melon]
gb|AAD31898.1|AF145480_1  glutamine synthetase leaf isozyme precu...    315   7e-102   Mesembryanthemum crystallinum
ref|XP_004167630.1|  PREDICTED: glutamine synthetase leaf isozyme...    308   1e-101   
gb|AAN84539.1|  putative plastidic glutamine synthetase                 307   2e-101   Gazania splendens
ref|XP_010255852.1|  PREDICTED: glutamine synthetase leaf isozyme...    314   2e-101   Nelumbo nucifera [Indian lotus]
ref|XP_011071523.1|  PREDICTED: glutamine synthetase leaf isozyme...    313   3e-101   Sesamum indicum [beniseed]
ref|XP_010041422.1|  PREDICTED: glutamine synthetase leaf isozyme...    312   7e-101   Eucalyptus grandis [rose gum]
ref|XP_010035905.1|  PREDICTED: glutamine synthetase leaf isozyme...    312   1e-100   Eucalyptus grandis [rose gum]
ref|XP_010035896.1|  PREDICTED: glutamine synthetase leaf isozyme...    312   1e-100   Eucalyptus grandis [rose gum]
gb|KDP40083.1|  hypothetical protein JCGZ_02081                         312   1e-100   Jatropha curcas
ref|XP_010041423.1|  PREDICTED: glutamine synthetase leaf isozyme...    310   1e-100   Eucalyptus grandis [rose gum]
gb|AIR07818.1|  chloroplastic glutamine synthetase GS2                  306   1e-100   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|ABL89188.2|  plastid glutamine synthetase 2                          311   2e-100   Spinacia oleracea
ref|XP_006593484.1|  PREDICTED: glutamine synthetase precursor is...    311   3e-100   Glycine max [soybeans]
ref|XP_010542001.1|  PREDICTED: glutamine synthetase, chloroplast...    311   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_003546121.1|  PREDICTED: glutamine synthetase leaf isozyme...    311   3e-100   Glycine max [soybeans]
ref|XP_009391592.1|  PREDICTED: glutamine synthetase leaf isozyme...    311   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN37551.1|  Glutamine synthetase leaf isozyme, chloroplastic        311   4e-100   Glycine soja [wild soybean]
gb|ACF17656.1|  putative glutamine synthase 2                           311   4e-100   Capsicum annuum
gb|KJB28233.1|  hypothetical protein B456_005G035800                    310   4e-100   Gossypium raimondii
ref|XP_006395952.1|  hypothetical protein EUTSA_v10004280mg             310   4e-100   Eutrema salsugineum [saltwater cress]
ref|XP_008223033.1|  PREDICTED: glutamine synthetase leaf isozyme...    310   5e-100   Prunus mume [ume]
sp|O22506.1|GLNA2_DAUCA  RecName: Full=Glutamine synthetase, chlo...    310   6e-100   Daucus carota [carrots]
ref|XP_004134161.1|  PREDICTED: glutamine synthetase leaf isozyme...    310   6e-100   Cucumis sativus [cucumbers]
ref|XP_002516801.1|  glutamine synthetase plant, putative               310   7e-100   Ricinus communis
gb|EYU43846.1|  hypothetical protein MIMGU_mgv1a010285mg                306   8e-100   Erythranthe guttata [common monkey flower]
ref|XP_009417914.1|  PREDICTED: glutamine synthetase leaf isozyme...    310   8e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADK27329.1|  plastid glutamine synthetase                            310   8e-100   Vigna radiata [mung bean]
ref|XP_009124267.1|  PREDICTED: glutamine synthetase, chloroplastic     310   9e-100   Brassica rapa
ref|XP_010557680.1|  PREDICTED: glutamine synthetase, chloroplast...    310   9e-100   Tarenaya hassleriana [spider flower]
gb|AGV54414.1|  glutamine synthetase                                    310   9e-100   Phaseolus vulgaris [French bean]
gb|ABY87178.1|  chloroplast glutamine synthetase                        309   1e-99    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009108017.1|  PREDICTED: glutamine synthetase, chloroplast...    309   1e-99    Brassica rapa
ref|XP_007147796.1|  hypothetical protein PHAVU_006G155800g             309   1e-99    Phaseolus vulgaris [French bean]
ref|XP_010666333.1|  PREDICTED: glutamine synthetase leaf isozyme...    309   1e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|AAF17703.1|AF031082_1  glutamine synthetase                          309   1e-99    Canavalia lineata
gb|ACU24520.1|  unknown                                                 309   2e-99    Glycine max [soybeans]
ref|XP_007222384.1|  hypothetical protein PRUPE_ppa006025mg             309   2e-99    Prunus persica
dbj|BAF62340.1|  glutamine synthetase                                   309   2e-99    Avicennia marina
gb|KHG04493.1|  Glutamine synthetase leaf isozyme, chloroplastic        308   2e-99    Gossypium arboreum [tree cotton]
ref|XP_004486102.1|  PREDICTED: glutamine synthetase leaf isozyme...    308   3e-99    Cicer arietinum [garbanzo]
ref|XP_002279497.1|  PREDICTED: glutamine synthetase leaf isozyme...    308   4e-99    Vitis vinifera
ref|XP_002868428.1|  hypothetical protein ARALYDRAFT_493621             308   4e-99    
emb|CDO98975.1|  unnamed protein product                                308   4e-99    Coffea canephora [robusta coffee]
ref|XP_002274139.1|  PREDICTED: glutamine synthetase leaf isozyme...    308   4e-99    Vitis vinifera
ref|NP_198413.1|  glutamine synthetase 2                                308   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237784.1|  glutamine synthetase precursor                     308   4e-99    
emb|CAN61808.1|  hypothetical protein VITISV_014295                     308   5e-99    Vitis vinifera
ref|XP_006282617.1|  hypothetical protein CARUB_v10004865mg             308   5e-99    Capsella rubella
ref|XP_010435449.1|  PREDICTED: glutamine synthetase, chloroplast...    308   5e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010435452.1|  PREDICTED: glutamine synthetase, chloroplast...    307   5e-99    
ref|XP_010450396.1|  PREDICTED: glutamine synthetase, chloroplast...    308   5e-99    Camelina sativa [gold-of-pleasure]
gb|AAO37651.1|  glutamine synthetase                                    307   6e-99    Medicago truncatula
ref|XP_010435447.1|  PREDICTED: glutamine synthetase, chloroplast...    308   7e-99    
ref|XP_008390805.1|  PREDICTED: glutamine synthetase leaf isozyme...    307   7e-99    Malus domestica [apple tree]
emb|CDY33684.1|  BnaC04g29670D                                          309   7e-99    Brassica napus [oilseed rape]
sp|Q9XQ94.1|GLNA2_MEDSA  RecName: Full=Glutamine synthetase leaf ...    307   7e-99    Medicago sativa [alfalfa]
emb|CAA73062.1|  plastidic glutamine synthetase precursor               307   7e-99    Brassica napus [oilseed rape]
ref|XP_009352136.1|  PREDICTED: glutamine synthetase leaf isozyme...    307   8e-99    Pyrus x bretschneideri [bai li]
gb|KJB37729.1|  hypothetical protein B456_006G218100                    307   1e-98    Gossypium raimondii
ref|XP_009773609.1|  PREDICTED: glutamine synthetase, chloroplastic     307   1e-98    Nicotiana sylvestris
ref|XP_004229461.1|  PREDICTED: glutamine synthetase, chloroplastic     307   1e-98    
ref|XP_009629915.1|  PREDICTED: glutamine synthetase, chloroplastic     306   1e-98    Nicotiana tomentosiformis
ref|XP_009339932.1|  PREDICTED: glutamine synthetase leaf isozyme...    306   1e-98    Pyrus x bretschneideri [bai li]
gb|AAD49734.1|AF169795_1  glutamine synthetase precursor                306   2e-98    Juglans nigra
gb|AAN84537.1|  putative plastidic glutamine synthetase                 306   2e-98    Crataegus crus-galli
ref|XP_008353244.1|  PREDICTED: glutamine synthetase leaf isozyme...    306   2e-98    
prf||1601519A  Gln synthetase                                           306   2e-98 
gb|AAA50249.1|  glutamine synthetase                                    297   2e-98    Solanum lycopersicum
gb|EYU45601.1|  hypothetical protein MIMGU_mgv1a007136mg                305   4e-98    Erythranthe guttata [common monkey flower]
emb|CAA29057.1|  gluthamine synthetase                                  303   6e-98    Pisum sativum [garden pea]
sp|P08281.2|GLNA2_PEA  RecName: Full=Glutamine synthetase leaf is...    305   6e-98    Pisum sativum [garden pea]
gb|AAO85217.1|  glutamine synthetase PR1 mutant                         305   8e-98    Lotus japonicus
gb|AAN84563.1|  glutamine synthetase                                    304   1e-97    Lotus japonicus
emb|CAB72423.1|  glutamine synthetase                                   304   1e-97    Brassica napus [oilseed rape]
gb|AAB61302.1|  chloroplastic glutamine synthetase                      295   1e-97    Helianthus annuus
gb|KDO74872.1|  hypothetical protein CISIN_1g013478mg                   304   1e-97    Citrus sinensis [apfelsine]
gb|AJI44225.1|  plastid glutamine synthetase                            304   1e-97    Boehmeria nivea [Chinese silk-plant]
gb|KDO74871.1|  hypothetical protein CISIN_1g013478mg                   304   2e-97    Citrus sinensis [apfelsine]
gb|KDO74875.1|  hypothetical protein CISIN_1g013478mg                   304   3e-97    Citrus sinensis [apfelsine]
ref|XP_007034566.1|  Glutamine synthetase 2                             306   4e-97    
gb|ACU18743.1|  unknown                                                 303   4e-97    Glycine max [soybeans]
gb|AJD14836.1|  plastid glutamine synthetase                            303   5e-97    Boehmeria nivea [Chinese silk-plant]
ref|XP_008812802.1|  PREDICTED: glutamine synthetase leaf isozyme...    293   6e-97    
gb|AAO85218.1|  glutamine synthetase PR2 mutant                         302   9e-97    Lotus japonicus
ref|XP_006419778.1|  hypothetical protein CICLE_v10005007mg             301   1e-96    Citrus clementina [clementine]
gb|AFH88076.1|  chloroplast glutamine synthetase protein                301   1e-96    Sesuvium portulacastrum [sea-purslane]
gb|AAL67439.1|  glutamine synthetase precursor                          301   3e-96    Lotus japonicus
ref|XP_010938796.1|  PREDICTED: glutamine synthetase leaf isozyme...    300   4e-96    Elaeis guineensis
ref|XP_002314425.1|  glutamine synthetase family protein                300   8e-96    Populus trichocarpa [western balsam poplar]
gb|AAN84538.1|  putative plastidic glutamine synthetase                 299   1e-95    Spiraea nipponica
ref|XP_010105702.1|  Glutamine synthetase leaf isozyme                  299   1e-95    Morus notabilis
ref|XP_002312733.1|  glutamine synthetase family protein                299   1e-95    
ref|XP_011009035.1|  PREDICTED: glutamine synthetase leaf isozyme...    299   2e-95    Populus euphratica
gb|AHJ10961.1|  chloroplast glutamine synthetase 2 isoform 1            298   2e-95    Lemna minor
ref|XP_011006593.1|  PREDICTED: glutamine synthetase leaf isozyme...    298   2e-95    Populus euphratica
ref|NP_001275177.1|  glutamine synthetase, chloroplastic-like           298   3e-95    Solanum tuberosum [potatoes]
ref|XP_011462784.1|  PREDICTED: glutamine synthetase leaf isozyme...    297   6e-95    Fragaria vesca subsp. vesca
ref|NP_001054133.1|  Os04g0659100                                       296   1e-94    
gb|ACO59263.1|  chloroplast glutamine synthetase                        292   2e-94    Populus x canadensis [Canadian poplar]
dbj|BAD12057.1|  plastidic glutamine synthetase                         296   2e-94    Phragmites australis
ref|XP_006653841.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    295   2e-94    
dbj|BAD12059.1|  plastidic glutamine synthetase                         295   3e-94    Phragmites australis
gb|ACG31728.1|  hypothetical protein                                    292   1e-93    Zea mays [maize]
ref|XP_008662331.1|  PREDICTED: glutamine synthetase, chloroplast...    293   1e-93    
ref|NP_001105725.1|  glutamine synthetase, chloroplastic precursor      293   2e-93    
gb|ADM45299.1|  chloroplast GS2b-alpha precursor                        293   2e-93    Medicago truncatula
ref|XP_004960149.1|  PREDICTED: glutamine synthetase, chloroplast...    293   2e-93    Setaria italica
gb|AAB61303.1|  chloroplastic glutamine synthetase                      284   2e-93    Helianthus annuus
gb|AHJ10962.1|  chloroplast glutamine synthetase 2 isoform 2            293   3e-93    Lemna minor
ref|XP_003580719.1|  PREDICTED: glutamine synthetase, chloroplastic     293   3e-93    Brachypodium distachyon [annual false brome]
gb|AAB61304.1|  chloroplastic glutamine synthetase                      284   3e-93    Helianthus annuus
dbj|BAL45315.1|  glutamine synthetase                                   287   5e-93    Boykinia occidentalis
gb|ACG35376.1|  glutamine synthetase                                    292   5e-93    Zea mays [maize]
ref|XP_008662330.1|  PREDICTED: glutamine synthetase, chloroplast...    295   7e-93    Zea mays [maize]
ref|XP_006850815.1|  hypothetical protein AMTR_s00025p00120730          292   9e-93    Amborella trichopoda
gb|AAX18864.1|  chloroplast glutamine synthetase                        286   1e-92    Glycine max [soybeans]
ref|XP_003594092.1|  Glutamine synthetase                               309   2e-92    
gb|AAX18865.1|  chloroplast glutamine synthetase                        285   3e-92    Glycine max [soybeans]
emb|CDY49365.1|  BnaA08g29950D                                          288   1e-91    Brassica napus [oilseed rape]
dbj|BAJ91545.1|  predicted protein                                      288   2e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA34131.1|  unnamed protein product                                288   2e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFB69878.1|  chloroplast glutamine synthetase isoform 2-1            288   2e-91    Secale cereale
sp|P13564.2|GLNA2_HORVU  RecName: Full=Glutamine synthetase leaf ...    288   4e-91    Hordeum vulgare [barley]
gb|AAZ30061.1|  plastid glutamine synthetase isoform GS2b               286   9e-91    Triticum aestivum [Canadian hard winter wheat]
gb|AAZ30062.1|  plastid glutamine synthetase isoform GS2c               286   9e-91    Triticum aestivum [Canadian hard winter wheat]
gb|ACT22500.1|  plastid glutamine synthetase 2                          286   9e-91    Triticum aestivum [Canadian hard winter wheat]
gb|ACT22496.1|  plastid glutamine synthetase 2                          286   1e-90    Triticum aestivum [Canadian hard winter wheat]
gb|AAK49029.1|  cytosolic glutamine synthetase                          283   2e-90    Populus tremula x Populus alba [gray poplar]
dbj|BAJ95492.1|  predicted protein                                      286   2e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P52783.1|GLNA_PINSY  RecName: Full=Glutamine synthetase cytoso...    282   7e-90    Pinus sylvestris [Scotch pine]
gb|EMS53309.1|  Glutamine synthetase leaf isozyme, chloroplastic        286   4e-89    Triticum urartu
emb|CAA47373.2|  glutamate--ammonia ligase                              282   6e-89    Nicotiana sylvestris
dbj|BAG49063.1|  glutamine synthetase                                   275   2e-88    Lactuca sativa [cultivated lettuce]
gb|AFW89163.1|  glutamine synthetase3                                   271   3e-88    
gb|EPS69972.1|  glutamine synthetase                                    272   3e-88    Genlisea aurea
emb|CAA52448.1|  glutamate--ammonia ligase                              277   5e-88    Pinus sylvestris [Scotch pine]
ref|XP_001755833.1|  predicted protein                                  277   6e-88    
gb|ABK21449.1|  unknown                                                 277   7e-88    Picea sitchensis
emb|CDO98315.1|  unnamed protein product                                276   1e-87    Coffea canephora [robusta coffee]
gb|AAZ30060.1|  plastid glutamine synthetase isoform GS2a               278   2e-87    Triticum aestivum [Canadian hard winter wheat]
gb|ACF84549.1|  unknown                                                 269   2e-87    Zea mays [maize]
ref|XP_010528562.1|  PREDICTED: glutamine synthetase cytosolic is...    275   2e-87    Tarenaya hassleriana [spider flower]
ref|NP_001267644.1|  glutamine synthetase cytosolic isozyme-like        275   2e-87    Cucumis sativus [cucumbers]
ref|XP_011003750.1|  PREDICTED: glutamine synthetase nodule isozyme     275   3e-87    Populus euphratica
gb|EPS57588.1|  glutamine synthetase                                    273   3e-87    Genlisea aurea
ref|XP_010528561.1|  PREDICTED: glutamine synthetase nodule isozy...    275   3e-87    Tarenaya hassleriana [spider flower]
gb|AGC24240.1|  glutamine synthetase 1                                  271   4e-87    Brassica napus [oilseed rape]
gb|AGC24242.1|  glutamine synthetase 1                                  271   4e-87    Brassica napus [oilseed rape]
gb|AAW21276.1|  chloroplast glutamine synthetase                        268   5e-87    Saccharum officinarum [noble cane]
gb|AGC82199.1|  glutamine synthetase 1                                  271   6e-87    Brassica napus [oilseed rape]
