BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048E24

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  287   1e-90   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         287   1e-90   Jatropha curcas
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             287   2e-90   Phoenix dactylifera
gb|AFV46215.1|  hypothetical protein                                    280   2e-90   Scutellaria baicalensis [Baikal skullcap]
emb|CDP11183.1|  unnamed protein product                                286   4e-90   Coffea canephora [robusta coffee]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             286   5e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  285   7e-90   Nelumbo nucifera [Indian lotus]
gb|KJB72025.1|  hypothetical protein B456_011G154000                    278   7e-90   Gossypium raimondii
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             285   9e-90   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  284   2e-89   Gossypium arboreum [tree cotton]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           284   2e-89   Tarenaya hassleriana [spider flower]
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             284   2e-89   Vitis vinifera
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             284   3e-89   Setaria italica
dbj|BAH57232.1|  AT4G13940                                              277   4e-89   Arabidopsis thaliana [mouse-ear cress]
gb|KJB72026.1|  hypothetical protein B456_011G154000                    279   4e-89   Gossypium raimondii
gb|KJB19538.1|  hypothetical protein B456_003G108500                    283   5e-89   Gossypium raimondii
gb|EMT11613.1|  Adenosylhomocysteinase                                  276   7e-89   
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  283   7e-89   
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  283   8e-89   Sesamum indicum [beniseed]
ref|XP_003601687.1|  Adenosylhomocysteinase                             282   1e-88   Medicago truncatula
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                282   1e-88   Tarenaya hassleriana [spider flower]
emb|CAH69227.1|  putative adenosylhomocysteinase                        275   1e-88   Nicotiana glauca [glaucous tobacco]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    282   1e-88   Gossypium raimondii
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    282   1e-88   Medicago sativa [alfalfa]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             282   1e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             282   1e-88   Sesamum indicum [beniseed]
gb|AFK46472.1|  unknown                                                 275   2e-88   Lotus japonicus
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       281   3e-88   Prunus mume [ume]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                281   3e-88   
gb|KJB28098.1|  hypothetical protein B456_005G027700                    281   3e-88   Gossypium raimondii
gb|KJB72027.1|  hypothetical protein B456_011G154000                    279   3e-88   Gossypium raimondii
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  281   3e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             281   4e-88   Prunus persica
gb|KHN12344.1|  Adenosylhomocysteinase                                  278   4e-88   Glycine soja [wild soybean]
dbj|BAA03710.1|  cytokinin binding protein CBP57                        280   4e-88   Nicotiana sylvestris
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  281   4e-88   Malus domestica [apple tree]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             281   4e-88   Setaria italica
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  281   5e-88   Gossypium arboreum [tree cotton]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                280   6e-88   Erythranthe guttata [common monkey flower]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      280   6e-88   Gossypium hirsutum [American cotton]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  280   7e-88   Pyrus x bretschneideri [bai li]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             279   8e-88   Oryza sativa Japonica Group [Japonica rice]
gb|KJB72029.1|  hypothetical protein B456_011G154000                    279   8e-88   Gossypium raimondii
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                280   8e-88   Eucalyptus grandis [rose gum]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    280   8e-88   Gossypium raimondii
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               280   9e-88   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             280   9e-88   Arabidopsis lyrata subsp. lyrata
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  280   9e-88   Nelumbo nucifera [Indian lotus]
ref|NP_001031627.1|  adenosylhomocysteinase 1                           276   9e-88   Arabidopsis thaliana [mouse-ear cress]
gb|EMS57067.1|  Adenosylhomocysteinase                                  278   1e-87   Triticum urartu
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             280   1e-87   Nicotiana sylvestris
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             280   1e-87   Cicer arietinum [garbanzo]
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             280   1e-87   Elaeis guineensis
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             280   1e-87   Phaseolus vulgaris [French bean]
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             280   1e-87   
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    273   1e-87   Camelina sativa [gold-of-pleasure]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             279   1e-87   Sesamum indicum [beniseed]
gb|KHG17040.1|  Adenosylhomocysteinase                                  279   1e-87   Gossypium arboreum [tree cotton]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    279   2e-87   Arabis alpina [alpine rockcress]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  279   2e-87   Malus domestica [apple tree]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    279   2e-87   
ref|XP_010097949.1|  hypothetical protein L484_026840                   279   2e-87   Morus notabilis
ref|NP_001031628.1|  adenosylhomocysteinase 1                           278   2e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             279   2e-87   Elaeis guineensis
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             279   3e-87   Nicotiana tomentosiformis
gb|EPS72602.1|  adenosylhomocysteinase                                  281   3e-87   Genlisea aurea
tpg|DAA38860.1|  TPA: hypothetical protein ZEAMMB73_022938              271   3e-87   
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     278   3e-87   Nicotiana tabacum [American tobacco]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             278   3e-87   Pyrus x bretschneideri [bai li]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             278   3e-87   Capsella rubella
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             278   4e-87   Oryza brachyantha
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             278   4e-87   Glycine max [soybeans]
gb|KHN44476.1|  Adenosylhomocysteinase                                  272   5e-87   Glycine soja [wild soybean]
gb|ACN34730.1|  unknown                                                 278   5e-87   Zea mays [maize]
gb|AGT16642.1|  Adenosylhomocysteinase                                  278   5e-87   Saccharum hybrid cultivar R570
ref|NP_001148534.1|  adenosylhomocysteinase                             278   6e-87   
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    278   6e-87   Arabis alpina [alpine rockcress]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       278   6e-87   Gentiana triflora
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  278   7e-87   Solanum lycopersicum
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   278   7e-87   Ricinus communis
gb|KJB72028.1|  hypothetical protein B456_011G154000                    278   8e-87   Gossypium raimondii
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             277   8e-87   Solanum tuberosum [potatoes]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   277   8e-87   Populus tomentosa [Chinese white poplar]
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  277   8e-87   Vitis vinifera
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             277   9e-87   Selaginella moellendorffii
ref|NP_001067845.2|  Os11g0455500                                       278   9e-87   