gb|AJD14835.1|  glutamine synthetase                                    274   8e-87    Boehmeria nivea [Chinese silk-plant]
ref|XP_010553887.1|  PREDICTED: glutamine synthetase nodule isozyme     273   1e-86    Tarenaya hassleriana [spider flower]
ref|NP_001284433.1|  glutamine synthetase cytosolic isozyme             273   1e-86    Cucumis melo [Oriental melon]
ref|NP_001239821.1|  cytosolic glutamine synthetase alpha               273   2e-86    Glycine max [soybeans]
ref|XP_004288594.1|  PREDICTED: glutamine synthetase nodule isozyme     273   2e-86    Fragaria vesca subsp. vesca
ref|XP_007036933.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    273   2e-86    
ref|XP_008229355.1|  PREDICTED: glutamine synthetase cytosolic is...    272   2e-86    Prunus mume [ume]
ref|XP_011001555.1|  PREDICTED: glutamine synthetase cytosolic is...    273   2e-86    Populus euphratica
ref|XP_003619869.1|  Glutamine synthetase                               273   2e-86    Medicago truncatula
ref|XP_009370058.1|  PREDICTED: glutamine synthetase cytosolic is...    273   2e-86    Pyrus x bretschneideri [bai li]
ref|XP_010271383.1|  PREDICTED: glutamine synthetase cytosolic is...    273   3e-86    Nelumbo nucifera [Indian lotus]
ref|XP_006288043.1|  hypothetical protein CARUB_v10001277mg             273   3e-86    
ref|XP_009121474.1|  PREDICTED: glutamine synthetase cytosolic is...    273   3e-86    Brassica rapa
prf||1804333C  Gln synthetase                                           275   3e-86 
dbj|BAD11327.1|  glutamine synthetase                                   272   4e-86    Camellia sinensis [black tea]
emb|CDY49656.1|  BnaC09g41340D                                          272   4e-86    Brassica napus [oilseed rape]
gb|AAA21586.1|  glutamine synthetase                                    266   4e-86    Solanum lycopersicum
gb|ABK95973.1|  unknown                                                 272   4e-86    Populus trichocarpa [western balsam poplar]
gb|AGC82204.1|  glutamine synthetase 1                                  268   4e-86    Brassica napus [oilseed rape]
emb|CAA73366.1|  glutamine synthetase                                   272   5e-86    Lotus japonicus
sp|O04867.1|GLNA1_ALNGL  RecName: Full=Glutamine synthetase; AltN...    272   5e-86    Alnus glutinosa
sp|Q42899.2|GLNA1_LOTJA  RecName: Full=Glutamine synthetase cytos...    272   5e-86    Lotus japonicus
ref|XP_002318305.1|  glutamine synthetase family protein                272   5e-86    
ref|XP_009370556.1|  PREDICTED: glutamine synthetase cytosolic is...    271   5e-86    Pyrus x bretschneideri [bai li]
ref|XP_006372556.1|  glutamate-ammonia ligase family protein            272   5e-86    Populus trichocarpa [western balsam poplar]
gb|AAP33167.1|  cytosolic glutamine synthetase                          272   5e-86    Securigera parviflora
emb|CDX69442.1|  BnaA10g17910D                                          272   5e-86    
ref|XP_010420354.1|  PREDICTED: glutamine synthetase cytosolic is...    272   6e-86    Camelina sativa [gold-of-pleasure]
pdb|4IS4|A  Chain A, The Glutamine Synthetase From The Dicotyledo...    273   6e-86    Medicago truncatula
sp|Q43785.1|GLNA3_MEDSA  RecName: Full=Glutamine synthetase nodul...    272   6e-86    Medicago sativa [alfalfa]
ref|XP_009338856.1|  PREDICTED: glutamine synthetase cytosolic is...    272   6e-86    
ref|XP_011083120.1|  PREDICTED: glutamine synthetase cytosolic is...    272   6e-86    Sesamum indicum [beniseed]
gb|AGC24238.1|  glutamine synthetase 1                                  271   7e-86    Brassica napus [oilseed rape]
ref|XP_006828441.1|  hypothetical protein AMTR_s00060p00116070          271   7e-86    Amborella trichopoda
ref|XP_002977477.1|  hypothetical protein SELMODRAFT_151817             272   7e-86    Selaginella moellendorffii
emb|CDY38104.1|  BnaC02g06690D                                          271   7e-86    Brassica napus [oilseed rape]
emb|CAJ87510.1|  putative glutamine synthetase                          271   7e-86    Pisum sativum [garden pea]
gb|AIK03054.1|  glutamine synthetase                                    271   8e-86    Eichhornia crassipes
ref|XP_003528974.1|  PREDICTED: glutamine synthetase PR-2               271   8e-86    Glycine max [soybeans]
ref|XP_002873784.1|  GLN1_4                                             271   8e-86    
gb|ABW89460.1|  glutamine synthetase                                    271   9e-86    Gossypium herbaceum [Arabian cotton]
emb|CAA29058.1|  glutamine synthetase                                   268   1e-85    Pisum sativum [garden pea]
ref|XP_007043312.1|  Glutamine synthetase 1,4                           271   1e-85    
ref|XP_009370554.1|  PREDICTED: glutamine synthetase cytosolic is...    271   1e-85    Pyrus x bretschneideri [bai li]
gb|ABW89463.1|  glutamine synthetase                                    271   1e-85    Gossypium raimondii
gb|ABW89464.1|  glutamine synthetase                                    271   1e-85    Gossypium hirsutum [American cotton]
gb|ABW89462.1|  glutamine synthetase                                    271   1e-85    Gossypium hirsutum [American cotton]
ref|XP_008365754.1|  PREDICTED: glutamine synthetase cytosolic is...    271   1e-85    
ref|XP_011085871.1|  PREDICTED: glutamine synthetase cytosolic is...    271   1e-85    Sesamum indicum [beniseed]
ref|NP_568335.1|  glutamine synthetase 1;4                              271   1e-85    Arabidopsis thaliana [mouse-ear cress]
gb|AFN42876.1|  glutamine synthetase                                    271   1e-85    Camellia sinensis [black tea]
dbj|BAD99525.1|  glutamine synthetase                                   271   1e-85    Camellia sinensis [black tea]
ref|XP_002972155.1|  hypothetical protein SELMODRAFT_270944             271   1e-85    Selaginella moellendorffii
dbj|BAM84282.1|  glutamine synthetase                                   271   1e-85    Tulipa humilis var. pulchella
gb|EYU45782.1|  hypothetical protein MIMGU_mgv1a009017mg                271   1e-85    Erythranthe guttata [common monkey flower]
gb|AIR07816.1|  cytosolic glutamine synthetase 1-1                      269   2e-85    Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AAB61597.1|  glutamine synthetase                                    271   2e-85    Hevea brasiliensis [jebe]
pir||S22527  glutamate-ammonia ligase (EC 6.3.1.2) - tobacco            273   2e-85 
ref|XP_011002191.1|  PREDICTED: glutamine synthetase cytosolic is...    271   2e-85    Populus euphratica
ref|XP_010492569.1|  PREDICTED: glutamine synthetase cytosolic is...    271   2e-85    Camelina sativa [gold-of-pleasure]
ref|NP_176794.1|  glutamine synthetase                                  270   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482120.1|  PREDICTED: glutamine synthetase nodule isozy...    270   2e-85    Citrus sinensis [apfelsine]
gb|AID48673.1|  theanine synthetase                                     270   2e-85    Camellia oleifera [abura-tsubaki]
ref|NP_001185327.1|  glutamine synthetase                               271   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007152660.1|  hypothetical protein PHAVU_004G148300g             270   2e-85    Phaseolus vulgaris [French bean]
ref|NP_001268175.1|  glutamine synthetase cytosolic isozyme 1           270   2e-85    Vitis vinifera
gb|AGC24239.1|  glutamine synthetase 1                                  270   2e-85    Brassica napus [oilseed rape]
ref|XP_009126124.1|  PREDICTED: glutamine synthetase cytosolic is...    270   2e-85    Brassica rapa
ref|XP_006391363.1|  hypothetical protein EUTSA_v10018774mg             270   2e-85    
gb|KHG29839.1|  Glutamine synthetase cytosolic isozyme 1-1              270   2e-85    Gossypium arboreum [tree cotton]
ref|XP_008659016.1|  PREDICTED: glutamine synthetase root isozyme...    268   3e-85    Zea mays [maize]
ref|XP_006844043.1|  hypothetical protein AMTR_s00006p00241880          270   3e-85    Amborella trichopoda
gb|KHG00636.1|  Glutamine synthetase cytosolic isozyme 1                270   3e-85    Gossypium arboreum [tree cotton]
gb|KCW69395.1|  hypothetical protein EUGRSUZ_F02872                     268   3e-85    Eucalyptus grandis [rose gum]
ref|XP_007215605.1|  hypothetical protein PRUPE_ppa007772mg             270   3e-85    Prunus persica
gb|AIR07817.1|  cytosolic glutamine synthetase 1-2                      269   3e-85    Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AJD14834.1|  glutamine synthetase                                    270   3e-85    Boehmeria nivea [Chinese silk-plant]
gb|KDP43303.1|  hypothetical protein JCGZ_24224                         270   3e-85    Jatropha curcas
ref|XP_001782920.1|  predicted protein                                  270   3e-85    
gb|AAR29057.1|  glutamine synthetase 1                                  270   3e-85    Datisca glomerata
dbj|BAA04995.1|  glutamine synthetase                                   270   4e-85    Raphanus sativus
gb|ABK23723.1|  unknown                                                 270   4e-85    Picea sitchensis
gb|KFK41041.1|  hypothetical protein AALP_AA2G077900                    270   4e-85    Arabis alpina [alpine rockcress]
ref|XP_006391364.1|  hypothetical protein EUTSA_v10018774mg             270   4e-85    Eutrema salsugineum [saltwater cress]
emb|CAN68162.1|  hypothetical protein VITISV_015673                     270   4e-85    Vitis vinifera
gb|KCW69394.1|  hypothetical protein EUGRSUZ_F02872                     269   5e-85    Eucalyptus grandis [rose gum]
gb|AAP33169.1|  cytosolic glutamine synthetase                          270   5e-85    Securigera parviflora
dbj|BAL14865.1|  putative cytosolic glutamine synthetase                269   5e-85    Tulipa gesneriana
ref|XP_006374208.1|  glutamine synthetase family protein                269   5e-85    
ref|XP_006360384.1|  PREDICTED: glutamine synthetase nodule isozy...    270   5e-85    Solanum tuberosum [potatoes]
gb|KFK25875.1|  hypothetical protein AALP_AA8G173600                    269   5e-85    Arabis alpina [alpine rockcress]
ref|XP_008358170.1|  PREDICTED: glutamine synthetase cytosolic is...    269   5e-85    
gb|ACJ11724.1|  glutamine synthase                                      269   5e-85    Gossypium hirsutum [American cotton]
gb|ACN40288.1|  unknown                                                 269   5e-85    Picea sitchensis
ref|XP_002305885.1|  glutamate-ammonia ligase family protein            269   5e-85    Populus trichocarpa [western balsam poplar]
emb|CBI33470.3|  unnamed protein product                                269   5e-85    Vitis vinifera
gb|AAW21273.1|  glutamine synthetase                                    269   5e-85    Saccharum officinarum [noble cane]
gb|ABK51388.1|  cytosolic glutamine synthetase                          269   6e-85    Camellia sinensis [black tea]
dbj|BAM84285.1|  glutamine synthetase                                   269   6e-85    Tulipa fosteriana
gb|ABK94916.1|  unknown                                                 269   6e-85    Populus trichocarpa [western balsam poplar]
ref|XP_010453820.1|  PREDICTED: glutamine synthetase cytosolic is...    269   6e-85    Camelina sativa [gold-of-pleasure]
gb|ABW89461.1|  glutamine synthetase                                    269   6e-85    Gossypium hirsutum [American cotton]
dbj|BAD99526.1|  glutamine synthetase                                   269   6e-85    Camellia sinensis [black tea]
ref|XP_011035558.1|  PREDICTED: glutamine synthetase cytosolic is...    269   6e-85    Populus euphratica
gb|AGZ15411.1|  glutamine synthetase PR-2                               269   6e-85    Phaseolus vulgaris [French bean]
ref|XP_004512771.1|  PREDICTED: glutamine synthetase nodule isozy...    269   6e-85    Cicer arietinum [garbanzo]
ref|XP_002888488.1|  ATGSR2                                             269   7e-85    
ref|XP_010062276.1|  PREDICTED: glutamine synthetase nodule isozy...    269   7e-85    Eucalyptus grandis [rose gum]
ref|XP_006430603.1|  hypothetical protein CICLE_v10011785mg             271   7e-85    
emb|CAA63963.1|  glutamate synthetase                                   269   7e-85    Lotus japonicus
ref|XP_007141923.1|  hypothetical protein PHAVU_008G237400g             269   7e-85    Phaseolus vulgaris [French bean]
ref|XP_006828438.1|  hypothetical protein AMTR_s00060p00109730          269   7e-85    Amborella trichopoda
ref|XP_004953842.1|  PREDICTED: glutamine synthetase cytosolic is...    269   7e-85    Setaria italica
ref|XP_004240034.1|  PREDICTED: glutamine synthetase-like               269   7e-85    Solanum lycopersicum
tpg|DAA50997.1|  TPA: glutamine synthetase2                             266   7e-85    
ref|XP_009414782.1|  PREDICTED: glutamine synthetase cytosolic is...    269   7e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008812466.1|  PREDICTED: glutamine synthetase nodule isozyme     269   7e-85    Phoenix dactylifera
ref|XP_009629012.1|  PREDICTED: glutamine synthetase-like               269   8e-85    Nicotiana tomentosiformis
ref|XP_006649656.1|  PREDICTED: glutamine synthetase cytosolic is...    269   9e-85    Oryza brachyantha
sp|P38563.2|GLNA5_MAIZE  RecName: Full=Glutamine synthetase root ...    269   9e-85    Zea mays [maize]
ref|XP_009800983.1|  PREDICTED: glutamine synthetase-like               269   9e-85    Nicotiana sylvestris
ref|XP_004299511.1|  PREDICTED: glutamine synthetase cytosolic is...    269   9e-85    Fragaria vesca subsp. vesca
ref|NP_001105297.1|  glutamine synthetase root isozyme 5                269   1e-84    
ref|XP_004490827.1|  PREDICTED: glutamine synthetase nodule isozy...    269   1e-84    Cicer arietinum [garbanzo]
dbj|BAE98486.1|  glutamine synthetase like protein                      269   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010271347.1|  PREDICTED: glutamine synthetase cytosolic is...    268   1e-84    
emb|CAA73063.1|  cytosolic glutamine synthetase                         268   1e-84    
ref|XP_008461372.1|  PREDICTED: glutamine synthetase nodule isozy...    268   1e-84    
ref|XP_001782914.1|  predicted protein                                  268   1e-84    
gb|ACG47508.1|  glutamine synthetase root isozyme 5                     268   1e-84    
dbj|BAD94626.1|  glutamate--ammonia ligase                              263   1e-84    
ref|XP_004985157.1|  PREDICTED: glutamine synthetase root isozyme...    268   1e-84    
ref|NP_001268054.1|  glutamine synthetase cytosolic isozyme 2           268   1e-84    
ref|XP_006400196.1|  hypothetical protein EUTSA_v10013948mg             268   1e-84    
gb|ABF06665.1|  glutamine synthetase                                    268   1e-84    
ref|XP_006300523.1|  hypothetical protein CARUB_v10020543mg             268   1e-84    
gb|AAN05339.1|  Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISO...    268   1e-84    
gb|KDP25795.1|  hypothetical protein JCGZ_22517                         268   1e-84    
ref|XP_004981993.1|  PREDICTED: glutamine synthetase cytosolic is...    268   2e-84    
gb|AAB03492.1|  cytosolic glutamine synthetase                          268   2e-84    
gb|AAM63710.1|  glutamine synthetase, putative                          268   2e-84    
gb|AAD31899.1|AF145481_1  cytosolic glutamine synthetase                268   2e-84    
gb|ABX79672.1|  glutamine synthetase                                    268   2e-84    
emb|CAA06383.1|  glutamine synthetase                                   268   2e-84    
gb|KFK33302.1|  hypothetical protein AALP_AA6G357500                    268   2e-84    
ref|XP_011022058.1|  PREDICTED: glutamine synthetase cytosolic is...    268   2e-84    
ref|XP_010250142.1|  PREDICTED: glutamine synthetase nodule isozyme     268   2e-84    
ref|XP_010103463.1|  Glutamine synthetase nodule isozyme                268   2e-84    
ref|XP_008460506.1|  PREDICTED: glutamine synthetase nodule isozy...    268   2e-84    
ref|NP_001105296.1|  glutamine synthetase root isozyme 3                268   2e-84    
ref|NP_001049424.1|  Os03g0223400                                       268   2e-84    
ref|XP_002306385.1|  glutamine synthetase family protein                268   2e-84    
sp|P08282.2|GLNA1_PEA  RecName: Full=Glutamine synthetase nodule ...    268   2e-84    
ref|XP_003544980.1|  PREDICTED: glutamine synthetase cytosolic is...    268   2e-84    
ref|XP_006346760.1|  PREDICTED: glutamine synthetase cytosolic is...    268   2e-84    
emb|CCO25538.1|  glutamine synthetase                                   268   2e-84    
sp|P07694.1|GLNA3_PEA  RecName: Full=Glutamine synthetase root is...    268   2e-84    
ref|XP_004236686.1|  PREDICTED: glutamine synthetase cytosolic is...    268   2e-84    
ref|XP_002310666.1|  glutamine synthetase family protein                268   2e-84    
ref|XP_002989575.1|  hypothetical protein SELMODRAFT_184683             268   3e-84    
ref|XP_010916212.1|  PREDICTED: glutamine synthetase nodule isozy...    268   3e-84    
ref|XP_011073176.1|  PREDICTED: glutamine synthetase nodule isozy...    269   3e-84    
ref|XP_006387591.1|  hypothetical protein POPTR_0799s00200g             268   3e-84    
gb|EEC73954.1|  hypothetical protein OsI_08842                          268   3e-84    
gb|ACN26845.1|  unknown                                                 267   3e-84    
ref|XP_010525077.1|  PREDICTED: glutamine synthetase nodule isozyme     267   3e-84    
emb|CAA54151.1|  glutamine                                              267   3e-84    
gb|KCW48619.1|  hypothetical protein EUGRSUZ_K02283                     267   3e-84    
gb|AAB61421.1|  cytosolic glutamine synthetase                          260   3e-84    
ref|XP_009127474.1|  PREDICTED: glutamine synthetase cytosolic is...    267   3e-84    
gb|ACF42116.1|  cytosolic glutamine synthetase                          267   3e-84    
ref|XP_010652433.1|  PREDICTED: glutamine synthetase isoform X1         267   3e-84    
sp|P04078.1|GLNA1_MEDSA  RecName: Full=Glutamine synthetase cytos...    267   3e-84    
ref|XP_008775534.1|  PREDICTED: glutamine synthetase nodule isozy...    267   4e-84    
ref|NP_001048045.1|  Os02g0735200                                       267   4e-84    
ref|XP_008353857.1|  PREDICTED: glutamine synthetase cytosolic is...    267   4e-84    
gb|ACD13217.1|  glutamine synthetase                                    267   4e-84    
ref|XP_010036983.1|  PREDICTED: glutamine synthetase cytosolic is...    267   5e-84    
pdb|2D3A|A  Chain A, Crystal Structure Of The Maize Glutamine Syn...    267   5e-84    
gb|ACR38147.1|  unknown                                                 267   5e-84    
gb|AAW21275.1|  glutamine synthetase                                    267   5e-84    
ref|NP_001241743.1|  glutamine synthetase root isozyme 3                267   5e-84    
gb|AGI78872.1|  glutamine synthetase                                    267   5e-84    
gb|AAG24873.1|AF301590_1  cytosolic glutamine synthetase GSbeta1        267   5e-84    
prf||1804333B  Gln synthetase                                           269   5e-84 
sp|Q43066.1|GLNA4_PEA  RecName: Full=Glutamine synthetase root is...    267   6e-84    
gb|ACF78695.1|  unknown                                                 267   6e-84    
gb|AGI78873.1|  glutamine synthetase                                    266   6e-84    
ref|XP_010932552.1|  PREDICTED: glutamine synthetase nodule isozyme     266   6e-84    
ref|XP_010435595.1|  PREDICTED: glutamine synthetase cytosolic is...    266   6e-84    
gb|ACL54769.1|  unknown                                                 267   6e-84    
ref|XP_010415162.1|  PREDICTED: glutamine synthetase cytosolic is...    266   7e-84    
ref|XP_009772493.1|  PREDICTED: glutamine synthetase cytosolic is...    266   7e-84    
gb|AAW21274.1|  glutamine synthetase                                    266   7e-84    
ref|XP_010066984.1|  PREDICTED: glutamine synthetase cytosolic is...    266   7e-84    
ref|XP_004162638.1|  PREDICTED: glutamine synthetase nodule isozy...    266   7e-84    
ref|XP_006590377.1|  PREDICTED: glutamine synthetase cytosolic is...    267   7e-84    
ref|XP_008781316.1|  PREDICTED: glutamine synthetase cytosolic is...    266   7e-84    
gb|EYU24513.1|  hypothetical protein MIMGU_mgv1a008973mg                266   7e-84    
ref|XP_010909363.1|  PREDICTED: glutamine synthetase nodule isozyme     266   8e-84    
ref|XP_007209293.1|  hypothetical protein PRUPE_ppa007728mg             266   8e-84    
ref|NP_001238531.1|  glutamine synthetase cytosolic isozyme 1           266   8e-84    
gb|KGN51032.1|  Glutamine synthetase                                    266   9e-84    
gb|AAR86718.1|  glutamine synthetase GS56                               266   9e-84    
ref|XP_010511548.1|  PREDICTED: glutamine synthetase cytosolic is...    266   1e-83    
ref|XP_011007210.1|  PREDICTED: glutamine synthetase cytosolic is...    266   1e-83    
ref|XP_009631592.1|  PREDICTED: glutamine synthetase isoform X1         266   1e-83    
gb|KEH36742.1|  glutamine synthetase domain protein                     267   1e-83    
ref|XP_007032111.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    266   1e-83    
emb|CAA46723.1|  glutamine synthetase                                   262   1e-83    
gb|AGV07415.1|  glutamine synthetase                                    266   1e-83    
gb|KHN07539.1|  Glutamine synthetase nodule isozyme                     266   1e-83    
ref|XP_002964238.1|  hypothetical protein SELMODRAFT_82032              267   1e-83    
gb|ACA50923.1|  glutamine synthetase                                    266   1e-83    
ref|XP_008789283.1|  PREDICTED: glutamine synthetase nodule isozy...    266   1e-83    
ref|XP_002465624.1|  hypothetical protein SORBIDRAFT_01g042450          266   1e-83    
gb|ACB06727.1|  glutamine synthetase                                    266   1e-83    
emb|CAA65173.1|  glutamine synthetase                                   265   2e-83    
ref|XP_010470493.1|  PREDICTED: glutamine synthetase cytosolic is...    265   2e-83    
sp|P23712.2|GLNA_LACSA  RecName: Full=Glutamine synthetase; AltNa...    265   2e-83    
ref|XP_008361978.1|  PREDICTED: glutamine synthetase leaf isozyme...    266   2e-83    
sp|P38559.1|GLNA1_MAIZE  RecName: Full=Glutamine synthetase root ...    265   2e-83    
ref|XP_003519325.1|  PREDICTED: glutamine synthetase cytosolic is...    265   2e-83    
gb|ABU45501.1|  cytosolic glutamine synthetase                          265   2e-83    
ref|XP_009408415.1|  PREDICTED: glutamine synthetase nodule isozy...    265   2e-83    
ref|NP_001105538.1|  glutamine synthetase root isozyme 1                265   2e-83    
ref|XP_003558466.1|  PREDICTED: glutamine synthetase cytosolic is...    265   2e-83    
ref|XP_009360053.1|  PREDICTED: glutamine synthetase nodule isozy...    265   2e-83    
sp|P32289.1|GLNA_VIGAC  RecName: Full=Glutamine synthetase nodule...    265   2e-83    
gb|ACR45960.1|  glutamine synthetase 1b                                 265   2e-83    
ref|XP_010926111.1|  PREDICTED: glutamine synthetase cytosolic is...    265   2e-83    
tpg|DAA44141.1|  TPA: glutamine synthetase6                             265   3e-83    
ref|NP_198576.1|  glutamine synthetase 1;1                              265   3e-83    
ref|XP_004135959.1|  PREDICTED: glutamine synthetase nodule isozy...    265   3e-83    
ref|XP_010935533.1|  PREDICTED: glutamine synthetase nodule isozy...    265   3e-83    
tpg|DAA44139.1|  TPA: glutamine synthetase6                             265   3e-83    
ref|XP_009614064.1|  PREDICTED: glutamine synthetase cytosolic is...    265   3e-83    
ref|XP_002870545.1|  ATGSR1                                             265   3e-83    
emb|CAA58118.1|  glutamate--ammonia ligase                              265   3e-83    
gb|ACR45959.1|  glutamine synthetase 1a                                 265   3e-83    
ref|XP_004250194.1|  PREDICTED: glutamine synthetase                    265   3e-83    
ref|XP_010032725.1|  PREDICTED: glutamine synthetase nodule isozyme     265   3e-83    
ref|NP_001051067.1|  Os03g0712800                                       265   3e-83    
emb|CAA71317.1|  glutamine synthetase                                   265   4e-83    
ref|XP_003600702.1|  Glutamine synthetase                               265   4e-83    
gb|AAP33168.1|  cytosolic glutamine synthetase                          262   4e-83    
gb|AAK08103.1|AF338444_1  glutamine synthetase                          265   4e-83    
ref|NP_001268104.1|  glutamine synthetase                               265   4e-83    
ref|XP_008340445.1|  PREDICTED: glutamine synthetase PR-2               264   5e-83    
gb|AHJ10959.1|  cytosolic glutamine synthetase 1 isoform 1              264   5e-83    
gb|AGT16433.1|  glutamine synthetase                                    265   5e-83    
gb|AFK48742.1|  unknown                                                 264   5e-83    
gb|AAG40238.2|AF302115_1  glutamine synthetase GS1                      264   6e-83    
gb|KHG29838.1|  Glutamine synthetase cytosolic isozyme 1-1              264   6e-83    
ref|XP_010440874.1|  PREDICTED: glutamine synthetase cytosolic is...    264   6e-83    
ref|XP_008221045.1|  PREDICTED: glutamine synthetase nodule isozy...    264   6e-83    
ref|NP_001242332.1|  cytosolic glutamine synthetase beta2               264   6e-83    
ref|XP_008803403.1|  PREDICTED: glutamine synthetase nodule isozy...    264   7e-83    
sp|P12424.1|GLNA_NICPL  RecName: Full=Glutamine synthetase; AltNa...    264   7e-83    
ref|XP_010450518.1|  PREDICTED: glutamine synthetase cytosolic is...    264   7e-83    
gb|KJB43163.1|  hypothetical protein B456_007G187300                    264   7e-83    
dbj|BAL45324.1|  glutamine synthetase                                   256   7e-83    
ref|XP_010551131.1|  PREDICTED: glutamine synthetase nodule isozy...    264   7e-83    
ref|XP_007222176.1|  hypothetical protein PRUPE_ppa007771mg             264   7e-83    
ref|XP_006284008.1|  hypothetical protein CARUB_v10005130mg             264   7e-83    
ref|XP_006405854.1|  hypothetical protein EUTSA_v10027817mg             263   8e-83    
ref|XP_006352444.1|  PREDICTED: glutamine synthetase-like               264   8e-83    
ref|XP_009391413.1|  PREDICTED: glutamine synthetase nodule isozy...    263   9e-83    
gb|EYU30859.1|  hypothetical protein MIMGU_mgv1a008986mg                263   9e-83    
ref|XP_006647853.1|  PREDICTED: glutamine synthetase cytosolic is...    263   9e-83    
ref|XP_006405853.1|  hypothetical protein EUTSA_v10027817mg             263   1e-82    
sp|P38561.1|GLNA3_MAIZE  RecName: Full=Glutamine synthetase root ...    263   1e-82    
ref|XP_010940335.1|  PREDICTED: glutamine synthetase nodule isozy...    263   1e-82    
ref|XP_009785976.1|  PREDICTED: glutamine synthetase isoform X1         263   1e-82    
gb|AFP20991.1|  glutamine synthetase isozyme                            263   1e-82    
ref|XP_008240120.1|  PREDICTED: glutamine synthetase nodule isozyme     263   1e-82    
ref|XP_007163376.1|  hypothetical protein PHAVU_001G229500g             263   1e-82    
sp|P04770.1|GLNA1_PHAVU  RecName: Full=Glutamine synthetase PR-1;...    263   1e-82    
gb|AHJ10960.1|  cytosolic glutamine synthetase 1 isoform 2              263   1e-82    
emb|CAA73064.1|  cytosolic glutamine synthetase                         263   2e-82    
gb|KDO52771.1|  hypothetical protein CISIN_1g018391mg                   260   2e-82    
sp|P52782.1|GLNA_LUPLU  RecName: Full=Glutamine synthetase nodule...    263   2e-82    
ref|XP_009393673.1|  PREDICTED: glutamine synthetase nodule isozyme     263   2e-82    
ref|XP_006437562.1|  hypothetical protein CICLE_v10031939mg             259   2e-82    
ref|XP_009385541.1|  PREDICTED: glutamine synthetase nodule isozy...    263   2e-82    
dbj|BAL45318.1|  glutamine synthetase                                   259   2e-82    
sp|O22504.1|GLNA1_DAUCA  RecName: Full=Glutamine synthetase cytos...    262   2e-82    
gb|AAC37356.1|  glutamine synthetase                                    255   3e-82    
gb|EEC76061.1|  hypothetical protein OsI_13264                          263   3e-82    
ref|XP_002527139.1|  glutamine synthetase plant, putative               262   3e-82    
gb|AAD52008.1|  cytosolic glutamine synthetase                          262   3e-82    
gb|EMT12639.1|  Glutamine synthetase                                    262   3e-82    
gb|AAB61301.1|  cytosolic glutamine synthetase                          255   3e-82    
gb|AEM42902.1|  cytosolic glutamine synthetase isoform                  262   3e-82    
dbj|BAK01909.1|  predicted protein                                      262   4e-82    
gb|KJB79891.1|  hypothetical protein B456_013G070600                    262   4e-82    
gb|KJB79890.1|  hypothetical protein B456_013G070600                    262   4e-82    
ref|XP_004503122.1|  PREDICTED: glutamine synthetase nodule isozy...    262   4e-82    
gb|AAZ30058.1|  glutamine synthetase isoform GS1b                       262   4e-82    
gb|AAZ30057.1|  glutamine synthetase isoform GS1a                       262   4e-82    
gb|AAZ30059.1|  glutamine synthetase isoform GS1c                       262   4e-82    
gb|AAT39510.1|  glutamine synthetase                                    261   5e-82    
ref|XP_010505950.1|  PREDICTED: glutamine synthetase cytosolic is...    255   5e-82    
ref|XP_006437564.1|  hypothetical protein CICLE_v10031939mg             261   5e-82    
gb|AAK14401.1|AF343667_1  cytosolic glutamine synthetase                261   6e-82    
dbj|BAL45347.1|  glutamine synthetase                                   258   6e-82    
ref|XP_009351711.1|  PREDICTED: glutamine synthetase nodule isozy...    261   7e-82    
dbj|BAL45316.1|  glutamine synthetase                                   258   7e-82    
gb|AFB69880.1|  glutamine synthetase isoform 1r                         261   7e-82    
gb|AGG19203.1|  glutamine synthetase                                    261   7e-82    
gb|AAR29058.1|  glutamine synthetase 2                                  259   8e-82    
gb|AAR84349.1|  glutamine synthetase isoform GSe1                       261   8e-82    
ref|XP_006437563.1|  hypothetical protein CICLE_v10031939mg             261   8e-82    
ref|XP_006484548.1|  PREDICTED: glutamine synthetase nodule isozy...    261   9e-82    
dbj|BAL45337.1|  glutamine synthetase                                   257   9e-82    
dbj|BAL45353.1|  glutamine synthetase                                   257   1e-81    
ref|XP_010236151.1|  PREDICTED: glutamine synthetase cytosolic is...    261   1e-81    
dbj|BAL45339.1|  glutamine synthetase                                   257   1e-81    
dbj|BAL45319.1|  glutamine synthetase                                   257   1e-81    
dbj|BAA04996.1|  glutamine synthetase                                   261   1e-81    
dbj|BAL45327.1|  glutamine synthetase                                   257   1e-81    
ref|XP_009785977.1|  PREDICTED: glutamine synthetase isoform X2         261   1e-81    
ref|XP_009139734.1|  PREDICTED: glutamine synthetase cytosolic is...    261   1e-81    
gb|AEH16645.1|  glutamine synthetase                                    261   1e-81    
gb|AFX60876.1|  glutamine synthetase isoform GS1_2                      261   1e-81    
dbj|BAL45325.1|  glutamine synthetase                                   257   1e-81    
gb|EMT08718.1|  Glutamine synthetase cytosolic isozyme 1-3              261   2e-81    
emb|CDP01645.1|  unnamed protein product                                260   2e-81    
gb|AEM42903.1|  cytosolic glutamine synthetase isoform                  260   2e-81    
ref|XP_008350820.1|  PREDICTED: glutamine synthetase nodule isozy...    260   2e-81    
ref|XP_009401139.1|  PREDICTED: glutamine synthetase nodule isozy...    260   2e-81    
gb|EMS45858.1|  Glutamine synthetase cytosolic isozyme 1-3              260   2e-81    
ref|NP_001105443.1|  glutamine synthetase root isozyme 2                260   3e-81    
dbj|BAL45317.1|  glutamine synthetase                                   256   3e-81    
gb|AFB69879.1|  glutamine synthetase isoform 1-1                        259   3e-81    
dbj|BAL45333.1|  glutamine synthetase                                   256   4e-81    
gb|AGW24651.1|  cytosolic glutamine synthetase                          259   4e-81    
ref|XP_004297747.1|  PREDICTED: glutamine synthetase nodule isozy...    259   4e-81    
ref|XP_010549036.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    260   4e-81    
ref|XP_010688706.1|  PREDICTED: glutamine synthetase nodule isozyme     259   4e-81    
gb|AFX60877.1|  glutamine synthetase isoform GS1_3                      259   4e-81    
dbj|BAL45335.1|  glutamine synthetase                                   256   4e-81    
gb|AGW24652.1|  cytosolic glutamine synthetase                          259   4e-81    
dbj|BAL45352.1|  glutamine synthetase                                   255   5e-81    
gb|ACU19484.1|  unknown                                                 259   6e-81    
gb|AAR84347.1|  glutamine synthetase isoform GSr1                       259   6e-81    