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    277   9e-87   
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             277   1e-86   Phoenix dactylifera
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     276   1e-86   Eucalyptus grandis [rose gum]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       279   1e-86   
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  277   1e-86   Fragaria vesca subsp. vesca
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      277   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                277   1e-86   Tarenaya hassleriana [spider flower]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             277   1e-86   Populus euphratica
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   277   1e-86   Populus tomentosa [Chinese white poplar]
ref|NP_193130.1|  adenosylhomocysteinase 1                              277   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             276   2e-86   Solanum lycopersicum
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    276   2e-86   Pinus pinaster [cluster pine]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   276   2e-86   Populus tomentosa [Chinese white poplar]
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   275   2e-86   Citrus sinensis [apfelsine]
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             276   2e-86   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT01272.1|  Adenosylhomocysteinase                                  276   2e-86   
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   276   2e-86   Populus tomentosa [Chinese white poplar]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  276   2e-86   Eucalyptus grandis [rose gum]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    276   2e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               276   3e-86   Capsicum annuum
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   276   3e-86   Populus tomentosa [Chinese white poplar]
gb|AAM62888.1|  adenosylhomocysteinase                                  276   3e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   276   3e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   276   3e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   276   4e-86   Populus tomentosa [Chinese white poplar]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             275   4e-86   Citrus sinensis [apfelsine]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   275   5e-86   Citrus sinensis [apfelsine]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     275   5e-86   Populus tomentosa [Chinese white poplar]
ref|NP_001289538.1|  adenosylhomocysteinase                             275   5e-86   Nicotiana sylvestris
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             278   5e-86   
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       275   5e-86   Gentiana triflora
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   275   6e-86   Populus tomentosa [Chinese white poplar]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       275   6e-86   Nicotiana suaveolens
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       275   6e-86   Nicotiana benthamiana
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     275   6e-86   Nicotiana tabacum [American tobacco]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   275   6e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   275   7e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   275   7e-86   Populus tomentosa [Chinese white poplar]
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    274   8e-86   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   275   9e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   275   9e-86   Populus tomentosa [Chinese white poplar]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  275   1e-85   Phoenix dactylifera
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    275   1e-85   Catharanthus roseus [chatas]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            275   1e-85   Arabidopsis thaliana [mouse-ear cress]
emb|CDP15078.1|  unnamed protein product                                275   1e-85   Coffea canephora [robusta coffee]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    275   1e-85   Lupinus luteus
emb|CDY47309.1|  BnaAnng08830D                                          275   1e-85   Brassica napus [oilseed rape]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-85   Populus tomentosa [Chinese white poplar]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          275   1e-85   Amborella trichopoda
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            275   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                274   1e-85   Brassica rapa
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    274   1e-85   Lupinus luteus
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   274   1e-85   Populus tomentosa [Chinese white poplar]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           274   2e-85   Brassica rapa
gb|EMS57266.1|  Adenosylhomocysteinase                                  281   2e-85   Triticum urartu
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             274   2e-85   Eutrema salsugineum [saltwater cress]
ref|XP_006373090.1|  adenosylhomocysteinase family protein              274   2e-85   Populus trichocarpa [western balsam poplar]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             274   2e-85   Citrus clementina [clementine]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        274   2e-85   
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                275   2e-85   Erythranthe guttata [common monkey flower]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   274   2e-85   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   273   3e-85   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   273   3e-85   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   273   3e-85   Populus tomentosa [Chinese white poplar]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            273   3e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AAA33855.1|  S-adenosylhomocysteine hydrolase                        265   3e-85   Petroselinum crispum
ref|NP_001234012.1|  adenosylhomocysteinase                             273   3e-85   
emb|CDY50423.1|  BnaCnng19320D                                          273   3e-85   Brassica napus [oilseed rape]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        273   3e-85   Cicer arietinum [garbanzo]
emb|CDY01177.1|  BnaA04g06420D                                          273   3e-85   
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             273   4e-85   Phaseolus vulgaris [French bean]
gb|AEI54335.1|  adenosylhomocysteinase                                  273   4e-85   Glycine max [soybeans]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    273   4e-85   Petroselinum crispum
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    273   4e-85   Arabis alpina [alpine rockcress]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    273   4e-85   Mesembryanthemum crystallinum
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                273   6e-85   Brassica rapa
gb|AAM19782.1|  AT3g23810/MYM9_15                                       272   7e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             272   7e-85   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189023.1|  adenosylhomocysteinase 2                              272   8e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008671500.1|  PREDICTED: adenosylhomocysteinase-like             270   8e-85   
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           272   9e-85   Camelina sativa [gold-of-pleasure]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                272   9e-85   Cucumis melo [Oriental melon]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                272   1e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    272   1e-84   Camelina sativa [gold-of-pleasure]
gb|ACN40278.1|  unknown                                                 272   1e-84   Picea sitchensis
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             273   1e-84   
gb|ABR16547.1|  unknown                                                 272   1e-84   Picea sitchensis
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             272   1e-84   Glycine max [soybeans]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                272   1e-84   