>ref|XP_010450398.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
[Camelina sativa]
 dbj|BAD94507.1| glutamate-ammonia ligase precursor [Arabidopsis thaliana]
Length=179

 Score =   308 bits (790),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  1    MPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  60

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  61   TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  120

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  121  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  164



>ref|XP_011090823.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090824.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090825.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090827.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
Length=432

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  417



>ref|NP_001284439.1| glutamine synthetase leaf isozyme, chloroplastic [Cucumis melo]
 gb|AAX35343.1| glutamine synthetase [Cucumis melo]
Length=432

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  417



>ref|XP_008438737.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
melo]
Length=432

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  417



>gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum 
crystallinum]
Length=433

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARYILERITEQ GVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  255  MPGQWEFQVGPSVGIEAGDHVWCARYILERITEQVGVVLTLDPKPIEGDWNGAGCHTNYS  314

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASI++FSWGVANRGC
Sbjct  315  TKSMREEGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASIDSFSWGVANRGC  374

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT LLAETTLLW+PT
Sbjct  375  SIRVGRDTEKAGKGYLEDRRPASNMDPYVVTGLLAETTLLWEPT  418



>ref|XP_004167630.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, 
partial [Cucumis sativus]
Length=249

 Score =   308 bits (789),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  71   MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  130

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  131  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  190

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  191  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  234



>gb|AAN84539.1| putative plastidic glutamine synthetase, partial [Gazania splendens]
Length=224

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  46   MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIDGDWNGAGCHTNYS  105

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T +MRE+GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  106  TLAMREDGGFEVIKKAILNLSLRHMEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  165

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPY VT LLAETTLLW+PT
Sbjct  166  SIRVGRDTEKAGKGYLEDRRPASNMDPYTVTGLLAETTLLWEPT  209



>ref|XP_010255852.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Nelumbo 
nucifera]
Length=432

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETA+INTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETANINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  417



>ref|XP_011071523.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Sesamum indicum]
Length=429

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  251  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAI NLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  311  TKSMREEGGFEVIKKAIFNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPY+VT+LLAETT+LW+PT
Sbjct  371  SIRVGRDTEKNGKGYLEDRRPASNMDPYIVTSLLAETTILWEPT  414



>ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=432

 Score =   312 bits (800),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RY+LERITEQ GVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYLLERITEQTGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  417



>ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010035913.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW84321.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=432

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RY+LERITEQ GVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYLLERITEQIGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  417



>ref|XP_010035896.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW84319.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=438

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RY+LERITEQ GVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  260  MPGQWEYQVGPSVGIEAGDHIWCSRYLLERITEQIGVVLTLDPKPIEGDWNGAGCHTNYS  319

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  320  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  379

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  380  SIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  423



>gb|KDP40083.1| hypothetical protein JCGZ_02081 [Jatropha curcas]
Length=432

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAILNLSLRHR+HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  314  TKSMREDGGYEVIKKAILNLSLRHREHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  417



>ref|XP_010041423.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X2 [Eucalyptus grandis]
Length=369

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RY+LERITEQ GVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  191  MPGQWEYQVGPSVGIEAGDHIWCSRYLLERITEQTGVVLTLDPKPIEGDWNGAGCHTNYS  250

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  251  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  310

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  311  SIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  354



>gb|AIR07818.1| chloroplastic glutamine synthetase GS2, partial [Vitis labrusca 
x Vitis vinifera]
Length=273

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  95   MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  154

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAILNLSLRH++HISAYGEGNERRLTGKHETA+INTFSWGVANRGC
Sbjct  155  TKSMREDGGYELIKKAILNLSLRHKEHISAYGEGNERRLTGKHETANINTFSWGVANRGC  214

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            S+RVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETT+LW+PT
Sbjct  215  SVRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTILWEPT  258



>gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea]
Length=431

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQ GVV+TLDPKPIEGDWNGAGCHTNYS
Sbjct  253  MPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQIGVVMTLDPKPIEGDWNGAGCHTNYS  312

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MREEGGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETA INTFSWGVANRGC
Sbjct  313  TKTMREEGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETADINTFSWGVANRGC  372

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLAETT+LW+PT
Sbjct  373  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTGLLAETTILWEPT  416



>ref|XP_006593484.1| PREDICTED: glutamine synthetase precursor isoform X1 [Glycine 
max]
Length=432

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  417



>ref|XP_010542001.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010542002.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=434

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  256  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  315

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  316  TKSMREDGGYEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  375

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  376  SIRVGRDTEKKGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  419



>ref|XP_003546121.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006597566.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Glycine max]
 gb|KHN33081.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=432

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  417



>ref|XP_009391592.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391594.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=433

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  255  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  314

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MREEGG+EVIKKAILNLSLRH DHISAYGEGNERRLTGKHETA+INTFSWGVANRGC
Sbjct  315  TKTMREEGGYEVIKKAILNLSLRHMDHISAYGEGNERRLTGKHETANINTFSWGVANRGC  374

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVV +LLAETT+LWQPT
Sbjct  375  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVISLLAETTILWQPT  418



>gb|KHN37551.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=434

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  256  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  315

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  316  TKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  375

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  376  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  419



>gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum]
Length=432

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  314  TLSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTGLLAETTILWEPT  417



>gb|KJB28233.1| hypothetical protein B456_005G035800 [Gossypium raimondii]
Length=431

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  253  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  312

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  313  TKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  372

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLAETTLL++PT
Sbjct  373  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLAETTLLYEPT  416



>ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
Length=426

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  248  MPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  307

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  308  TKSMREEGGFEVIKKAILNLSLRHMEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  367

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  368  SIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  411



>ref|XP_008223033.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Prunus 
mume]
Length=432

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHTDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  417



>sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Daucus carota]
 gb|AAB71693.1| glutamine synthetase [Daucus carota]
Length=432

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIDGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI++FSWGVA+RGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDSFSWGVADRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTGLLAETTLLWEPT  417



>ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57036.1| Glutamine synthetase [Cucumis sativus]
Length=432

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  417



>ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis]
 gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis]
Length=432

 Score =   310 bits (794),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGV+LTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVILTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR+EGG+EVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  314  TKSMRDEGGYEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  417



>gb|EYU43846.1| hypothetical protein MIMGU_mgv1a010285mg [Erythranthe guttata]
Length=317

 Score =   306 bits (783),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  155  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  214

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAI NLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  215  TKSMREEGGFEVIKKAIYNLSLRHKEHISAYGEGNERRLTGKHETASIDKFSWGVANRGC  274

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLAETTLLW+P
Sbjct  275  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLAETTLLWKP  317



>ref|XP_009417914.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417915.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGV+L+LDPKPIEGDWNGAGCHTN+S
Sbjct  255  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVILSLDPKPIEGDWNGAGCHTNFS  314

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAILNLSLRH DHISAYGEGNERRLTGKHETA+INTFSWGVANRGC
Sbjct  315  TKSMREEGGYEVIKKAILNLSLRHMDHISAYGEGNERRLTGKHETANINTFSWGVANRGC  374

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLAETT+LWQP+
Sbjct  375  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWQPS  418



>gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata]
Length=429

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  251  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  311  TKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  371  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  414



>ref|XP_009124267.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica rapa]
 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Brassica napus]
 emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus]
 emb|CDX74644.1| BnaA04g07450D [Brassica napus]
Length=428

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHMEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  370  SIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  413



>ref|XP_010557680.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=434

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  256  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  315

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR++GG+EVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  316  TKSMRDDGGYEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  375

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  376  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  419



>gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris]
Length=429

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  251  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  311  TKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAE+TLLW+PT
Sbjct  371  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAESTLLWEPT  414



>gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis]
Length=428

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHMEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  370  SIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  413



>ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica 
rapa]
Length=428

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGF+VIKKAILNLSLRH +HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  310  TKSMREEGGFDVIKKAILNLSLRHMEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  370  SIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  413



>ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 ref|XP_007147797.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 sp|P15102.1|GLNA4_PHAVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=Glutamate--ammonia ligase; AltName: Full=Isozyme 
delta; Flags: Precursor [Phaseolus vulgaris]
 emb|CAA31234.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW19790.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 gb|ESW19791.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
Length=429

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  251  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  311  TKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAE+TLLW+PT
Sbjct  371  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAESTLLWEPT  414



>ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010666334.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris]
 gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris]
Length=431

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  253  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  312

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETA I+TFSWGVANRGC
Sbjct  313  TKTMREDGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETADIDTFSWGVANRGC  372

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGY+EDRRPASNMDPYVVT LLAE+TLLW+PT
Sbjct  373  SIRVGRDTEKEGKGYMEDRRPASNMDPYVVTGLLAESTLLWEPT  416



>gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata]
Length=430

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIW ARYILERITEQAGVVL+LDPKPI+GDWNGAGCHTNYS
Sbjct  252  MPGQWEFQVGPSVGIEAGDHIWAARYILERITEQAGVVLSLDPKPIQGDWNGAGCHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH DHI AYGEGNERRLTGKHETA INTFSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHSDHIRAYGEGNERRLTGKHETADINTFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  372  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  415



>gb|ACU24520.1| unknown [Glycine max]
Length=432

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPAS+MDPYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPASSMDPYVVTSLLAETTLLWEPT  417



>ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
 gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
Length=432

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITE+AGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEEAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHTDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT  417



>dbj|BAF62340.1| glutamine synthetase [Avicennia marina]
Length=432

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWC+RY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCSRYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG EVIKKAILNLSLRH++HISAYGEGNERRLTGKHETA+I+TFSWGVANRGC
Sbjct  314  TKSMREEGGLEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETANIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  417



>gb|KHG04493.1| Glutamine synthetase leaf isozyme, chloroplastic [Gossypium arboreum]
Length=432

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT LLAETT+L++PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTGLLAETTILYEPT  417



>ref|XP_004486102.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cicer arietinum]
Length=430

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  252  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH+ HI AYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHKVHIEAYGEGNERRLTGKHETASINTFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEKSGKGYLEDRRPASNMDPY VTALLAE+TLLW+PT
Sbjct  372  SIRVGRDTEKSGKGYLEDRRPASNMDPYTVTALLAESTLLWEPT  415



>ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI26165.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAILNLSLRH++HISAYGEGNERRLTGKHETA+INTFSWGVANRGC
Sbjct  314  TKSMREDGGYELIKKAILNLSLRHKEHISAYGEGNERRLTGKHETANINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            S+RVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETT+LW+PT
Sbjct  374  SVRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTILWEPT  417



>ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44687.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  251  MPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  311  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  371  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  414



>emb|CDO98975.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E IKKAIL+LSLRH+DHISAYGEGNERRLTGKHETA INTFSWGVANRGC
Sbjct  314  TKSMREDGGYEKIKKAILSLSLRHKDHISAYGEGNERRLTGKHETADINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK+GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  374  SIRVGRETEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  417



>ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI32325.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  255  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  314

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  315  TKSMREDGGFEVIKKAILNLSLRHEVHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  374

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  375  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  418



>ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001031969.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001078639.1| glutamine synthetase 2 [Arabidopsis thaliana]
 sp|Q43127.1|GLNA2_ARATH RecName: Full=Glutamine synthetase, chloroplastic/mitochondrial; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16230.1|AF428461_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAL16249.1|AF428319_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAB20558.1| light-regulated glutamine synthetase isoenzyme [Arabidopsis thaliana]
 dbj|BAA88761.1| Glutamine Synthetase [Arabidopsis thaliana]
 dbj|BAB09304.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
(clone lambdaAtgsl1) [Arabidopsis thaliana]
 gb|AAL91141.1| glutamate-ammonia ligase, chloroplast [Arabidopsis thaliana]
 gb|AAM14064.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 gb|AAM65763.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
[Arabidopsis thaliana]
 gb|AAM67510.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 dbj|BAH19798.1| AT5G35630 [Arabidopsis thaliana]
 gb|AED93993.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93994.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93995.1| glutamine synthetase [Arabidopsis thaliana]
 prf||1804333A Gln synthetase
Length=430

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  252  MPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  372  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  415



>ref|NP_001237784.1| glutamine synthetase precursor [Glycine max]
 gb|AAK43833.1|AF353620_1 glutamine synthetase precursor [Glycine max]
Length=432

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRP SNMDPYV T+LLAETTLLW+PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPTSNMDPYVATSLLAETTLLWEPT  417



>emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera]
Length=433

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  255  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  314

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  315  TKSMREDGGFEVIKKAILNLSLRHEVHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  374

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  375  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  418



>ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
 gb|EOA15515.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
Length=429

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  251  MPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  311  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  371  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  414



>ref|XP_010435449.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
 ref|XP_010435451.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X4 [Camelina sativa]
 ref|XP_010440748.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=430

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  252  MPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  372  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  415



>ref|XP_010435452.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X5 [Camelina sativa]
 ref|XP_010435453.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X6 [Camelina sativa]
 ref|XP_010440749.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
Length=418

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  240  MPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  299

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  300  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  359

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  360  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  403



>ref|XP_010450396.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
 ref|XP_010450397.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=430

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  252  MPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  372  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  415



>gb|AAO37651.1| glutamine synthetase [Medicago truncatula]
 gb|KEH36741.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   307 bits (787),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHKIHIEAYGEGNERRLTGKHETASINTFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLAE+TLLW+PT
Sbjct  370  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLAESTLLWEPT  413



>ref|XP_010435447.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010435448.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
 ref|XP_010435454.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X7 [Camelina sativa]
 ref|XP_010440747.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=441

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  263  MPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  322

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  323  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  382

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  383  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  426



>ref|XP_008390805.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHGEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  417



>emb|CDY33684.1| BnaC04g29670D [Brassica napus]
Length=489

 Score =   309 bits (792),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  311  MPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  370

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  371  TKSMREDGGFEVIKKAILNLSLRHMEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  430

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  431  SIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  474



>sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Medicago sativa]
 gb|AAD28443.1|AF124244_1 glutamine synthetase precursor [Medicago sativa]
Length=428

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHKVHIEAYGEGNERRLTGKHETASINTFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLAE+TLLW+PT
Sbjct  370  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLAESTLLWEPT  413



>emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus]
Length=428

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGF+VIKK ILNLSLRH +HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  310  TKSMREEGGFDVIKKDILNLSLRHMEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  370  SIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  413



>ref|XP_009352136.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=432

 Score =   307 bits (787),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHGEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  417



>gb|KJB37729.1| hypothetical protein B456_006G218100 [Gossypium raimondii]
Length=432

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI++FSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDSFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT LLAETT+L++PT
Sbjct  374  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTGLLAETTILYEPT  417



>ref|XP_009773609.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana sylvestris]
Length=432

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRG 
Sbjct  314  TLSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDKFSWGVANRGA  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTGLLAETTILWEPT  417



>ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
 ref|XP_010322793.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
Length=432

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIE GDHIWCARY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEGGDHIWCARYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  314  TLSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTGLLAETTILWEPT  417



>ref|XP_009629915.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana tomentosiformis]
 gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata]
Length=432

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRG 
Sbjct  314  TLSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDKFSWGVANRGA  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLAETT+LW+PT
Sbjct  374  SIRVGRDTEKQGKGYLEDRRPASNMDPYVVTGLLAETTILWEPT  417



>ref|XP_009339932.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Pyrus 
x bretschneideri]
Length=432

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSLRHVEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  417



>gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra]
Length=432

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGD NGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDRNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLAETT+LW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTILWEPT  417



>gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli]
Length=432

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSLRHVEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  417



>ref|XP_008353244.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSLRHGEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  417



>prf||1601519A Gln synthetase
Length=429

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  251  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGNERRLTGK ETASINTFSWGVANRGC
Sbjct  311  TKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKMETASINTFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLAE+TLLW+PT
Sbjct  371  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAESTLLWEPT  414



>gb|AAA50249.1| glutamine synthetase, partial (chloroplast) [Solanum lycopersicum]
Length=191

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE QVGPSVGIE GDHIWCARY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  13   MPGQWESQVGPSVGIEGGDHIWCARYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  72

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMR EGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  73   TLSMRGEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  132

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDP VVT LLAETT+LW+PT
Sbjct  133  SIRVGRDTEKEGKGYLEDRRPASNMDPIVVTGLLAETTILWEPT  176



>gb|EYU45601.1| hypothetical protein MIMGU_mgv1a007136mg [Erythranthe guttata]
Length=418

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAI NLSLRH++HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAIHNLSLRHKEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLAETTLLW P
Sbjct  374  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLAETTLLWDP  416



>emb|CAA29057.1| gluthamine synthetase [Pisum sativum]
Length=373

 Score =   303 bits (776),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  195  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  254

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGNERRLTGKHETASIN FSWGVANRGC
Sbjct  255  TKSMREDGGFEVIKKAILNLSLRHKIHIEAYGEGNERRLTGKHETASINDFSWGVANRGC  314

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLAE+TLLW+PT
Sbjct  315  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLAESTLLWEPT  358



>sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Pisum sativum]
 gb|AAA33653.1| glutamine synthetase (chloroplast GS2) (EC 6.3.1.2) [Pisum sativum]
Length=430

 Score =   305 bits (781),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  252  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGNERRLTGKHETASIN FSWGVANRGC
Sbjct  312  TKSMREDGGFEVIKKAILNLSLRHKIHIEAYGEGNERRLTGKHETASINDFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLAE+TLLW+PT
Sbjct  372  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLAESTLLWEPT  415



>gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus]
Length=430

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQAGVVLTLDPKPIEGDWNGAG HTNYS
Sbjct  252  MPGQWEYQVGPSVGIEAGDHIWASRYLLERITEQAGVVLTLDPKPIEGDWNGAGAHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH+DHI AYGEGNERRLTGKHETA INTFSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHQDHIRAYGEGNERRLTGKHETADINTFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLAETTLLW+PT
Sbjct  372  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLAETTLLWEPT  415



>gb|AAN84563.1| glutamine synthetase [Lotus japonicus]
Length=430

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQAGVVLTLDPKPIEGDWNGAG HTNYS
Sbjct  252  MPGQWEYQVGPSVGIEAGDHIWASRYLLERITEQAGVVLTLDPKPIEGDWNGAGAHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH+DHI AYGEGNERRLTGKHETA INTFSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHQDHIRAYGEGNERRLTGKHETADINTFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLAETTLLW+PT
Sbjct  372  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLAETTLLWEPT  415



>emb|CAB72423.1| glutamine synthetase [Brassica napus]
Length=428

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSV IEAGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEFQVGPSVRIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH +HI AYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHMEHIIAYGEGNERRLTGKHETASIDQFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  370  SIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  413



>gb|AAB61302.1| chloroplastic glutamine synthetase [Helianthus annuus]
Length=174

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  749  FQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE  570
            FQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTK+MRE
Sbjct  2    FQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKAMRE  61

Query  569  EGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR  390
            +GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASIN FSWGVANRGCSIRVGR
Sbjct  62   DGGFEVIKKAILNLSLRHTEHISAYGEGNERRLTGKHETASINQFSWGVANRGCSIRVGR  121

Query  389  DTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            DTEK+GKGYLEDRRPASNMDPY VT LLAETT+LW+PT
Sbjct  122  DTEKAGKGYLEDRRPASNMDPYTVTGLLAETTILWEPT  159



>gb|KDO74872.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74873.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74874.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=432

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIWC+RY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIDAGDHIWCSRYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+E IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI++FSWGVANRGC
Sbjct  314  TKSMREEGGYETIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDSFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  417



>gb|AJI44225.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTN+S
Sbjct  252  MPGQWEYQVGPSVGIEAGDHIWMSRYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNFS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GG+E IKKAILNLSLRH+DHISAYGEGNERRLTGKHETASI++FSWGVANRGC
Sbjct  312  TKTMREDGGYEAIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASIDSFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEKSGKGYLEDRRPASNMDPY+VT+LLAETTLLW PT
Sbjct  372  SIRVGRDTEKSGKGYLEDRRPASNMDPYIVTSLLAETTLLWAPT  415



>gb|KDO74871.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=428

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIWC+RY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEYQVGPSVGIDAGDHIWCSRYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+E IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI++FSWGVANRGC
Sbjct  310  TKSMREEGGYETIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDSFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  370  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  413



>gb|KDO74875.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=442

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIWC+RY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  264  MPGQWEYQVGPSVGIDAGDHIWCSRYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  323

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+E IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI++FSWGVANRGC
Sbjct  324  TKSMREEGGYETIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDSFSWGVANRGC  383

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  384  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  427



>ref|XP_007034566.1| Glutamine synthetase 2 [Theobroma cacao]
 gb|EOY05492.1| Glutamine synthetase 2 [Theobroma cacao]
Length=549

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  371  MPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  430

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  431  TKSMREDGGYEVIKKAILNLSLRHQEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  490

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVV +LLAETT+L++PT
Sbjct  491  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVISLLAETTILYEPT  534



>gb|ACU18743.1| unknown [Glycine max]
Length=420

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLS RH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREDGGFEVIKKAILNLSPRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+T+K+GKGYLEDRRPASNM+PYVVT+LLAETTLLW+PT
Sbjct  374  SIRVGRNTKKNGKGYLEDRRPASNMNPYVVTSLLAETTLLWEPT  417



>gb|AJD14836.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTN+S
Sbjct  252  MPGQWEYQVGPSVGIEAGDHIWMSRYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNFS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GG+E IKKAILNLSLRH+DHISAYGEGNERRLTGKHETASI++FSWGVANRGC
Sbjct  312  TKTMREDGGYEAIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASIDSFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPY+VT+LLAETTLLW PT
Sbjct  372  SIRVGRDTEKNGKGYLEDRRPASNMDPYIVTSLLAETTLLWAPT  415



>ref|XP_008812802.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic, 
partial [Phoenix dactylifera]
Length=175

 Score =   293 bits (751),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -3

Query  755  WEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSM  576
            WE+QVGPSVGIEA DH+WC+RYILERITEQAGVVL+L+PKPIEGDWNGAGCHTN+STKSM
Sbjct  1    WEYQVGPSVGIEASDHVWCSRYILERITEQAGVVLSLNPKPIEGDWNGAGCHTNFSTKSM  60

Query  575  REEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGCSIRV  396
            REEGG+EVIKKAILNLSLRH++HISAYGEGNERRLTGKHETA+INTFSWGVANRGCSIRV
Sbjct  61   REEGGYEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETANINTFSWGVANRGCSIRV  120

Query  395  GRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            GR+TE+ GKGYLEDRRPASNMDPYVVT++LAETT+LW+PT
Sbjct  121  GRETERRGKGYLEDRRPASNMDPYVVTSMLAETTILWEPT  160



>gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus]
Length=430

 Score =   302 bits (773),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RY LERITEQAGVVLTLDPKPIEGDWNGAG HTNYS
Sbjct  252  MPGQWEYQVGPSVGIEAGDHIWASRYHLERITEQAGVVLTLDPKPIEGDWNGAGAHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH+DHI AYGEGNERRLTGKHETA INTFSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHQDHIRAYGEGNERRLTGKHETADINTFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLAETTLLW+PT
Sbjct  372  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLAETTLLWEPT  415



>ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
 ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
Length=432

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIWC+RY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIDAGDHIWCSRYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKS REEGG+E IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI++FSWGVANRGC
Sbjct  314  TKSTREEGGYETIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDSFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  417



>gb|AFH88076.1| chloroplast glutamine synthetase protein, partial [Sesuvium portulacastrum]
Length=433

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQ GVVLTLDPKPIEGDWNGAG HTNYS
Sbjct  255  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQVGVVLTLDPKPIEGDWNGAGAHTNYS  314

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILN S RH +HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  315  TKSMREDGGFEVIKKAILNPSPRHTEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  374

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPYVVTALLAETT+LW+PT
Sbjct  375  SIRVGRDTEAKGKGYLEDRRPASNMDPYVVTALLAETTILWEPT  418



>gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus]
Length=430

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGP VGIEAGDHIW +RY+LERIT QAGVVLTLDPKPIEGDWNGAG HTNYS
Sbjct  252  MPGQWEYQVGPXVGIEAGDHIWASRYLLERITXQAGVVLTLDPKPIEGDWNGAGAHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH+DHI AYGEGNERRLTGKHETA INTFSWGVANRGC
Sbjct  312  TKSMREEGGFEVIKKAILNLSLRHQDHIRAYGEGNERRLTGKHETADINTFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLAETTLLW+PT
Sbjct  372  SIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLAETTLLWEPT  415



>ref|XP_010938796.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Elaeis 
guineensis]
Length=434

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIE+GDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTN+S
Sbjct  256  MPGQWEYQVGPSVGIESGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNFS  315

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK MRE+GG+EVIKKA+LNLSLRH++HISAYGEGNERRLTGKHETA+INTFSWGVANRGC
Sbjct  316  TKRMREDGGYEVIKKAVLNLSLRHKEHISAYGEGNERRLTGKHETANINTFSWGVANRGC  375

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TE+ GKGYLEDRRPASNMDPYVVT++LAETT+LW+PT
Sbjct  376  SIRVGRETERRGKGYLEDRRPASNMDPYVVTSMLAETTILWEPT  419



>ref|XP_002314425.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEF00596.1| glutamine synthetase family protein [Populus trichocarpa]
Length=432

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIDAGDHIWISRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MREEGGFE IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  314  TKTMREEGGFEAIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLAETT+L++PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTILYEPT  417



>gb|AAN84538.1| putative plastidic glutamine synthetase [Spiraea nipponica]
Length=429

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAI  LSLRH++HISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  314  TKSMREEGGFEVIKKAIHKLSLRHKEHISAYGEGNERRLTGKHETASINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQ  282
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT LLAETTLLW+
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTGLLAETTLLWE  415



>ref|XP_010105702.1| Glutamine synthetase leaf isozyme [Morus notabilis]
 gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis]
Length=433

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTN+S
Sbjct  255  MPGQWEYQVGPSVGIDAGDHIWISRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNFS  314

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  315  TKSMREDGGYEAIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  374

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLAETTLLW+PT
Sbjct  375  SIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT  418



>ref|XP_002312733.1| glutamine synthetase family protein [Populus trichocarpa]
 ref|XP_006380049.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ABK94955.1| unknown [Populus trichocarpa]
 gb|EEE90100.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP57846.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=432

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIDAGDHIWISRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MREEGG+E IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  314  TKTMREEGGYEAIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVTALLAETT+L++PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTALLAETTILYEPT  417



>ref|XP_011009035.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009036.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
Length=432

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIDAGDHIWISRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MREEGG+E IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  314  TKTMREEGGYEAIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAETT+L++PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILYEPT  417



>gb|AHJ10961.1| chloroplast glutamine synthetase 2 isoform 1 [Lemna minor]
Length=424

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIDAGDHIWVSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MREEGGFEVIKKA++NLSLRH++HISAYGEGNERRLTGKHETA+INTFSWGVANRGC
Sbjct  314  TKTMREEGGFEVIKKAVVNLSLRHKEHISAYGEGNERRLTGKHETANINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            S+RVGR+TEK GKGY+EDRRPASNMDPYVVT+LLAETT+LW+P+
Sbjct  374  SVRVGRETEKEGKGYMEDRRPASNMDPYVVTSLLAETTILWEPS  417



>ref|XP_011006593.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Populus 
euphratica]
Length=432

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSVGIDAGDHIWISRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MREEGG+E IKKAILNLSLRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  314  TKTMREEGGYEAIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAETT+L++PT
Sbjct  374  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILYEPT  417



>ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [Solanum tuberosum]
 gb|AAG40236.2| plastid glutamine synthetase GS2 [Solanum tuberosum]
Length=432

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIE GDHIWCARY+LERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEGGDHIWCARYLLERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T S+REEGGFEVIKKAILNLSLRH+ HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  314  TLSIREEGGFEVIKKAILNLSLRHKGHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR TEK  +GYLEDRRPASNMDPYVVTALLAETT+LW+PT
Sbjct  374  SIRVGRYTEKEARGYLEDRRPASNMDPYVVTALLAETTILWEPT  417



>ref|XP_011462784.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  253  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  312

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTG HET +IN FSWGVANRG 
Sbjct  313  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGLHETQNINKFSWGVANRGA  372

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  373  SIRVGRDTEKEGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  416



>ref|NP_001054133.1| Os04g0659100 [Oryza sativa Japonica Group]
 sp|P14655.1|GLNA2_ORYSJ RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=Glutamate--ammonia 
ligase; AltName: Full=OsGS2; Short=GS2; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAA32462.1| unnamed protein product [Oryza sativa]
 emb|CAE02885.2| OSJNBa0015K02.2 [Oryza sativa Japonica Group]
 emb|CAE54574.1| OSJNBa0011F23.15 [Oryza sativa Japonica Group]
 dbj|BAF16047.1| Os04g0659100 [Oryza sativa Japonica Group]
 emb|CAH67797.1| OSIGBa0132E09-OSIGBa0108L24.11 [Oryza sativa Indica Group]
 gb|EEC78171.1| hypothetical protein OsI_17756 [Oryza sativa Indica Group]
 gb|EEE61834.1| hypothetical protein OsJ_16481 [Oryza sativa Japonica Group]
Length=428

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  250  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHDLHISAYGEGNERRLTGLHETASIDNFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPYVVTALLAETT+LW+PT
Sbjct  370  SIRVGRDTEAKGKGYLEDRRPASNMDPYVVTALLAETTILWEPT  413



>gb|ACO59263.1| chloroplast glutamine synthetase [Populus x canadensis]
 gb|ACT83378.1| chloroplast glutamine synthetase [Populus sp. FZ-2009]
Length=316

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  161  MPGQWEYQVGPSVGIDAGDHIWISRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  220

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MREEGGFE IKKAILNL LRH++HISAYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  221  TKTMREEGGFEAIKKAILNLPLRHKEHISAYGEGNERRLTGKHETASIDTFSWGVANRGC  280

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGR+TEK GKGYLEDRRPASNMDPY+V
Sbjct  281  SIRVGRETEKQGKGYLEDRRPASNMDPYIV  310



>dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites australis]
 dbj|BAD12058.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAG+VLTLDPKPI+GDWNGAGCHTNYS
Sbjct  251  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGIVLTLDPKPIQGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  311  TKSMREDGGFEVIKKAILNLSLRHDLHISAYGEGNERRLTGLHETASIDNFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  371  SIRVGRDTEAKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  414



>ref|XP_006653841.1| PREDICTED: LOW QUALITY PROTEIN: glutamine synthetase, chloroplastic-like 
[Oryza brachyantha]
Length=410

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  232  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  291

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  292  TKSMREDGGFEVIKKAILNLSLRHDLHISAYGEGNERRLTGLHETASIDNFSWGVANRGC  351

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  352  SIRVGRDTEAQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  395



>dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  251  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  310

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  311  TKSMREDGGFEVIKKAILNLSLRHDLHISAYGEGNERRLTGLHETASIDNFSWGVANRGC  370

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPYVVT+LLAETT+LW+PT
Sbjct  371  SIRVGRDTEAKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT  414



>gb|ACG31728.1| hypothetical protein [Zea mays]
Length=382

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  204  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  263

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GGFE IK+AILNLSLRH  HISAYGEGNERRLTGKHETASI TFSWGVANRGC
Sbjct  264  TKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGNERRLTGKHETASIGTFSWGVANRGC  323

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY VT LLAETT+LWQP+
Sbjct  324  SIRVGRDTEAKGKGYLEDRRPASNMDPYTVTGLLAETTILWQPS  367



>ref|XP_008662331.1| PREDICTED: glutamine synthetase, chloroplastic isoform X1 [Zea 
mays]
 gb|ACF83467.1| unknown [Zea mays]
 gb|ACN27769.1| unknown [Zea mays]
 gb|ACF86733.2| unknown [Zea mays]
 gb|AFW59720.1| glutamine synthetase1 isoform 1 [Zea mays]
 gb|AFW59721.1| glutamine synthetase1 isoform 2 [Zea mays]
Length=423

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  245  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  304

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GGFE IK+AILNLSLRH  HISAYGEGNERRLTGKHETASI TFSWGVANRGC
Sbjct  305  TKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGNERRLTGKHETASIGTFSWGVANRGC  364

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT LLAETT+LWQP+
Sbjct  365  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTGLLAETTILWQPS  408



>ref|NP_001105725.1| glutamine synthetase, chloroplastic precursor [Zea mays]
 sp|P25462.1|GLNAC_MAIZE RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Zea mays]
 emb|CAA46724.1| glutamine synthetase [Zea mays]
Length=423

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  245  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  304

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GGFE IK+AILNLSLRH  HISAYGEGNERRLTGKHETASI TFSWGVANRGC
Sbjct  305  TKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGNERRLTGKHETASIGTFSWGVANRGC  364

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT LLAETT+LWQP+
Sbjct  365  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTGLLAETTILWQPS  408



>gb|ADM45299.1| chloroplast GS2b-alpha precursor [Medicago truncatula]
 gb|ADM45300.1| chloroplast GS2b-beta precursor [Medicago truncatula]
 gb|KEH36738.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVG EA DHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEYQVGPSVGTEAADHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+ H+ AYGEGNERRLTGKHETASI+TFSWG+  RGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHKVHMEAYGEGNERRLTGKHETASIDTFSWGIGKRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK+GKGYLEDRRPASNMDPYVVTALLAE+TLLW+PT
Sbjct  370  SIRVGRETEKNGKGYLEDRRPASNMDPYVVTALLAESTLLWEPT  413