gb|ABR17322.1|  unknown                                                 271   1e-84   Picea sitchensis
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                271   2e-84   Brassica rapa
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             271   2e-84   Cucumis sativus [cucumbers]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    271   2e-84   
ref|XP_001755926.1|  predicted protein                                  271   2e-84   
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        271   2e-84   Kalanchoe daigremontiana
gb|ABR16573.1|  unknown                                                 271   2e-84   Picea sitchensis
ref|XP_001755929.1|  predicted protein                                  271   2e-84   
ref|XP_003629610.1|  Adenosylhomocysteinase                             271   3e-84   Medicago truncatula
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     271   3e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     271   3e-84   Populus tomentosa [Chinese white poplar]
gb|ABR16616.1|  unknown                                                 270   3e-84   Picea sitchensis
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     271   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     271   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     271   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        270   4e-84   Trifolium pratense [peavine clover]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     270   4e-84   Populus tomentosa [Chinese white poplar]
gb|ABK24229.1|  unknown                                                 270   4e-84   Picea sitchensis
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     270   5e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     270   5e-84   Populus tomentosa [Chinese white poplar]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             270   5e-84   
gb|ABR16138.1|  unknown                                                 270   5e-84   Picea sitchensis
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  270   5e-84   Populus euphratica
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     270   5e-84   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     270   5e-84   Populus tomentosa [Chinese white poplar]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    270   7e-84   Triticum aestivum [Canadian hard winter wheat]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     270   7e-84   Populus tomentosa [Chinese white poplar]
ref|XP_001755906.1|  predicted protein                                  270   8e-84   
gb|ABK25129.1|  unknown                                                 270   8e-84   Picea sitchensis
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             270   8e-84   Arabidopsis thaliana [mouse-ear cress]
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                     265   1e-83   
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     269   1e-83   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     269   1e-83   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     269   1e-83   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     269   2e-83   Populus tomentosa [Chinese white poplar]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    269   2e-83   Phalaenopsis sp.
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     268   2e-83   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     268   2e-83   Populus tomentosa [Chinese white poplar]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      268   2e-83   Petunia x hybrida [garden petunia]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     268   2e-83   Phaseolus vulgaris [French bean]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                271   2e-83   Erythranthe guttata [common monkey flower]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     268   3e-83   Populus tomentosa [Chinese white poplar]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    270   3e-83   Linum usitatissimum
ref|XP_002300147.1|  adenosylhomocysteinase family protein              268   4e-83   Populus trichocarpa [western balsam poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     268   4e-83   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     268   4e-83   Populus tomentosa [Chinese white poplar]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     268   5e-83   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     268   6e-83   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     267   6e-83   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     267   6e-83   Populus tomentosa [Chinese white poplar]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     267   9e-83   Cucumis sativus [cucumbers]
gb|ACI31554.1|  S-adenosyl homocysteine hydrolase                       257   2e-82   Nicotiana benthamiana
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             266   2e-82   Cucumis melo [Oriental melon]
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                264   2e-81   Solanum tuberosum [potatoes]
gb|KFK36282.1|  hypothetical protein AALP_AA4G102500                    246   6e-79   Arabis alpina [alpine rockcress]
gb|ACE96401.1|  C-x8-C-x5-C-x3-H type Zn-finger                         242   3e-77   Populus tremula [European aspen]
gb|ACE96407.1|  C-x8-C-x5-C-x3-H type Zn-finger                         242   4e-77   Populus tremula [European aspen]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                246   8e-75   Chlorella variabilis
gb|KIZ05177.1|  adenosylhomocysteinase                                  255   1e-74   Monoraphidium neglectum
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)            244   1e-74   
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  245   3e-74   Chlamydomonas reinhardtii
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    244   4e-74   Ostreococcus tauri
ref|XP_003057172.1|  adenosylhomocysteinase                             244   4e-74   Micromonas pusilla CCMP1545
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              243   9e-74   Volvox carteri f. nagariensis
ref|XP_002505983.1|  adenosylhomocysteinase                             243   1e-73   Micromonas commoda
ref|XP_001419579.1|  predicted protein                                  243   1e-73   Ostreococcus lucimarinus CCE9901
emb|CDY58805.1|  BnaC08g46780D                                          242   2e-73   Brassica napus [oilseed rape]
emb|CDX85127.1|  BnaC07g07790D                                          242   3e-73   
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       242   3e-73   Chlamydomonas sp. ICE-L
gb|AJD09650.1|  SAHH1                                                   231   5e-73   Braya humilis
gb|AJD09655.1|  SAHH1                                                   230   7e-73   Iberis amara [bitter candytuft]
gb|AJD09657.1|  SAHH1                                                   230   7e-73   Lepidium campestre [bastard cress]
gb|AJD09647.1|  SAHH1                                                   230   1e-72   Arabis alpina [alpine rockcress]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           240   1e-72   Brassica rapa
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       240   2e-72   
gb|AJD09658.1|  SAHH1                                                   229   2e-72   
gb|AJD09648.1|  SAHH1                                                   229   3e-72   
gb|AJD09646.1|  SAHH1                                                   228   3e-72   
gb|AAL09400.1|AF307335_1  cytokinin binding protein                     238   5e-72   
gb|AJD09654.1|  SAHH1                                                   228   7e-72   
gb|AJD09659.1|  SAHH1                                                   228   7e-72   
gb|AJD09652.1|  SAHH1                                                   227   1e-71   
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     238   2e-71   
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      236   7e-71   
gb|AJD09649.1|  SAHH1                                                   222   1e-69   
ref|XP_005708566.1|  adenosylhomocysteinase                             232   3e-69   
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  232   4e-69   
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      230   2e-68   
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     229   5e-68   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                230   8e-68   
ref|XP_011397211.1|  Adenosylhomocysteinase                             228   4e-67   
emb|CDY50106.1|  BnaC01g43540D                                          223   1e-65   
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  221   4e-65   
emb|CDY67319.1|  BnaA03g57570D                                          211   9e-65   
gb|EJY87176.1|  Adenosylhomocysteinase                                  219   2e-64   
gb|KFG60763.1|  putative adenosylhomocysteinase                         216   2e-64   
ref|XP_009493630.1|  adenosylhomocysteinase 1                           219   3e-64   
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   218   3e-64   
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    218   7e-64   
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   217   1e-63   
gb|EJK64241.1|  hypothetical protein THAOC_15047                        209   1e-63   
emb|CDX77483.1|  BnaA07g06210D                                          215   4e-63   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                215   9e-63   
gb|EPT27008.1|  adenosylhomocysteinase, putative                        217   9e-63   
gb|KFH13893.1|  putative adenosylhomocysteinase                         217   1e-62   
ref|XP_008872075.1|  adenosylhomocysteinase 2                           214   1e-62   
gb|KFG55060.1|  putative adenosylhomocysteinase                         217   1e-62   
gb|EPR62066.1|  putative adenosylhomocysteinase                         217   1e-62   
gb|KFG42936.1|  putative adenosylhomocysteinase                         217   1e-62   
gb|ESS32583.1|  putative adenosylhomocysteinase                         217   1e-62   
emb|CDY53211.1|  BnaC03g74050D                                          212   8e-62   
ref|XP_008611237.1|  adenosylhomocysteinase                             210   5e-61   
gb|ETO08386.1|  hypothetical protein RFI_29000                          204   5e-61   
ref|WP_036944508.1|  hypothetical protein                               210   5e-61   
gb|ETO04662.1|  hypothetical protein RFI_32734                          202   1e-60   
ref|XP_009833581.1|  adenosylhomocysteinase 2                           209   1e-60   
ref|XP_002177758.1|  adenosylhomocysteinase                             209   1e-60   
gb|ADR18482.1|  adenosylhomocysteinase                                  207   5e-60   
ref|WP_041723781.1|  adenosylhomocysteinase                             207   5e-60   
gb|KDO17385.1|  hypothetical protein SPRG_17078                         197   7e-60   
gb|ABR16332.1|  unknown                                                 207   7e-60   
gb|AHG90399.1|  Adenosylhomocysteinase                                  207   1e-59   
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             206   2e-59   
ref|WP_017355275.1|  S-adenosyl-L-homocysteine hydrolase                206   2e-59   
ref|WP_022926989.1|  S-adenosyl-L-homocysteine hydrolase                206   4e-59   
ref|XP_001023087.1|  adenosylhomocysteinase family protein              205   4e-59   
dbj|GAE20305.1|  adenosylhomocysteinase                                 201   6e-59   
dbj|GAE21599.1|  adenosylhomocysteinase                                 201   7e-59   
ref|XP_004025117.1|  hypothetical protein IMG5_191490                   204   7e-59   
ref|WP_043581849.1|  adenosylhomocysteinase                             204   1e-58   
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              204   1e-58   
gb|AAX40985.1|  S-adenosyl-L-homocysteine hydrolase                     200   3e-58   
ref|XP_002788757.1|  conserved hypothetical protein                     202   4e-58   
ref|XP_002765933.1|  conserved hypothetical protein                     202   5e-58   
ref|WP_039007649.1|  S-adenosyl-L-homocysteine hydrolase                202   6e-58   
gb|EKE10711.1|  hypothetical protein ACD_15C00209G0001                  194   6e-58   
emb|CCA20123.1|  unnamed protein product                                202   7e-58   
ref|WP_003475714.1|  adenosylhomocysteinase                             202   8e-58   
ref|WP_009576960.1|  Adenosylhomocysteinase                             202   8e-58   
ref|WP_027006534.1|  hypothetical protein                               201   3e-57   
ref|WP_026910859.1|  S-adenosyl-L-homocysteine hydrolase                201   3e-57   
ref|WP_003465484.1|  S-adenosyl-L-homocysteine hydrolase                200   3e-57   
ref|WP_027325990.1|  adenosylhomocysteinase                             200   3e-57   
ref|WP_008213996.1|  S-adenosyl-L-homocysteine hydrolase                200   3e-57   
ref|WP_027079175.1|  S-adenosyl-L-homocysteine hydrolase                200   3e-57   
ref|WP_018502367.1|  S-adenosyl-L-homocysteine hydrolase                200   3e-57   
ref|WP_027072847.1|  S-adenosyl-L-homocysteine hydrolase                200   4e-57   
ref|WP_033834449.1|  S-adenosyl-L-homocysteine hydrolase                200   5e-57   
ref|WP_044656141.1|  adenosylhomocysteinase                             195   5e-57   
ref|WP_019661087.1|  S-adenosyl-L-homocysteine hydrolase                200   5e-57   
ref|WP_043959717.1|  S-adenosyl-L-homocysteine hydrolase                199   6e-57   
ref|WP_007238886.1|  S-adenosyl-L-homocysteine hydrolase                199   7e-57   
ref|WP_005170542.1|  adenosylhomocysteinase                             199   7e-57   
ref|WP_027069325.1|  S-adenosyl-L-homocysteine hydrolase                199   8e-57   
ref|WP_012157556.1|  S-adenosyl-L-homocysteine hydrolase                199   8e-57   
ref|WP_038690480.1|  S-adenosyl-L-homocysteine hydrolase                199   8e-57   
ref|WP_010481888.1|  S-adenosyl-L-homocysteine hydrolase [              199   9e-57   
ref|WP_026869144.1|  adenosylhomocysteinase                             198   9e-57   
dbj|GAN45334.1|  S-adenosyl-L-homocysteine hydrolase                    199   9e-57   
ref|WP_026633760.1|  S-adenosyl-L-homocysteine hydrolase                199   1e-56   
ref|WP_009947852.1|  S-adenosyl-L-homocysteine hydrolase                199   1e-56   
ref|WP_013219512.1|  S-adenosyl-L-homocysteine hydrolase                197   1e-56   
ref|WP_005415311.1|  S-adenosyl-L-homocysteine hydrolase                199   1e-56   
ref|WP_039856658.1|  S-adenosyl-L-homocysteine hydrolase                199   2e-56   
gb|KFA30189.1|  S-adenosyl-L-homocysteine hydrolase                     196   2e-56   
ref|WP_028081726.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-56   
ref|WP_025876541.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-56   
ref|WP_028769932.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-56   
ref|WP_008375899.1|  adenosylhomocysteinase                             198   2e-56   
emb|CCI50303.1|  unnamed protein product                                198   2e-56   
emb|CDJ37737.1|  adenosylhomocysteinase, putative                       198   2e-56   
gb|KGK58630.1|  S-adenosyl-L-homocysteine hydrolase                     198   2e-56   
ref|WP_032974920.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-56   
ref|WP_033830371.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-56   
emb|CBK23294.2|  unnamed protein product                                197   2e-56   
ref|WP_039564728.1|  S-adenosyl-L-homocysteine hydrolase                198   3e-56   
ref|WP_027493191.1|  S-adenosyl-L-homocysteine hydrolase                197   3e-56   
ref|WP_028061676.1|  hypothetical protein                               197   3e-56   
ref|WP_021645958.1|  adenosylhomocysteinase                             197   3e-56   
gb|ADK98228.1|  S-adenosyl-homocysteine hydrolase                       187   3e-56   
ref|WP_010568439.1|  S-adenosyl-L-homocysteine hydrolase                196   4e-56   
ref|WP_019182466.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-56   
gb|ADK98229.1|  S-adenosyl-homocysteine hydrolase                       187   4e-56   
gb|ADK98240.1|  S-adenosyl-homocysteine hydrolase                       187   4e-56   
ref|WP_007081119.1|  S-adenosyl-L-homocysteine hydrolase                197   5e-56   
ref|WP_019466297.1|  S-adenosyl-L-homocysteine hydrolase                197   5e-56   
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              197   5e-56   
ref|WP_012917260.1|  S-adenosyl-L-homocysteine hydrolase                197   5e-56   
ref|WP_018180991.1|  S-adenosyl-L-homocysteine hydrolase                197   5e-56   
ref|WP_005910841.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   5e-56   
ref|WP_011346442.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   5e-56   
ref|WP_002775930.1|  S-adenosyl-L-homocysteine hydrolase                196   6e-56   