>ref|XP_004960149.1| PREDICTED: glutamine synthetase, chloroplastic-like [Setaria 
italica]
Length=428

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQAGVVLTLDPKPI GDWNGAGCHTNYS
Sbjct  250  MPGQWEYQVGPSVGIEAGDHIWISRYLLERITEQAGVVLTLDPKPIPGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFE+IKKAILNLSLRH  HISAYGEGNERRLTG HETASI+TFSWGVANRGC
Sbjct  310  TKSMREDGGFELIKKAILNLSLRHDLHISAYGEGNERRLTGLHETASIDTFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT LLAETT+LW+PT
Sbjct  370  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTGLLAETTILWEPT  413



>gb|AAB61303.1| chloroplastic glutamine synthetase [Helianthus annuus]
Length=174

 Score =   284 bits (727),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -3

Query  746  QVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREE  567
            QVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTK+MRE+
Sbjct  3    QVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKAMRED  62

Query  566  GGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRD  387
            GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKH TASIN FSWGVANRGCSIRVGRD
Sbjct  63   GGFEVIKKAILNLSLRHTEHISAYGEGNERRLTGKHGTASINQFSWGVANRGCSIRVGRD  122

Query  386  TEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            T+ +GKGYLEDRRPASNMDPY VT LLAET  LW+P+
Sbjct  123  TDAAGKGYLEDRRPASNMDPYTVTGLLAETPFLWEPS  159



>gb|AHJ10962.1| chloroplast glutamine synthetase 2 isoform 2 [Lemna minor]
Length=424

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPS GI+AGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEYQVGPSAGIDAGDHIWVSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GGFE IKKA++NLSLRH++HISAYGEGNERRLTGKHETA+INTFSWGVANRGC
Sbjct  314  TKTMREDGGFEEIKKAVVNLSLRHKEHISAYGEGNERRLTGKHETANINTFSWGVANRGC  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            S+RVGR+TEK GKGY+EDRRPASNMDPYVVT+LLAETT+LW+P+
Sbjct  374  SVRVGRETEKEGKGYMEDRRPASNMDPYVVTSLLAETTILWEPS  417



>ref|XP_003580719.1| PREDICTED: glutamine synthetase, chloroplastic [Brachypodium 
distachyon]
Length=430

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  252  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GGFEVIKKAILNLSLRH  HISAYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  312  TKAMREDGGFEVIKKAILNLSLRHDLHISAYGEGNERRLTGLHETASISDFSWGVANRGC  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE +GKGYLEDRRPASNMDPY VTALLAETTLLW+PT
Sbjct  372  SIRVGRDTEANGKGYLEDRRPASNMDPYTVTALLAETTLLWEPT  415



>gb|AAB61304.1| chloroplastic glutamine synthetase [Helianthus annuus]
Length=174

 Score =   284 bits (726),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  749  FQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMRE  570
            FQVGPSVGI++GDHIW ARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTK+MRE
Sbjct  2    FQVGPSVGIDSGDHIWRARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKAMRE  61

Query  569  EGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGR  390
            +GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASIN FSWGVANRGCSIRVG 
Sbjct  62   DGGFEVIKKAILNLSLRHTEHISAYGEGNERRLTGKHETASINQFSWGVANRGCSIRVGG  121

Query  389  DTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            DTEK+GKGYLEDRRPASNMDPY VT LLAETT+LW+P+
Sbjct  122  DTEKAGKGYLEDRRPASNMDPYTVTGLLAETTILWEPS  159



>dbj|BAL45315.1| glutamine synthetase, partial [Boykinia occidentalis]
Length=274

 Score =   287 bits (735),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIWC+RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  130  MPGQWEYQVGPSVGIDAGDHIWCSRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  189

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASIN FSWGVANRGC
Sbjct  190  TKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASINQFSWGVANRGC  249

Query  407  SIRVGRDTEKSGKGYLEDRRPASNM  333
            S+RVGR+TE+ GKGYLEDRRPASNM
Sbjct  250  SVRVGRETEQQGKGYLEDRRPASNM  274



>gb|ACG35376.1| glutamine synthetase [Zea mays]
Length=427

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  249  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  308

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GGFE IK+AILNLSLRH  HISAYGEGNERRLTGKHETASI TFSWGVANRGC
Sbjct  309  TKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGNERRLTGKHETASIGTFSWGVANRGC  368

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY VT LLAETT+LWQP+
Sbjct  369  SIRVGRDTEAKGKGYLEDRRPASNMDPYTVTGLLAETTILWQPS  412



>ref|XP_008662330.1| PREDICTED: glutamine synthetase, chloroplastic isoform X2 [Zea 
mays]
Length=512

 Score =   295 bits (754),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  334  MPGQWEYQVGPSVGIEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  393

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GGFE IK+AILNLSLRH  HISAYGEGNERRLTGKHETASI TFSWGVANRGC
Sbjct  394  TKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGNERRLTGKHETASIGTFSWGVANRGC  453

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY+VT LLAETT+LWQP+
Sbjct  454  SIRVGRDTEAKGKGYLEDRRPASNMDPYIVTGLLAETTILWQPS  497



>ref|XP_006850815.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
 gb|ERN12396.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
Length=433

 Score =   292 bits (747),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDH+WC+RY+LERITE AGVVL+LDPKPIEGDWNGAGCHTN+S
Sbjct  258  MPGQWEYQVGPSVGIDAGDHVWCSRYLLERITEMAGVVLSLDPKPIEGDWNGAGCHTNFS  317

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR+EGG+ VIKKAI NLSLRH++HI AYGEGNERRLTGKHETASI+TFSWGVANRGC
Sbjct  318  TKSMRDEGGYAVIKKAIRNLSLRHKEHIGAYGEGNERRLTGKHETASIDTFSWGVANRGC  377

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLAET +L++PT
Sbjct  378  SIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETAILFEPT  421



>gb|AAX18864.1| chloroplast glutamine synthetase, partial [Glycine max]
Length=281

 Score =   286 bits (733),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGC+TNYS
Sbjct  138  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCYTNYS  197

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  198  TKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  257

Query  407  SIRVGRDTEKSGKGYLEDRRPASN  336
            SIRVGRDTEK+GKGYLEDRRPASN
Sbjct  258  SIRVGRDTEKNGKGYLEDRRPASN  281



>ref|XP_003594092.1| Glutamine synthetase [Medicago truncatula]
Length=1639

 Score =   309 bits (792),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHKIHIEAYGEGNERRLTGKHETASINTFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLAE+TLLW+PT
Sbjct  370  SIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLAESTLLWEPT  413


 Score =   295 bits (754),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  767   MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
             MPGQWE+QVGPSVG EA DHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  1461  MPGQWEYQVGPSVGTEAADHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  1520

Query  587   TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
             TKSMRE+GGFEVIKKAILNLSLRH+ H+ AYGEGNERRLTGKHETASI+TFSWG+  RGC
Sbjct  1521  TKSMREDGGFEVIKKAILNLSLRHKVHMEAYGEGNERRLTGKHETASIDTFSWGIGKRGC  1580

Query  407   SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
             SIRVGR+TEK+GKGYLEDRRPASNMDPYVVTALLAE+TLLW+PT
Sbjct  1581  SIRVGRETEKNGKGYLEDRRPASNMDPYVVTALLAESTLLWEPT  1624


 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 85/151 (56%), Gaps = 53/151 (35%)
 Frame = -3

Query  725  IEAGDHIWCARYILERITEQAGVVL-TLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVI  549
            ++ GDHIW +++  +RI +QAGVVL TL+P+PIE   NGAG                   
Sbjct  878  VKDGDHIWASKF--KRIAKQAGVVLLTLNPQPIE---NGAG-------------------  913

Query  548  KKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGK  369
                          +S   EGNER+LT KHET SINTFSW              TEK+GK
Sbjct  914  --------------MSGNNEGNERKLTVKHETVSINTFSW--------------TEKNGK  945

Query  368  GYLEDRRPASNMDPYVVtallaettlLWQPT  276
            GYLEDR   SNMDPYVVT LLAE+TLLW+ T
Sbjct  946  GYLEDRPLVSNMDPYVVTTLLAESTLLWEQT  976



>gb|AAX18865.1| chloroplast glutamine synthetase, partial [Glycine max]
Length=281

 Score =   285 bits (730),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGIEAGDHIW +RYILERITEQAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  138  MPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYS  197

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH+D ISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  198  TKSMREDGGFEVIKKAILNLSLRHKDRISAYGEGNERRLTGKHETASINTFSWGVANRGC  257

Query  407  SIRVGRDTEKSGKGYLEDRRPASN  336
            SIRVGRDTEK+GKGYLEDRRPASN
Sbjct  258  SIRVGRDTEKNGKGYLEDRRPASN  281



>emb|CDY49365.1| BnaA08g29950D [Brassica napus]
Length=394

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  250  MPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  309

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGNERRLTGKHETASI+ FSWGVANRGC
Sbjct  310  TKSMREDGGFEVIKKAILNLSLRHMEHISAYGEGNERRLTGKHETASIDQFSWGVANRGC  369

Query  407  SIRVGRDTEKSGKGYLEDRRPAS  339
            SIRVGRDTEK GKGYLEDRRPAS
Sbjct  370  SIRVGRDTEKKGKGYLEDRRPAS  392



>dbj|BAJ91545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  257  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  316

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  317  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  376

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  377  SIRVGRDTEAKGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  420



>emb|CAA34131.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  248  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  307

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  308  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  367

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  368  SIRVGRDTEAKGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  411



>gb|AFB69878.1| chloroplast glutamine synthetase isoform 2-1 [Secale cereale]
Length=427

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  249  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  308

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  309  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  368

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY VTALLAE+T+LW+PT
Sbjct  369  SIRVGRDTEAKGKGYLEDRRPASNMDPYTVTALLAESTILWEPT  412



>sp|P13564.2|GLNA2_HORVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA37643.1| unnamed protein product [Hordeum vulgare]
Length=434

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  256  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  315

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  316  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  375

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  376  SIRVGRDTEAKGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  419



>gb|AAZ30061.1| plastid glutamine synthetase isoform GS2b [Triticum aestivum]
Length=427

 Score =   286 bits (733),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  249  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  308

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  309  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  368

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TE  GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  369  SIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  412



>gb|AAZ30062.1| plastid glutamine synthetase isoform GS2c [Triticum aestivum]
 gb|AAZ80474.1| GS2 [Triticum aestivum]
 gb|ACT22493.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22495.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22498.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|AEH16638.1| glutamine synthetase [Triticum aestivum]
 gb|AEM42904.1| plastid glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|EMT11272.1| Glutamine synthetase leaf isozyme, chloroplastic [Aegilops tauschii]
Length=427

 Score =   286 bits (733),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  249  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  308

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  309  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  368

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TE  GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  369  SIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  412



>gb|ACT22500.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   286 bits (733),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  249  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  308

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  309  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  368

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TE  GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  369  SIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  412



>gb|ACT22496.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22497.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  249  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  308

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  309  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  368

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TE  GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  369  SIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  412



>gb|AAK49029.1| cytosolic glutamine synthetase [Populus tremula x Populus alba]
Length=356

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGDHIW ARYILERITEQAGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDHIWAARYILERITEQAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HISAYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>dbj|BAJ95492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  257  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  316

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  317  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  376

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTE  GK YLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  377  SIRVGRDTEAKGKRYLEDRRPASNMDPYTVTALLAETTILWEPT  420



>sp|P52783.1|GLNA_PINSY RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Pinus sylvestris]
 emb|CAA49476.1| glutamate--ammonia ligase [Pinus sylvestris]
Length=357

 Score =   282 bits (721),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D +WCAR+I+ERITE+AGVVL+ DPKPIEGDWNGAGCHTNYS
Sbjct  195  MPGQWEFQVGPSVGISAADELWCARFIMERITEKAGVVLSFDPKPIEGDWNGAGCHTNYS  254

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR+EGGFEVIKKAI  L LRH++HISAYGEGNERRLTG+HETA +NTFSWGVANRG 
Sbjct  255  TKSMRKEGGFEVIKKAIEKLKLRHKEHISAYGEGNERRLTGRHETADMNTFSWGVANRGA  314

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPY+VT+++AETT+LW+P
Sbjct  315  SVRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWKP  357



>gb|EMS53309.1| Glutamine synthetase leaf isozyme, chloroplastic [Triticum urartu]
Length=535

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  241  MPGQWEYQVGPSVGIDAGDHIWASRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  300

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSWGVANRGC
Sbjct  301  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWGVANRGC  360

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TE  GKGYLEDRRPASNMDPY VTALLAETT+LW+PT
Sbjct  361  SIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLAETTILWEPT  404



>emb|CAA47373.2| glutamate--ammonia ligase [Nicotiana sylvestris]
Length=432

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARYILERIT QAGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYILERITGQAGVVLSLDPKPIEGDWNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGFEVIKKA LNLSLRH++HI+AYGEG   +LTG HETASI+ FSWGVA RG 
Sbjct  314  TLSMREDGGFEVIKKANLNLSLRHKEHINAYGEGILEKLTGNHETASIDKFSWGVAFRGA  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVG DTEK GKGYLEDRRPASNMDPYVVT LLAETT+LW+PT
Sbjct  374  SIRVGADTEKQGKGYLEDRRPASNMDPYVVTGLLAETTILWEPT  417



>dbj|BAG49063.1| glutamine synthetase [Lactuca sativa]
Length=266

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS
Sbjct  131  MPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  190

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMREEGGFEVIK+AILNLSLRH DHISAYGEGNERRLTGKHETASINTFSWGVANRGC
Sbjct  191  TLSMREEGGFEVIKEAILNLSLRHADHISAYGEGNERRLTGKHETASINTFSWGVANRGC  250

Query  407  SIRVGRDTEKSGKGYL  360
            SIRVGRDTEK+GKGYL
Sbjct  251  SIRVGRDTEKAGKGYL  266



>gb|AFW89163.1| glutamine synthetase3 [Zea mays]
Length=164

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AG+VL+LDPKPI+GDWNGAG HTNYS
Sbjct  1    MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGAHTNYS  60

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE GG+EVIK+AI  L  RHR+HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  61   TKSMREAGGYEVIKEAIEKLGKRHREHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  120

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQ  282
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT ++A+TT+LW+
Sbjct  121  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIADTTILWK  162



>gb|EPS69972.1| glutamine synthetase, partial [Genlisea aurea]
Length=201

 Score =   272 bits (696),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  40   MPGQWEFQVGPSVGISAGDQIWAARYILERITEIAGVVLSLDPKPIPGDWNGAGAHTNYS  99

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR EGG+EVIKKAI  L LRH+ HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  100  TKSMRNEGGYEVIKKAIEKLGLRHKHHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  159

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQ  282
            SIRVGRDTE +GKGY EDRRPASNMDPYVVT+L+AETT+LW+
Sbjct  160  SIRVGRDTEAAGKGYFEDRRPASNMDPYVVTSLIAETTILWK  201



>emb|CAA52448.1| glutamate--ammonia ligase [Pinus sylvestris]
Length=357

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D +WCAR+I+ERITE+AGVVL+ DPKPIEGDWNGAGCHTNYS
Sbjct  195  MPGQWEFQVGPSVGISAADELWCARFIMERITEKAGVVLSFDPKPIEGDWNGAGCHTNYS  254

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR+EGGFEVIKKAI  L LRH++HISAYGEGNERRLTG+HETA +NTFS GVANRG 
Sbjct  255  TKSMRKEGGFEVIKKAIEKLKLRHKEHISAYGEGNERRLTGRHETADMNTFSRGVANRGA  314

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPY+VT+++AETT+LW+P
Sbjct  315  SVRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWKP  357



>ref|XP_001755833.1| predicted protein [Physcomitrella patens]
 gb|EDQ79506.1| predicted protein [Physcomitrella patens]
Length=360

 Score =   277 bits (708),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPS GI A D +W ARYILERITE AGVVL+LDPKPIEGDWNGAGCHTNYS
Sbjct  194  MPGQWEFQVGPSKGIAAADQLWAARYILERITEIAGVVLSLDPKPIEGDWNGAGCHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRHR+HI++YGEGNERRLTGKHETA +NTFSWGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIEKLGLRHREHIASYGEGNERRLTGKHETADMNTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT ++A TT+LW P
Sbjct  314  SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTGMIAYTTILWSP  356



>gb|ABK21449.1| unknown [Picea sitchensis]
 gb|ABK23372.1| unknown [Picea sitchensis]
Length=357

 Score =   277 bits (708),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D +WCARYI+ERITE+ GVVL+ DPKPIEGDWNGAGCHTNYS
Sbjct  195  MPGQWEFQVGPSVGISAADELWCARYIMERITEKEGVVLSFDPKPIEGDWNGAGCHTNYS  254

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKS R+EGGFEVIKKAI  L LRH++HISAYGEGNERRLTG+HETA I+TFSWGVANRG 
Sbjct  255  TKSTRKEGGFEVIKKAIEKLRLRHKEHISAYGEGNERRLTGRHETADIHTFSWGVANRGA  314