emb|CDJ69092.1|  adenosylhomocysteinase, putative                       197   6e-56   
ref|WP_031421135.1|  S-adenosyl-L-homocysteine hydrolase                197   6e-56   
ref|WP_014089407.1|  S-adenosyl-L-homocysteine hydrolase                197   6e-56   
ref|WP_038614995.1|  S-adenosyl-L-homocysteine hydrolase                197   6e-56   
ref|WP_043397992.1|  S-adenosyl-L-homocysteine hydrolase                197   6e-56   
ref|WP_004154241.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   6e-56   
ref|WP_019338084.1|  S-adenosyl-L-homocysteine hydrolase                197   6e-56   
ref|WP_014036003.1|  S-adenosyl-L-homocysteine hydrolase                197   6e-56   
ref|WP_012501941.1|  S-adenosyl-L-homocysteine hydrolase                196   6e-56   
ref|WP_038031735.1|  adenosylhomocysteinase                             196   7e-56   
dbj|GAB40911.1|  adenosylhomocysteinase                                 198   7e-56   
ref|XP_010024044.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    195   7e-56   
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                197   7e-56   
ref|WP_020651088.1|  S-adenosyl-L-homocysteine hydrolase                196   8e-56   
ref|WP_036194122.1|  S-adenosyl-L-homocysteine hydrolase                197   8e-56   
ref|WP_024957291.1|  S-adenosyl-L-homocysteine hydrolase                196   8e-56   
ref|WP_019737854.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-56   
ref|WP_010409859.1|  S-adenosyl-L-homocysteine hydrolase                196   8e-56   
ref|WP_009155258.1|  S-adenosyl-L-homocysteine hydrolase                196   9e-56   
ref|WP_016551225.1|  adenosylhomocysteinase                             195   9e-56   
ref|WP_032576381.1|  adenosylhomocysteinase                             196   1e-55   
ref|WP_044300351.1|  adenosylhomocysteinase                             196   1e-55   
ref|WP_005781763.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    196   1e-55   
emb|CDA85923.1|  adenosylhomocysteinase                                 194   1e-55   
ref|WP_029219085.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-55   
ref|XP_004344078.1|  Sadenosyl-L-homocysteine hydrolase, putative       196   1e-55   
ref|WP_014645960.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-55   
ref|WP_006370365.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-55   
ref|WP_005991516.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-55   
ref|XP_010024043.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    194   1e-55   
ref|XP_002781556.1|  adenosylhomocysteinase, putative                   186   1e-55   
ref|WP_007509390.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-55   
ref|WP_027484548.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-55   
ref|WP_017912973.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_015448722.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_008770078.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_027490068.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_039404132.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_029207109.1|  hypothetical protein                               187   2e-55   
ref|WP_006538559.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-55   
ref|WP_010367570.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    196   2e-55   
ref|WP_022301900.1|  adenosylhomocysteinase                             194   2e-55   
ref|WP_039440812.1|  S-adenosyl-L-homocysteine hydrolase                195   2e-55   
gb|ADK98242.1|  S-adenosyl-homocysteine hydrolase                       185   2e-55   
ref|WP_009514080.1|  S-adenosyl-L-homocysteine hydrolase                195   2e-55   
ref|WP_008019385.1|  S-adenosyl-L-homocysteine hydrolase, NAD bin...    192   2e-55   
ref|WP_044606136.1|  hypothetical protein                               194   3e-55   
ref|WP_033429119.1|  adenosylhomocysteinase                             195   3e-55   
ref|WP_015104941.1|  Adenosylhomocysteinase                             195   3e-55   
ref|WP_006895565.1|  adenosylhomocysteinase                             195   3e-55   
ref|WP_007028966.1|  S-adenosyl-L-homocysteine hydrolase                195   3e-55   
ref|WP_018636612.1|  S-adenosyl-L-homocysteine hydrolase                195   3e-55   
gb|ADK98221.1|  S-adenosyl-homocysteine hydrolase                       185   3e-55   
ref|WP_038508580.1|  adenosylhomocysteinase                             195   3e-55   
ref|WP_041266969.1|  adenosylhomocysteinase                             195   3e-55   
gb|ADG77823.1|  adenosylhomocysteinase                                  195   3e-55   
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     194   4e-55   
ref|WP_026917209.1|  S-adenosyl-L-homocysteine hydrolase                195   4e-55   
ref|WP_041448694.1|  adenosylhomocysteinase                             195   4e-55   
ref|WP_009741556.1|  S-adenosyl-L-homocysteine hydrolase                195   4e-55   
dbj|BAH40894.1|  adenosylhomocysteinase                                 195   4e-55   
ref|WP_014360923.1|  S-adenosyl-L-homocysteine hydrolase                195   4e-55   
ref|WP_030534490.1|  MULTISPECIES: adenosylhomocysteinase               195   4e-55   
ref|WP_015679205.1|  adenosylhomocysteinase                             194   4e-55   
ref|XP_002902721.1|  adenosylhomocysteinase                             194   4e-55   
ref|WP_028008156.1|  S-adenosyl-L-homocysteine hydrolase                194   4e-55   
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                      194   4e-55   
ref|XP_008893590.1|  adenosylhomocysteinase                             194   4e-55   
ref|WP_007661865.1|  S-adenosyl-L-homocysteine hydrolase                194   4e-55   
gb|ABS24379.1|  adenosylhomocysteinase                                  195   5e-55   
ref|WP_030426804.1|  hypothetical protein                               195   5e-55   
gb|ETR69755.1|  Adenosylhomocysteinase                                  194   5e-55   
ref|WP_041944766.1|  S-adenosyl-L-homocysteine hydrolase                195   5e-55   
ref|WP_035634402.1|  adenosylhomocysteinase                             193   5e-55   
ref|WP_009679225.1|  S-adenosyl-L-homocysteine hydrolase                194   5e-55   
ref|WP_024710446.1|  S-adenosyl-L-homocysteine hydrolase                194   5e-55   
ref|WP_024745553.1|  S-adenosyl-L-homocysteine hydrolase                194   5e-55   
gb|ACF28652.1|  adenosylhomocysteinase                                  190   6e-55   
ref|WP_029917627.1|  hypothetical protein                               194   6e-55   
ref|WP_022849981.1|  S-adenosyl-L-homocysteine hydrolase                194   6e-55   
ref|WP_007315856.1|  S-adenosyl-L-homocysteine hydrolase                194   6e-55   
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                194   6e-55   
ref|WP_035857732.1|  hypothetical protein                               194   7e-55   
ref|WP_016268876.1|  adenosylhomocysteinase                             194   7e-55   
ref|WP_008433716.1|  S-adenosyl-L-homocysteine hydrolase                194   7e-55   
gb|KIG17698.1|  Adenosylhomocysteinase                                  193   7e-55   
ref|WP_008765354.1|  S-adenosyl-L-homocysteine hydrolase                194   7e-55   
ref|WP_017915311.1|  S-adenosyl-L-homocysteine hydrolase                194   7e-55   
ref|WP_010535621.1|  S-adenosyl-L-homocysteine hydrolase                194   7e-55   
ref|WP_019300158.1|  S-adenosyl-L-homocysteine hydrolase                194   7e-55   
ref|WP_029720180.1|  hypothetical protein                               194   7e-55   
ref|WP_028478774.1|  S-adenosyl-L-homocysteine hydrolase                194   7e-55   
ref|WP_007322036.1|  S-adenosyl-L-homocysteine hydrolase                194   7e-55   
ref|WP_043093152.1|  S-adenosyl-L-homocysteine hydrolase                194   7e-55   
ref|WP_010572375.1|  S-adenosyl-L-homocysteine hydrolase                193   7e-55   
ref|WP_017909629.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-55   
ref|WP_042613665.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-55   
ref|WP_006841877.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-55   
ref|WP_006801116.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-55   
ref|WP_022968411.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-55   
ref|WP_043585025.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-55   
emb|CAJ65404.1|  Adenosylhomocysteinase (S-adenosyl-L-homocystein...    194   8e-55   
ref|WP_013829917.1|  S-adenosyl-L-homocysteine hydrolase                194   8e-55   



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKTTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW+EK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWREKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YIS+P EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQAEYISVPTEGPYKPPHYRY  485



>gb|AFV46215.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=302

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK+
Sbjct  143  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRITIKPQTDRWVFPETKS  202

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  203  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERTSGKYEKKVYVLPKHLDE  262

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYRY
Sbjct  263  KVAALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  302



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK+
Sbjct  326  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T  
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   285 bits (730),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLADGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKGTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>gb|KJB72025.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=265

 Score =   278 bits (711),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  106  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  165

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  166  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  225

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  226  KVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  265



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   285 bits (729),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVEHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERETGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQAEYISVPIEGPYKPAHYRY  485



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLSTDQADYISVPIEGPYKPPHYRY  485



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMK+MKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVHHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+PEQAAYIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSPEQAAYISVPVEGPYKPTHYRY  485



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+  QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLSKSQADYISVPIEGPYKPAHYRY  485



>dbj|BAH57232.1| AT4G13940 [Arabidopsis thaliana]
Length=291

 Score =   277 bits (709),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  132  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  191

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  192  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  251

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  252  KVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  291



>gb|KJB72026.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=345

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  186  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  245

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  246  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  305

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  306  KVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  345



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVSHMK+MKNNAIVCNIGHFDNEIDM GLETYPG+KRITIKPQTDR++FPET  
Sbjct  326  GNKDIIMVSHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGIKRITIKPQTDRWIFPETNR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYRY
Sbjct  446  KVASLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>gb|EMT11613.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=292

 Score =   276 bits (707),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  133  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETNT  192

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  193  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  252

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  253  KVAALHLGKLGARLTKLTKAQSEYISIPVEGPYKPAAYRY  292



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPAQAEYISVPIEGPYKPPHYRY  485



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPPHYRY  485



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETK+
Sbjct  326  GNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYISVPIEGPYKPPHYRY  485



>emb|CAH69227.1| putative adenosylhomocysteinase [Nicotiana glauca]
Length=264

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  105  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  164

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  165  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  224

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  225  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  264



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETK+
Sbjct  326  GNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLG+LGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGQLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPG+KRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMQGLETYPGIKRITIKPQTDRWVFPETST  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERKTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQAEYISVPVEGPYKPVHYRY  485



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAI+CNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVGHMRKMKNNAIICNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>gb|AFK46472.1| unknown [Lotus japonicus]
Length=290

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAI+ NIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  131  GNKDIIMVDHMRKMKNNAIISNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTNS  190

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDE
Sbjct  191  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDE  250

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL  +Q+ YISIP+EGPYKP HYRY
Sbjct  251  KVAALHLGKLGARLTKLRKDQSDYISIPIEGPYKPAHYRY  290



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMK+MKNNAIVCNIGHFDNEIDM GLETYPG+KRITIKPQTDR+VFPET  
Sbjct  326  GNKDIIMVCHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGIKRITIKPQTDRWVFPETNR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKPP YRY
Sbjct  446  KVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPPRYRY  485



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWTEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLVKLGAKLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  264  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  323

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  324  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  383

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  384  KVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  423



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPG+KRITIKPQTDRFVFPETK+
Sbjct  328  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGIKRITIKPQTDRFVFPETKS  387

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  388  GVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  447

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  448  KVAALHLNKLGAKLTKLTKDQSDYLSIPVEGPYKPAHYRY  487



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVEHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  249  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  308

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  309  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  368

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  369  KVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  408



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  291  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNS  350

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  351  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  410

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  411  KVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  450



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+  Q+ YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKSQSDYISVPIEGPYKPAHYRY  485



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVSHMK+MKNNA+VCNIGHFDNEIDM GLETYPG+KRITIKPQTDR++FPET  
Sbjct  326  GNKDIIMVSHMKQMKNNAVVCNIGHFDNEIDMLGLETYPGIKRITIKPQTDRWIFPETNR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
             V +LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYRY
Sbjct  446  MVGSLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT EQ+ YISIPVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKEQSDYISIPVEGPYKPPHYRY  485



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  291  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNT  350

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  351  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  410

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  411  KVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  450



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score =   279 bits (714),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  297  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  356

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  357  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  416

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  417  KVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  456



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVHHMKKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   280 bits (716),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  485



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   280 bits (716),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPPHYRY  485



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   280 bits (716),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE  PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLEILPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            G+I+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GVIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT EQAAYIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTSEQAAYISVPVEGPYKPAHYRY  485



>ref|NP_001031627.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83346.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=364

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  205  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  264

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  265  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  324

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  325  KVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  364



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  257  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKT  316

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDE
Sbjct  317  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDE  376

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  377  KVAALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAYRY  416



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE YPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLENYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKR  IKPQTDR+VFPET T
Sbjct  326  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRTNIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLG+LGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGQLGAKLTKLTKEQADYISVPVEGPYKPVHYRY  485



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET  
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNV  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+P QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSPAQADYISVPVEGPYKPAHYRY  485



>ref|XP_010466741.1| PREDICTED: adenosylhomocysteinase 2-like isoform X2 [Camelina 
sativa]
Length=291

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  132  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKS  191

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  192  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  251

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  252  KVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  291



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAI+CNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVGHMRKMKNNAIICNIGHFDNEIDMQGLETYPGVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIVVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ YISIP++GPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYISIPIQGPYKPPHYRY  485



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPETK+
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  YRY
Sbjct  446  KVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAAYRY  485



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE++TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT  QA YISIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKSQADYISIPIEGPYKPAHYRY  485



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERTTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLSKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  281  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  340