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPY+VT+++AETT+LW+P
Sbjct  315  SVRVGRDTEKDGKGYFEDRRPASNMDPYIVTSMIAETTILWKP  357



>emb|CDO98315.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDEVWMARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGF VIKKAI  L LRH+DHI+AYGEGNERRLTGKHETA INTFSWGVANRG 
Sbjct  254  TKSMRSDGGFNVIKKAIEKLKLRHKDHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT++W+P
Sbjct  314  SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIVWKP  356



>gb|AAZ30060.1| plastid glutamine synthetase isoform GS2a [Triticum aestivum]
Length=427

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI+AGDHIW + YILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYS
Sbjct  249  MPGQWEYQVGPSVGIDAGDHIWASGYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYS  308

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGNERRLTG HETASI+ FSW VANRGC
Sbjct  309  TLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGNERRLTGLHETASISDFSWCVANRGC  368

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGR+TE  GKGYLEDRRP SNMDPY VTALLAETT+LW+PT
Sbjct  369  SIRVGRETEAKGKGYLEDRRPPSNMDPYTVTALLAETTILWEPT  412



>gb|ACF84549.1| unknown [Zea mays]
Length=163

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI +GD +W ARYILERITE AGVV+T DPKPI GDWNGAG HTNYS
Sbjct  1    MPGQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYS  60

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T+SMR+EGG+EVIK AI  L LRH++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  61   TESMRKEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  120

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGR+TE++GKGY EDRRPASNMDPYVVT+++AETT++W+P
Sbjct  121  SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIVWKP  163



>ref|XP_010528562.1| PREDICTED: glutamine synthetase cytosolic isozyme 2-like isoform 
X2 [Tarenaya hassleriana]
Length=326

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI GDWNGAG HTNYS
Sbjct  164  MPGQWEFQVGPSVGISAGDELWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  223

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L +RH+DHI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  224  TKSMREEGGYEVIKKAIKKLEMRHKDHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  283

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW P
Sbjct  284  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWNP  326



>ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like [Cucumis sativus]
 gb|AEZ56958.1| glutamine synthetase [Cucumis sativus]
 gb|KGN57792.1| hypothetical protein Csa_3G304140 [Cucumis sativus]
Length=356

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEIWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA I+TFSWGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIEKLKLRHKEHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMVAETTILWKP  356



>ref|XP_011003750.1| PREDICTED: glutamine synthetase nodule isozyme [Populus euphratica]
Length=356

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIAGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFEVIKKAI NL LRH++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMRNDGGFEVIKKAIGNLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A+TT+LW+P
Sbjct  314  SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWKP  356



>gb|EPS57588.1| glutamine synthetase, partial [Genlisea aurea]
Length=283

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  121  MPGQWEFQVGPSVGISAGDQIWAARYILERITEIAGVVLSLDPKPIPGDWNGAGAHTNYS  180

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR EGG+EVIKKAI  L LRH+ HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  181  TKSMRNEGGYEVIKKAIEKLGLRHKHHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  240

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE +GKGY EDRRPASNMDPYVVT+L+AETT+LW+P
Sbjct  241  SIRVGRDTEAAGKGYFEDRRPASNMDPYVVTSLIAETTILWKP  283



>ref|XP_010528561.1| PREDICTED: glutamine synthetase nodule isozyme-like isoform X1 
[Tarenaya hassleriana]
Length=356

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L +RH+DHI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIKKLEMRHKDHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWNP  356



>gb|AGC24240.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC24241.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC82197.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC82198.1| glutamine synthetase 1, partial [Brassica napus]
Length=257

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  95   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  154

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HISAYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  155  TKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGA  214

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE++GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  215  SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWKP  257



>gb|AGC24242.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC24243.1| glutamine synthetase 1, partial [Brassica napus]
Length=249

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  87   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  146

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HISAYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  147  TKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGA  206

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE++GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  207  SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWKP  249



>gb|AAW21276.1| chloroplast glutamine synthetase, partial [Saccharum officinarum]
Length=165

 Score =   268 bits (684),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  725  IEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIK  546
            IEAGDHIW +RYILERITEQAGVVLTLDPKPI+GDWNGAGCHTNYSTK+MRE+GGFE IK
Sbjct  1    IEAGDHIWISRYILERITEQAGVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIK  60

Query  545  KAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKG  366
            +AILNLSLRH  HISAYGEGNERRLTGKHETASI+TFSWGVANRGCS+RVGRDTE  GKG
Sbjct  61   RAILNLSLRHDLHISAYGEGNERRLTGKHETASIDTFSWGVANRGCSVRVGRDTEAKGKG  120

Query  365  YLEDRRPASNMDPYVVtallaettlLWQPT  276
            YLEDRRPASNMDPY+VT LLAETT+LWQPT
Sbjct  121  YLEDRRPASNMDPYIVTGLLAETTILWQPT  150



>gb|AGC82199.1| glutamine synthetase 1, partial [Brassica napus]
Length=255

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  93   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  152

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HISAYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  153  TKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGA  212

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE++GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  213  SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWKP  255



>gb|AJD14835.1| glutamine synthetase [Boehmeria nivea]
Length=356

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR EGG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMVAETTILWKP  356



>ref|XP_010553887.1| PREDICTED: glutamine synthetase nodule isozyme [Tarenaya hassleriana]
Length=356

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRH+DHI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIEKLGLRHKDHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVV  343



>ref|NP_001284433.1| glutamine synthetase cytosolic isozyme [Cucumis melo]
 gb|ABI30732.1| cytosolic glutamine synthetase [Cucumis melo]
Length=356

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNM PYVVT+++AETT+LW+P
Sbjct  314  SVRVGRDTEKEGKGYFEDRRPASNMGPYVVTSMVAETTILWKP  356



>ref|NP_001239821.1| cytosolic glutamine synthetase alpha [Glycine max]
 gb|ACU18102.1| unknown [Glycine max]
 gb|KHN43648.1| Glutamine synthetase PR-2 [Glycine soja]
Length=356

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGV+++ DPKPI GDWNGAG H+NYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWAARYILERITEMAGVIVSFDPKPIPGDWNGAGAHSNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR+EGG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMRDEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGS  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR EGG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT++W+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIVWKP  356



>ref|XP_007036933.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
 gb|EOY21434.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
Length=356

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARY+LERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDELWVARYLLERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+E+IKKAI NL LRH++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMRNDGGYEIIKKAIENLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SVRVGRDTEKCGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|XP_008229355.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Prunus mume]
Length=326

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  164  MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  223

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR  GGFEVIKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  224  TKSMRANGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  283

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQ  282
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+L+AETTL+W+
Sbjct  284  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSLIAETTLVWK  325



>ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus 
euphratica]
Length=356

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI +GD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISSGDELWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR EGG+EVIKKAI  L LRHR+HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRNEGGYEVIKKAIEKLGLRHREHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|XP_003619869.1| Glutamine synthetase [Medicago truncatula]
 emb|CAA71316.1| glutamine synthetase [Medicago truncatula]
 gb|AES76087.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE GG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTFSWGVANRG 
Sbjct  254  TKSMRENGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRP+SNMDPYVVT+++AETTLLW+P
Sbjct  314  SVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIAETTLLWKP  356



>ref|XP_009370058.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAINKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVV  343



>ref|XP_010271383.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Nelumbo 
nucifera]
Length=356

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWIARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR EGG+EVIKKAI  L LRH++HISAYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRSEGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFVWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE++GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTERAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|XP_006288043.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
 gb|EOA20941.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
Length=356

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPY VT+++AE+T+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIAESTILWKP  356



>ref|XP_009121474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 [Brassica 
rapa]
Length=356

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HISAYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFVWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE++GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  314  SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWKP  356



>prf||1804333C Gln synthetase
Length=430

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D IW ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  252  MPGQWEFQVGPSVGISAADEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  311

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+E+IKKAI  L LRH++HISAYGEGNERRLTG HETA INTF WGVANRG 
Sbjct  312  TKSMREEGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  371

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETTLLW PT
Sbjct  372  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWNPT  415



>dbj|BAD11327.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI +GD +W ARYILERITE AGVV++ DPKPIEGDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISSGDQLWMARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFEVIKKAI  L L+H++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMRSDGGFEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A TT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIANTTILWKP  356



>emb|CDY49656.1| BnaC09g41340D [Brassica napus]
Length=356

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HISAYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE++GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  314  SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWKP  356



>gb|AAA21586.1| glutamine synthetase, partial [Solanum lycopersicum]
Length=173

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERI E AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  13   MPGQWEFQVGPSVGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  72

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+I KAI  L L+H++HI+AYGEGNERRL+GKHETA+INTF WGVANRG 
Sbjct  73   TKSMREDGGYEIILKAIEKLGLKHKEHIAAYGEGNERRLSGKHETANINTFKWGVANRGA  132

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            S+RVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  133  SVRVGRDTEKAGKGYFEDRRPASNMDPYVV  162



>gb|ABK95973.1| unknown [Populus trichocarpa]
Length=356

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFEVIKKAI  L L+H++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMRNDGGFEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A+TT+LW+P
Sbjct  314  SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWKP  356



>gb|AGC82204.1| glutamine synthetase 1, partial [Brassica napus]
Length=235

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  79   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  138

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HISAYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  139  TKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGA  198

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTE++GKGY EDRRPASNMDPY V
Sbjct  199  SIRVGRDTEQAGKGYFEDRRPASNMDPYTV  228



>emb|CAA73366.1| glutamine synthetase [Lotus japonicus]
Length=356

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWVARYILERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKTMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A+TT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIADTTILWKP  356



>sp|O04867.1|GLNA1_ALNGL RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Alnus glutinosa]
 emb|CAA69937.1| glutamate synthetase [Alnus glutinosa]
Length=356

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+LDPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR  GG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRNNGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETTLLW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWKP  356



>sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Lotus japonicus]
Length=356

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWVARYILERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKTMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A+TT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIADTTILWKP  356



>ref|XP_002318305.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEE96525.1| glutamine synthetase family protein [Populus trichocarpa]
Length=356

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIAGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFEVIKKAI  L L+H++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMRNDGGFEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A+TT+LW+P
Sbjct  314  SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWKP  356



>ref|XP_009370556.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X2 
[Pyrus x bretschneideri]
Length=326

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  164  MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  223

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  224  TKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  283

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTE++GKGY EDRRPASNMDPY+V
Sbjct  284  SIRVGRDTEQAGKGYFEDRRPASNMDPYIV  313



>ref|XP_006372556.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|ABK94934.1| unknown [Populus trichocarpa]
 gb|ABK95264.1| unknown [Populus trichocarpa]
 gb|ERP50353.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI +GD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISSGDELWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR EGG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARY+LERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWVARYVLERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKTMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A+TT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWKP  356



>emb|CDX69442.1| BnaA10g17910D [Brassica napus]
Length=356

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HISAYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE++GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  314  SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWKP  356



>ref|XP_010420354.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X1 [Camelina sativa]
Length=356

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY VT+++AE+T+LW+P
Sbjct  314  SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAESTILWKP  356



>pdb|4IS4|A Chain A, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|B Chain B, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|C Chain C, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|D Chain D, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|E Chain E, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|F Chain F, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|G Chain G, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|H Chain H, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|I Chain I, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|J Chain J, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
Length=378

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  216  MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  275

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE GG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTFSWGVANRG 
Sbjct  276  TKSMRENGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  335

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRP+SNMDPYVVT+++AETTLLW+P
Sbjct  336  SVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIAETTLLWKP  378



>sp|Q43785.1|GLNA3_MEDSA RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Glutamate--ammonia 
ligase [Medicago sativa]
 gb|AAB41554.1| cytosolic glutamine synthetase [Medicago sativa]
Length=356

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHET  INTFSWGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETTDINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRP+SNMDPYVVT+++AETTLLW+P
Sbjct  314  SVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIAETTLLWKP  356



>ref|XP_009338856.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAINKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTE++GKGY EDRRPASNMDPYVV
Sbjct  314  SIRVGRDTEQAGKGYFEDRRPASNMDPYVV  343



>ref|XP_011083120.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Sesamum 
indicum]
Length=356

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDQLWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH+ HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIEKLGLRHKHHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|AGC24238.1| glutamine synthetase 1 [Brassica napus]
Length=356

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVAETTVLWKP  356



>ref|XP_006828441.1| hypothetical protein AMTR_s00060p00116070 [Amborella trichopoda]
 gb|ERM95857.1| hypothetical protein AMTR_s00060p00116070 [Amborella trichopoda]
Length=356

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPS GI AGD +WCARYILERITE AGVVLT DPKPI+GDWNGAGCHTNYS
Sbjct  194  MPGQWEFQVGPSEGISAGDELWCARYILERITEIAGVVLTFDPKPIQGDWNGAGCHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKS R+EGG+EVIKKAI  L LRH++HI+AYGEGNERRLTG HETA INTFSWGVANRG 
Sbjct  254  TKSTRKEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGHHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLW  285
            S+RVGRDTEK G+GY EDRRPASNMDPYVVT+++AETT+LW
Sbjct  314  SVRVGRDTEKEGRGYFEDRRPASNMDPYVVTSMIAETTILW  354



>ref|XP_002977477.1| hypothetical protein SELMODRAFT_151817 [Selaginella moellendorffii]
 gb|EFJ21481.1| hypothetical protein SELMODRAFT_151817 [Selaginella moellendorffii]
Length=371

 Score =   272 bits (695),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP VGI AGD +W ARYILER+TE A VVL+ DPKPIEGDWNGAGCH NYS
Sbjct  193  MPGQWEFQVGPVVGISAGDQLWAARYILERVTEIANVVLSFDPKPIEGDWNGAGCHANYS  252

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+E+IKKAI  L L+H+DHI+AYGEGNERRLTG+HETA I+TFSWGVANRG 
Sbjct  253  TKSMREEGGYEIIKKAIGKLGLKHKDHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  312

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW P
Sbjct  313  SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWNP  355



>emb|CDY38104.1| BnaC02g06690D [Brassica napus]
Length=356

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVAETTILWKP  356



>emb|CAJ87510.1| putative glutamine synthetase [Pisum sativum]
Length=356

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVVLT DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEIWVARYILERITEVAGVVLTFDPKPIKGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L  RH +HISAYGEGNERRLTGKHETA INTFSWGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIEKLGKRHAEHISAYGEGNERRLTGKHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            S+RVGRDTEK GKGY EDRRPASNMDPYVV
Sbjct  314  SVRVGRDTEKEGKGYFEDRRPASNMDPYVV  343



>gb|AIK03054.1| glutamine synthetase [Eichhornia crassipes]
Length=356

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGR+TEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRETEKNGKGYFEDRRPASNMDPYVVTSMVAETTILWKP  356



>ref|XP_003528974.1| PREDICTED: glutamine synthetase PR-2 [Glycine max]
 gb|KHN45263.1| Glutamine synthetase PR-2 [Glycine soja]
Length=356

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AG +++ DPKPI GDWNGAG H+NYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGAIVSFDPKPIPGDWNGAGAHSNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGS  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|XP_002873784.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50043.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYIL+RITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILQRITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPY VT+++AE+T+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIAESTILWKP  356



>gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum]
 gb|ABW89466.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   271 bits (694),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>emb|CAA29058.1| glutamine synthetase [Pisum sativum]
Length=259

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVVLT DPKPI+GDWNGAG HTNYS
Sbjct  97   MPGQWEFQVGPSVGISAGDEIWVARYILERITEVAGVVLTFDPKPIKGDWNGAGAHTNYS  156

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L  R  +HISAYGEGNERRLTGKHETA INTFSWGVANRG 
Sbjct  157  TKSMREDGGYEIIKKAIEKLGKRLPEHISAYGEGNERRLTGKHETADINTFSWGVANRGA  216

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            S+RVGRDTEK GKGY EDRRPASNMDPYVV
Sbjct  217  SVRVGRDTEKEGKGYFEDRRPASNMDPYVV  246



>ref|XP_007043312.1| Glutamine synthetase 1,4 [Theobroma cacao]
 gb|EOX99143.1| Glutamine synthetase 1,4 [Theobroma cacao]
Length=356

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDQLWVARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG  VIKKAI  L LRH++HI+AYGEGNERRLTG+HETA IN+FSWGVANRG 
Sbjct  254  TKSMRNDGGIHVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINSFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTMLWKP  356



>ref|XP_009370554.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X1 
[Pyrus x bretschneideri]
Length=356

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTE++GKGY EDRRPASNMDPY+V
Sbjct  314  SIRVGRDTEQAGKGYFEDRRPASNMDPYIV  343



>gb|ABW89463.1| glutamine synthetase [Gossypium raimondii]
 gb|KJB10477.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=356

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDELWVARYILERITETAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum]
 gb|ABW89465.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDELWVARYILERITETAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+ W+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIPWKP  356



>ref|XP_008365754.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTE++GKGY EDRRPASNMDPY+V
Sbjct  314  SIRVGRDTEQAGKGYFEDRRPASNMDPYIV  343



>ref|XP_011085871.1| PREDICTED: glutamine synthetase cytosolic isozyme [Sesamum indicum]
Length=356