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  341  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  400

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  401  KVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  440



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE YPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLENYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  485



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGV+RITIKPQTDR+VFP+TKT
Sbjct  408  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVERITIKPQTDRYVFPDTKT  467

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+++GKYEKKVYVLPKHLDE
Sbjct  468  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERSSGKYEKKVYVLPKHLDE  527

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ EQA YIS+ VEGPYKP HYRY
Sbjct  528  KVAALHLGKLGAKLTKLSKEQADYISVAVEGPYKPAHYRY  567



>tpg|DAA38860.1| TPA: hypothetical protein ZEAMMB73_022938 [Zea mays]
Length=270

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQ DR+VFPET T
Sbjct  111  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQIDRWVFPETNT  170

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLELWKEKN+GKYEKKVYVLPKHLDE
Sbjct  171  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLELWKEKNSGKYEKKVYVLPKHLDE  230

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KV ALHLGK GAKLTKLT  QA YI +P+EGPYK  HYRY
Sbjct  231  KVNALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAHYRY  270



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  320  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNS  379

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  380  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  439

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  440  KVAALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  479



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY GVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYAGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMTKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT  QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLTKSQADYISVPVEGPYKPAHYRY  485



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>gb|KHN44476.1| Adenosylhomocysteinase [Glycine soja]
Length=291

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET PGVKRI IKPQTDR+VFP+TK 
Sbjct  132  GNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETCPGVKRINIKPQTDRWVFPDTKR  191

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDE
Sbjct  192  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDE  251

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  252  KVASLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  291



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  485



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK+ITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKKITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPLHYRY  485



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDI+MV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIVMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW+EK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWREKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   278 bits (710),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  245
            KVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYR
Sbjct  446  KVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYR  484



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETGT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKL+ +QAAYI++PVEGPYKP HYRY
Sbjct  446  KVAALHLPKLGAKLTKLSADQAAYINVPVEGPYKPAHYRY  485



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  356  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNT  415

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  416  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  475

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  476  KVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  515



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+L KL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLAKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV  M+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +PGVKRITIKPQTDR+VFP+TK+
Sbjct  308  GNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRITIKPQTDRWVFPDTKS  367

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKY+K+VYVLPKHLDE
Sbjct  368  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYKKEVYVLPKHLDE  427

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHYRY
Sbjct  428  KVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  467



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  245
            KVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  446  KVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGV+RITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMLEHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVQRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ EQA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKEQADYISVPIEGPYKPAHYRY  485



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKY+K+VYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYKKEVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+P++GPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPIDGPYKPPHYRY  485



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  446  KVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDE
Sbjct  386  GILVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGA LTKL+PEQAAYI++PVEGPYKP HYRY
Sbjct  446  KVAALHLPKLGAHLTKLSPEQAAYINVPVEGPYKPAHYRY  485



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM++MKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +
Sbjct  286  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNS  345

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  346  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  405

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  406  KVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  445



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  446  KVAALHLGKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY  485



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  446  KVAALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAYRY  485



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM++MKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKY+K+VYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYKKEVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  485



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  308  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  367

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  368  GIIVLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  427

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+L KL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  428  KVALLHLGKLGARLRKLSKDQSDYVSIPIEGPYKPPHYRY  467



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            G+I+LAEGRLMNLGCA GHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GVIVLAEGRLMNLGCAAGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAPLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +Q  Y+SIP+EGPYKPPHYRY
Sbjct  446  KVALLHLGKLGARLTKLSKDQXDYVSIPIEGPYKPPHYRY  485



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKH DE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHFDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PG KRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGAKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITI+PQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIEPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMK+NAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKSNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  429  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKT  488

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  489  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  548

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYRY
Sbjct  549  KVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  588



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS MKKMKNNAIVCNIGHFDNEIDM GLETYPGVK+ITIKPQTDR+VFPETK+
Sbjct  326  GNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKKITIKPQTDRWVFPETKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  YRY
Sbjct  446  KVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPLAYRY  485



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKV+VLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVHVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWSEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR+
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRH  485



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPVTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK + KYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSSKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  291  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKT  350

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  351  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  410

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT  Q+ YISIP+EGPYKP  YRY
Sbjct  411  KVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKPAAYRY  450



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITI PQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITILPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+  +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDISS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDI+MV HM+KMKNNAIVCNIGHFDNEIDMHGLE +PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDILMVGHMRKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YI++P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQAEYINVPIEGPYKPAHYRY  485



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQADYISVPIEGPYKPAHYRY  485



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHL+E
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLNE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  446  KVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDII+V HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKR+TIKPQTDR++FPE +T
Sbjct  326  GNKDIIIVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRVTIKPQTDRWIFPENET  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRL NLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLTNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT  QAAYI++PVEGPYKPPHYRY
Sbjct  446  KVAALHLGKLGAKLTKLTSGQAAYINVPVEGPYKPPHYRY  485



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  485



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  327  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRITIKPQTDRWVFPDTKS  386

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  387  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  446

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  447  KVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  486



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLD 
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDG  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKR TIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRNTIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKY+K+VYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYQKQVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA LTKL+P+QA YI++P+EGPYKPP YRY
Sbjct  446  KVASLHLGKLGAHLTKLSPDQAEYINVPIEGPYKPPQYRY  485



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSF NQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFINQVIAQLELWNEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  446  KVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFPET T
Sbjct  329  GNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHPGVKRITIKPQTDRWVFPETNT  388

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  389  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  448

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  KVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  488



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEI MHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIGMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPGHYRY  485



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   281 bits (718),  Expect = 2e-85, Method: Composition-based stats.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPET T
Sbjct  593  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETNT  652

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDE
Sbjct  653  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDE  712

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT  Q+ YISIPV+GPYKP  YRY
Sbjct  713  KVAALHLGKLGARLTKLTKAQSEYISIPVDGPYKPAAYRY  752



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPVHYRY  485



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GILVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HMKKMKNNAIVCNIGHFDNEID+ GLETYPGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDVLGLETYPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  388  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTKS  447

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDE
Sbjct  448  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDE  507

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +Q+ Y+SIPVEGPYKPPHYRY
Sbjct  508  KVAALHLGKLGAKLTKLTKDQSDYVSIPVEGPYKPPHYRY  547



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHG ET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGPETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ ELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQPELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTSS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPETK 
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETKA  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
             II+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  EIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  446  KVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AAA33855.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=227

 Score =   265 bits (677),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS M+KMKNNAIV NIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T  
Sbjct  68   GNKDIIMVSDMRKMKNNAIVDNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTGR  127

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYV PKHLDE
Sbjct  128  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVCPKHLDE  187

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  188  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  227



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGK GAKLTKLT +QA YI +PVEGPYKP HYRY
Sbjct  446  KVAALHLGKFGAKLTKLTKDQADYIYVPVEGPYKPAHYRY  485



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMAGLENYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+N+GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERNSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLNKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LWKEK+ GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLGLWKEKSIGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T  
Sbjct  326  GNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTGR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDRFVFPET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRFVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLM LGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMKLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP  YRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVSYRY  485



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|XP_008671500.1| PREDICTED: adenosylhomocysteinase-like [Zea mays]
Length=426

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQ DR+VFPET T
Sbjct  267  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQIDRWVFPETNT  326

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLELWKEKN+GKYEKKVYVLPKHLDE
Sbjct  327  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLELWKEKNSGKYEKKVYVLPKHLDE  386

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KV ALHLGK GAKLTKLT  QA YI +P+EGPYK  HYRY
Sbjct  387  KVNALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAHYRY  426



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET  
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNV  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  348  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  407

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  408  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  467

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  468  KVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  507



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET PGVKRI IKPQTDR+VFP+TK 
Sbjct  326  GNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETCPGVKRINIKPQTDRWVFPDTKR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  446  KVASLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMCGLENYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  245
            KVAALHL KLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  446  KVAALHLPKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS M+KMKNNAIV NIGHFDNEIDMHGLET+P VKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLETFPDVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS M+KMKNNAIV NIGHFDNEIDMHGLET+P VKRITIKPQTDR+VFP+TKT
Sbjct  326  GNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLETFPDVKRITIKPQTDRWVFPDTKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK 
Sbjct  326  GNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETYPGVKRITIKPQTDRWVFPDTKR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  446  KVALLHLEKLGARLTKLSEDQASYINVPVGGPYKPAHYRY  485



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKD+IMVS MK+MKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFPET +
Sbjct  326  GNKDVIMVSDMKRMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKLT EQA YIS+P+EGPYKP  YRY
Sbjct  446  KVAALHLSKLGAKLTKLTKEQADYISVPIEGPYKPAAYRY  485



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGA+LTKL+P+QA YI++P+EGPYKP HYRY
Sbjct  446  KVAALHLPKLGARLTKLSPDQAEYINVPIEGPYKPAHYRY  485



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+TK 
Sbjct  326  GNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETYPGVKRITIKPQTDRWVFPDTKR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  446  KVALLHLEKLGARLTKLSEDQASYINVPVGGPYKPAHYRY  485



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE YPGVKR+TIKPQTDR+VFPET T
Sbjct  326  GNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMSGLENYPGVKRVTIKPQTDRWVFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +
Sbjct  291  GNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNS  350

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  351  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  410

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGA+LTKL+P+QA YI++PV+GPYKP HYRY
Sbjct  411  KVAALHLPKLGARLTKLSPDQAEYINVPVDGPYKPAHYRY  450



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV  MKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR++FPET T
Sbjct  326  GNKDIIMVDDMKKMKNNAIVCNIGHFDNEIDMSGLENYPGVKRITIKPQTDRWLFPETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LT+L+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTELSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HM+KMKNNAIVCNIGHFDNEID+ GLE +PGVK+ITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDIQGLENFPGVKKITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPET  
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFPETNV  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM+ HM+K+KNNAIVCNIGHFDNEIDM GLET+PGVK+ITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMLDHMRKIKNNAIVCNIGHFDNEIDMQGLETFPGVKKITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGV+RITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVRRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+L LGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLRLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRITIKPQTDR+VFPETKT
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPETKT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT  Q+ YISIP+EGPYK   YRY
Sbjct  446  KVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKLRLYRY  485



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGV+RITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVRRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK 
Sbjct  326  GNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLETFPGVKRITIKPQTDRWVFPDTKR  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERTSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  446  KVALLHLEKLGARLTKLSDDQASYINVPVGGPYKPAHYRY  485



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDI+M+ HM+KMKNNAIVCNIGHFDNEID+ GLE +PGVK+ITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIVMLDHMRKMKNNAIVCNIGHFDNEIDIQGLENFPGVKKITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPK LDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKRLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|ABJ53283.1| S-adenosyl-L-homocysteine hydrolase [Ligularia fischeri]
Length=327

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMVS MKKMKNNAIVCNIGHFDNEIDM GLETYPGV+RITIKPQTDR+VFPETK 
Sbjct  168  GNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVQRITIKPQTDRWVFPETKA  227

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY+ +VYVLPKHLDE
Sbjct  228  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYKNEVYVLPKHLDE  287

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLT L+ +QA YI++PVEGPYKP +YRY
Sbjct  288  KVAALHLGKLGAKLTVLSKDQADYINVPVEGPYKPLNYRY  327



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI+ PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINAPVEGPYKPAQYRY  485



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP++K+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDSKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIM  HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMADHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFT+QVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTDQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE++PGVKRITIKPQTDR VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLESFPGVKRITIKPQTDRRVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GI++LAEGRLMNLGCATGHPSFVMS SFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE
Sbjct  386  GILVLAEGRLMNLGCATGHPSFVMSSSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLTPSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            G+KDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GSKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFD+EIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDSEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSEDQADYINVPVEGPYKPAQYRY  485



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPS VMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSVVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  446  KVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPVHYRY  485



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VF ET T
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRWVFLETNT  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HYRY
Sbjct  446  KVAALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV  MK+MKNNAIVCNIGHFDNEIDM GLE YPGVKRITIKPQTDR+VFPETK+
Sbjct  415  GNKDIIMVDQMKRMKNNAIVCNIGHFDNEIDMQGLENYPGVKRITIKPQTDRWVFPETKS  474

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDE
Sbjct  475  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDE  534

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVAALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYRY
Sbjct  535  KVAALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  574



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGH DNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHLDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM+GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  402  GNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMNGLETFPGVKRITIKPQTDRWVFPDTKS  461

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDE
Sbjct  462  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDE  521

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP  YRY
Sbjct  522  KVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAQYRY  561



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++P+EGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPIEGPYKPAQYRY  485



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  721  GNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKT  542
            GNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+TK+
Sbjct  326  GNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTKS  385

Query  541  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDE  362
            GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYV PKHLDE
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVSPKHLDE  445

Query  361  KVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  242
            KVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  446  KVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425