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPIEGDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWIARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR+EGG+E+IKKAI  L  RH++HI+AYGEGNERRLTGKHETA+INTF WGVANRG 
Sbjct  254  TKSMRKEGGYEIIKKAIEKLGHRHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|NP_568335.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
 sp|Q9FMD9.1|GLN14_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-4; AltName: 
Full=Glutamate--ammonia ligase GLN1;4; Short=GLN1;4 [Arabidopsis 
thaliana]
 dbj|BAB10184.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL24414.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAM91149.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED92312.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
Length=356

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTE++GKGY EDRRPASNMDPY VT+++AE+T+LW+P
Sbjct  314  SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAESTILWKP  356



>gb|AFN42876.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPIEGDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKS R +GGFEVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSTRSDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETTLLW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLLWKP  356



>dbj|BAD99525.1| glutamine synthetase [Camellia sinensis]
 gb|AEM44626.1| theanine synthetase [Camellia sinensis]
Length=356

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPIEGDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKS R +GGFEVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSTRSDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETTLLW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLLWKP  356



>ref|XP_002972155.1| hypothetical protein SELMODRAFT_270944 [Selaginella moellendorffii]
 gb|EFJ27072.1| hypothetical protein SELMODRAFT_270944 [Selaginella moellendorffii]
Length=371

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP VGI AGD +W ARYILERITE A VVL+ DPKPIEGDWNGAGCHTNYS
Sbjct  193  MPGQWEFQVGPVVGISAGDQLWAARYILERITEIANVVLSFDPKPIEGDWNGAGCHTNYS  252

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK MREEGG+E+IKKAI  L L+H+DHI+AYGEGNERRLTG+HETA I+TFSWGVANRG 
Sbjct  253  TKRMREEGGYELIKKAIGKLGLKHKDHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  312

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW P
Sbjct  313  SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWNP  355



>dbj|BAM84282.1| glutamine synthetase [Tulipa pulchella]
Length=353

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+LDPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVI KAI  LSL+H++HISAYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRSDGGYEVILKAIEKLSLKHKEHISAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVV  343



>gb|EYU45782.1| hypothetical protein MIMGU_mgv1a009017mg [Erythranthe guttata]
Length=355

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPIEGDWNGAG HTNYS
Sbjct  193  MPGQWEFQVGPAVGISAGDEVWIARYILERITEIAGVVLSFDPKPIEGDWNGAGAHTNYS  252

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+I KAI  LSLRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  253  TKSMREDGGYEIILKAIEKLSLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  312

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTEK GKGY EDRRPASNMDPY+V
Sbjct  313  SIRVGRDTEKEGKGYFEDRRPASNMDPYIV  342



>gb|AIR07816.1| cytosolic glutamine synthetase 1-1, partial [Vitis labrusca x 
Vitis vinifera]
Length=318

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI AGD +W +RYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  156  MPGQWEYQVGPSVGISAGDELWVSRYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  215

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFEVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  216  TKSMRNDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  275

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  276  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  318



>gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis]
Length=356

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRHDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKQGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco
Length=432

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGIEAGDHIWCARYILERIT QAGVVL+LDP PIEGD NGAGCHTNYS
Sbjct  254  MPGQWEFQVGPSVGIEAGDHIWCARYILERITGQAGVVLSLDPLPIEGDTNGAGCHTNYS  313

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T SMRE+GGFEVIKKA LNLSLRH +HI+AYGEG   +LTG HETASI+ FSWGVA RG 
Sbjct  314  TLSMREDGGFEVIKKANLNLSLRHLEHINAYGEGILEKLTGNHETASIDYFSWGVAFRGA  373

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            SIRVG DTEK GKGYLEDRRPASNMDPYVVT LLA+TT+LW+PT
Sbjct  374  SIRVGADTEKQGKGYLEDRRPASNMDPYVVTGLLAQTTILWEPT  417



>ref|XP_011002191.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Populus 
euphratica]
Length=356

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPS+GI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSIGISAGDELWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T+SMR EGG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TESMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|XP_010492569.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W AR+ILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARFILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY VT+++AE+T+LW+P
Sbjct  314  SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAESTILWKP  356



>ref|NP_176794.1| glutamine synthetase [Arabidopsis thaliana]
 sp|Q8LCE1.2|GLN12_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-2; AltName: 
Full=Glutamate--ammonia ligase GLN1;2; Short=GLN1;2 [Arabidopsis 
thaliana]
 gb|AAG51310.1|AC026480_17 glutamine synthetase, putative [Arabidopsis thaliana]
 gb|AAM14052.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AAM67495.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34474.1| glutamine synthetase [Arabidopsis thaliana]
Length=356

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D IW ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAADEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+E+IKKAI  L LRH++HISAYGEGNERRLTG HETA INTF WGVANRG 
Sbjct  254  TKSMREEGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETTLLW P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWNP  356



>ref|XP_006482120.1| PREDICTED: glutamine synthetase nodule isozyme-like [Citrus sinensis]
 gb|KDO50818.1| hypothetical protein CISIN_1g018434mg [Citrus sinensis]
Length=356

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG H NYS
Sbjct  194  MPGQWEFQVGPAVGISAGDQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHANYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFEVIKKAI  L LRH +HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|AID48673.1| theanine synthetase [Camellia oleifera]
Length=356

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI +GD +W ARYILERITE AGVV++ DPKPIEGDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISSGDQLWMARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFEVIKKAI  L L+H++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMRSDGGFEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPA NMDPYVVT+++A TT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPAPNMDPYVVTSMIANTTILWKP  356



>ref|NP_001185327.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34476.1| glutamine synthetase [Arabidopsis thaliana]
Length=365

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D IW ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  203  MPGQWEFQVGPSVGISAADEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  262

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+E+IKKAI  L LRH++HISAYGEGNERRLTG HETA INTF WGVANRG 
Sbjct  263  TKSMREEGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  322

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETTLLW P
Sbjct  323  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWNP  365



>ref|XP_007152660.1| hypothetical protein PHAVU_004G148300g [Phaseolus vulgaris]
 sp|P04771.1|GLNA2_PHAVU RecName: Full=Glutamine synthetase PR-2; AltName: Full=Gln isozyme 
alpha; AltName: Full=Glutamate--ammonia ligase [Phaseolus 
vulgaris]
 emb|CAA27632.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW24654.1| hypothetical protein PHAVU_004G148300g [Phaseolus vulgaris]
 prf||1208270B synthetase R2,Gln
Length=356

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AG V++ DPKPI GDWNGAG H+NYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWAARYILERITELAGAVVSFDPKPIPGDWNGAGAHSNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRH++HI+AYG+GNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIEKLGLRHKEHIAAYGKGNERRLTGRHETADINTFSWGVANRGS  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SVRVGRDTEKQGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|NP_001268175.1| glutamine synthetase cytosolic isozyme 1 [Vitis vinifera]
 sp|P51118.1|GLNA1_VITVI RecName: Full=Glutamine synthetase cytosolic isozyme 1; AltName: 
Full=Glutamate--ammonia ligase [Vitis vinifera]
 emb|CAA63981.1| glutamine synthetase [Vitis vinifera]
 emb|CBI15615.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWE+QVGPSVGI AGD +W +RYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEYQVGPSVGISAGDELWVSRYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFEVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRNDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|AGC24239.1| glutamine synthetase 1 [Brassica napus]
 emb|CDX85499.1| BnaA02g03140D [Brassica napus]
Length=356

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVAETTILWKP  356



>ref|XP_009126124.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Brassica 
rapa]
Length=356

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY VT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYTVTSMVAETTILWKP  356



>ref|XP_006391363.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28649.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=340

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D +W ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  178  MPGQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  237

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRH++HISAYGEGNERRLTG HETA INTF WGVANRG 
Sbjct  238  TKSMREEGGYEVIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  297

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++AETTLLW P
Sbjct  298  SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTLLWNP  340



>gb|KHG29839.1| Glutamine synthetase cytosolic isozyme 1-1 [Gossypium arboreum]
Length=356

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVVL+ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDQIWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG +VIKKAI  L LRH++HI+AYGEGNERRLTG+HETA IN+FSWGVANRG 
Sbjct  254  TKSMRNDGGIDVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINSFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|XP_008659016.1| PREDICTED: glutamine synthetase root isozyme 5 isoform X1 [Zea 
mays]
 gb|AFW89162.1| glutamine synthetase3 [Zea mays]
Length=306

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AG+VL+LDPKPI+GDWNGAG HTNYS
Sbjct  143  MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGAHTNYS  202

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE GG+EVIK+AI  L  RHR+HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  203  TKSMREAGGYEVIKEAIEKLGKRHREHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  262

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQ  282
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT ++A+TT+LW+
Sbjct  263  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIADTTILWK  304



>ref|XP_006844043.1| hypothetical protein AMTR_s00006p00241880 [Amborella trichopoda]
 gb|ERN05718.1| hypothetical protein AMTR_s00006p00241880 [Amborella trichopoda]
Length=356

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD IW ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG +VIKKAI  L LRH++HISAYGEGNERRLTG HETA INTFSWGVANRG 
Sbjct  254  TKSMREDGGIDVIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|KHG00636.1| Glutamine synthetase cytosolic isozyme 1 [Gossypium arboreum]
Length=356

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INT+ WGVANRG 
Sbjct  254  TKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGNERRLTGRHETADINTYLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|KCW69395.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=313

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  151  MPGQWEFQVGPSVGISASDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  210

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MR EGG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  211  TKTMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  270

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  271  SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  313



>ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
 gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
Length=356

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR  GG+EVIKKAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMRANGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTEK GKGY EDRRPASNMDPYVV
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVV  343



>gb|AIR07817.1| cytosolic glutamine synthetase 1-2, partial [Vitis labrusca x 
Vitis vinifera]
Length=321

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPI+GDWNGAG HTNYS
Sbjct  159  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  218

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  219  TKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  278

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AE+T+LW+P
Sbjct  279  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAESTILWKP  321



>gb|AJD14834.1| glutamine synthetase [Boehmeria nivea]
Length=356

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI +GD +W ARYILERITE AGVVL+ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISSGDQVWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR EGG +VIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMRNEGGIDVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>gb|KDP43303.1| hypothetical protein JCGZ_24224 [Jatropha curcas]
Length=356

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG  VIKKAI  L LRH++HI+AYGEGNERRLTG+HETA I+TFSWGVANRG 
Sbjct  254  TKSMRNDGGLAVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEKSGKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKSGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>ref|XP_001782920.1| predicted protein [Physcomitrella patens]
 gb|EDQ52271.1| predicted protein [Physcomitrella patens]
Length=360

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+ GI A D +W ARYILERITE AGVVL+LDPKPI+GDWNGAGCHTNYS
Sbjct  194  MPGQWEFQVGPAKGIAAADQLWAARYILERITEIAGVVLSLDPKPIDGDWNGAGCHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVIKKAI  L LRH++HI++YGEGNERRLTGKHETA +N+FSWGVANRG 
Sbjct  254  TKSMRADGGYEVIKKAIEKLGLRHKEHIASYGEGNERRLTGKHETADMNSFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  276
            S+RVGRDTEK GKGY EDRRPASNMDPYVVT ++A TT+LW P+
Sbjct  314  SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMVAYTTILWSPS  357



>gb|AAR29057.1| glutamine synthetase 1 [Datisca glomerata]
Length=356

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INT  WGVANRG 
Sbjct  254  TKSMREKGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTSLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETTLLW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWKP  356



>dbj|BAA04995.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D +W ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+E+IKKAI  L LRH++HISAYGEGNERRLTG HETA INTF WGVANRG 
Sbjct  254  TKSMREEGGYEIIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++AETT+LW P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMVAETTILWNP  356



>gb|ABK23723.1| unknown [Picea sitchensis]
 gb|ABR17424.1| unknown [Picea sitchensis]
Length=355

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI +GD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGISSGDQVWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG +VIKKAI  L LRH++HISAYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMREEGGIKVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTE+ GKGY EDRRPASNMDPY+V
Sbjct  314  SIRVGRDTEREGKGYFEDRRPASNMDPYIV  343



>gb|KFK41041.1| hypothetical protein AALP_AA2G077900 [Arabis alpina]
Length=356

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D IW ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAADEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRH++HISAYGEGNERRLTG HETA INTF WGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++AETTLLW P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTLLWNP  356



>ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=356

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D +W ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG+EVIKKAI  L LRH++HISAYGEGNERRLTG HETA INTF WGVANRG 
Sbjct  254  TKSMREEGGYEVIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++AETTLLW P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTLLWNP  356



>emb|CAN68162.1| hypothetical protein VITISV_015673 [Vitis vinifera]
Length=356

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AE+T+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAESTILWKP  356



>gb|KCW69394.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=348

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI A D +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  186  MPGQWEFQVGPSVGISASDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  245

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TK+MR EGG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  246  TKTMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  305

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  306  SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  348



>gb|AAP33169.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AG V++ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGAVVSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GGFE+IKKAI  L L+H++HI+AYG+GNERRLTGKHETA INTFSWGVANRG 
Sbjct  254  TKSMREDGGFEIIKKAIEKLGLKHKEHIAAYGKGNERRLTGKHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGR+TEK GKGY EDRRPASNMDPY+VT+++AETT+LW+P
Sbjct  314  SVRVGRETEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWKP  356



>dbj|BAL14865.1| putative cytosolic glutamine synthetase [Tulipa gesneriana]
 dbj|BAM84283.1| glutamine synthetase [Tulipa gesneriana]
 dbj|BAM84284.1| glutamine synthetase [Tulipa gesneriana]
Length=353

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+LDPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDEVWAARYILERITELAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+EVI KAI  L L+H++HISAYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRSDGGYEVILKAIEKLGLKHKEHISAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  314  SIRVGRDTEKAGKGYFEDRRPASNMDPYVV  343



>ref|XP_006374208.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP52005.1| glutamine synthetase family protein [Populus trichocarpa]
Length=348

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPI GDWNGAG HTNYS
Sbjct  186  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  245

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GGFE+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA I+TFSWGVANRG 
Sbjct  246  TKSMRNDGGFEIIKKAIGKLQLRHKEHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  305

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK GKGY EDRRPASNMDPY+VT+++AETT+LW+P
Sbjct  306  SVRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWKP  348



>ref|XP_006360384.1| PREDICTED: glutamine synthetase nodule isozyme-like [Solanum 
tuberosum]
Length=356

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI AGD +W ARYILERI E AGVV++ DPKPI GDWNGAG H NYS
Sbjct  194  MPGQWEFQVGPAVGISAGDEVWTARYILERIAEVAGVVVSFDPKPIPGDWNGAGAHANYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGNERRLTGKHETA IN+F WGVANRGC
Sbjct  254  TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINSFKWGVANRGC  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            S+RVGRDTEK+GKGY EDRRPASNMDPY+VT+++AETT++W+P
Sbjct  314  SVRVGRDTEKAGKGYFEDRRPASNMDPYIVTSMIAETTIVWKP  356



>gb|KFK25875.1| hypothetical protein AALP_AA8G173600 [Arabis alpina]
Length=356

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI A D +W ARYILERITE AGVVL+LDPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVI KAI  L LRH++HI+AYGEGNERRLTGKHETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVILKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPY VT+++AE+T+LW+P
Sbjct  314  SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVAESTILWKP  356



>ref|XP_008358170.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTE++GKGY EDRRPASNMDPY V
Sbjct  314  SIRVGRDTEQAGKGYFEDRRPASNMDPYXV  343



>gb|ACJ11724.1| glutamine synthase [Gossypium hirsutum]
 gb|KJB77349.1| hypothetical protein B456_012G133400 [Gossypium raimondii]
 gb|KJB77350.1| hypothetical protein B456_012G133400 [Gossypium raimondii]
Length=356

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD IW ARYILERITE AGVVL+ DPKPI GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDQIWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG  VIKKAI  L LRH++HI+AYGEGNERRLTG+HETA IN+FSWGVANRG 
Sbjct  254  TKSMRNDGGINVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINSFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT++W+P
Sbjct  314  SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTIIWKP  356



>gb|ACN40288.1| unknown [Picea sitchensis]
Length=355

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGP+VGI +GD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPTVGISSGDQVWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMREEGG +VIKKAI  L LRH++HISAYGEGNERRLTG+HETA INTFSWGVANRG 
Sbjct  254  TKSMREEGGIKVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVV  318
            SIRVGRDTE+ GKGY EDRRPASNMDPY+V
Sbjct  314  SIRVGRDTEREGKGYFEDRRPASNMDPYIV  343



>ref|XP_002305885.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|EEE86396.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVVL+ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            T+SMR EGG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVA+RG 
Sbjct  254  TESMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



>emb|CBI33470.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  767  MPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEGDWNGAGCHTNYS  588
            MPGQWEFQVGPSVGI AGD +W ARYILERITE AGVV++ DPKPI+GDWNGAG HTNYS
Sbjct  194  MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  587  TKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASINTFSWGVANRGC  408
            TKSMR +GG+E+IKKAI  L LRH++HI+AYGEGNERRLTG+HETA INTF WGVANRG 
Sbjct  254  TKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  407  SIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  279
            SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++AETT+LW+P
Sbjct  314  SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100