BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048E03

Length=795
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009759318.1|  PREDICTED: tip elongation aberrant protein 3...    273   3e-83   Nicotiana sylvestris
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    274   9e-83   Nicotiana tomentosiformis
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...    265   2e-79   Solanum tuberosum [potatoes]
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...    259   2e-77   Solanum lycopersicum
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    259   2e-77   Sesamum indicum [beniseed]
emb|CDO98898.1|  unnamed protein product                                246   3e-72   Coffea canephora [robusta coffee]
gb|KDO75101.1|  hypothetical protein CISIN_1g0050432mg                  237   3e-72   Citrus sinensis [apfelsine]
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...    236   1e-68   Vitis vinifera
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...    234   6e-68   
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...    234   9e-68   Prunus mume [ume]
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg             233   2e-67   Citrus clementina [clementine]
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...    233   2e-67   Citrus sinensis [apfelsine]
emb|CAN77820.1|  hypothetical protein VITISV_043441                     236   2e-67   Vitis vinifera
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...    231   8e-67   Pyrus x bretschneideri [bai li]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...    231   9e-67   Pyrus x bretschneideri [bai li]
ref|XP_007222490.1|  hypothetical protein PRUPE_ppa004126mg             227   1e-66   
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...    229   4e-66   Nelumbo nucifera [Indian lotus]
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4            229   4e-66   Gossypium arboreum [tree cotton]
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4            229   5e-66   Gossypium arboreum [tree cotton]
ref|XP_011012826.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   5e-66   Populus euphratica
gb|KJB72601.1|  hypothetical protein B456_011G187500                    228   6e-66   Gossypium raimondii
gb|KJB72598.1|  hypothetical protein B456_011G187500                    228   6e-66   Gossypium raimondii
gb|KJB72599.1|  hypothetical protein B456_011G187500                    229   7e-66   Gossypium raimondii
gb|KJB72596.1|  hypothetical protein B456_011G187500                    228   9e-66   Gossypium raimondii
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   1e-65   
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   1e-65   
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   2e-65   Elaeis guineensis
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...    228   2e-65   Elaeis guineensis
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...    227   3e-65   Populus euphratica
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...    227   3e-65   Populus euphratica
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...    227   3e-65   Populus euphratica
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...    226   8e-65   Phoenix dactylifera
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...    225   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   3e-64   
gb|KJB38636.1|  hypothetical protein B456_006G264600                    223   3e-64   Gossypium raimondii
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g             224   3e-64   
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...    224   4e-64   Fragaria vesca subsp. vesca
gb|KJB38635.1|  hypothetical protein B456_006G264600                    223   6e-64   Gossypium raimondii
ref|XP_004486293.1|  PREDICTED: uncharacterized protein LOC101494304    210   9e-64   
gb|KDP40010.1|  hypothetical protein JCGZ_02008                         222   2e-63   Jatropha curcas
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein      222   2e-63   Gossypium arboreum [tree cotton]
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...    221   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...    221   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    220   1e-62   
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...    220   1e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...    219   2e-62   
dbj|BAH19562.1|  AT5G18590                                              219   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                       219   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                             219   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    219   3e-62   
ref|XP_002873905.1|  kelch repeat-containing protein                    218   5e-62   
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...    217   9e-62   Cucumis melo [Oriental melon]
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...    216   1e-61   Solanum tuberosum [potatoes]
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...    217   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...    217   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...    214   7e-61   Cucumis sativus [cucumbers]
ref|XP_010931596.1|  PREDICTED: tip elongation aberrant protein 3...    213   2e-60   
gb|KJB72597.1|  hypothetical protein B456_011G187500                    212   3e-60   Gossypium raimondii
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                213   4e-60   Erythranthe guttata [common monkey flower]
ref|XP_002516884.1|  acyl-CoA binding protein, putative                 213   4e-60   Ricinus communis
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...    213   7e-60   Elaeis guineensis
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...    213   7e-60   
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...    213   7e-60   Elaeis guineensis
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...    213   7e-60   Elaeis guineensis
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg             212   8e-60   Eutrema salsugineum [saltwater cress]
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...    211   2e-59   Solanum lycopersicum
emb|CDY13903.1|  BnaC09g39230D                                          211   2e-59   Brassica napus [oilseed rape]
ref|XP_004486044.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   2e-58   Cicer arietinum [garbanzo]
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   3e-58   Brassica rapa
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g             207   4e-58   
emb|CDX92598.1|  BnaA10g16370D                                          207   5e-58   
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   7e-58   Cicer arietinum [garbanzo]
gb|AES91803.2|  acyl-CoA-binding domain protein                         207   8e-58   Medicago truncatula
gb|KEH32273.1|  acyl-CoA-binding domain protein                         207   8e-58   Medicago truncatula
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein         207   1e-57   
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...    206   1e-57   
gb|KHN47303.1|  hypothetical protein glysoja_020171                     196   2e-57   Glycine soja [wild soybean]
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g             205   3e-57   Phaseolus vulgaris [French bean]
gb|AES64218.2|  acyl-CoA-binding domain protein                         202   2e-56   Medicago truncatula
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...    202   4e-56   
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein         202   5e-56   
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...    202   5e-56   
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...    200   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...    199   4e-55   
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g             199   5e-55   Phaseolus vulgaris [French bean]
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...    196   4e-54   Glycine max [soybeans]
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4            196   9e-54   Glycine soja [wild soybean]
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...    195   2e-53   Glycine max [soybeans]
gb|EPS74438.1|  hypothetical protein M569_00314                         190   3e-53   Genlisea aurea
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...    194   4e-53   Glycine max [soybeans]
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4            187   5e-51   Glycine soja [wild soybean]
gb|AES91804.2|  acyl-CoA-binding domain protein                         185   5e-50   Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein         185   5e-50   
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   1e-49   Cicer arietinum [garbanzo]
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   1e-49   Cicer arietinum [garbanzo]
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   1e-49   
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...    184   1e-49   
ref|XP_006855461.1|  hypothetical protein AMTR_s00057p00182130          179   4e-48   
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...    174   4e-46   Populus euphratica
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...    174   4e-46   Populus euphratica
ref|NP_001068393.1|  Os11g0657000                                       165   2e-43   
gb|EEC68565.1|  hypothetical protein OsI_36893                          166   2e-43   Oryza sativa Indica Group [Indian rice]
gb|EEE52499.1|  hypothetical protein OsJ_34700                          165   6e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663088.1|  PREDICTED: acyl-CoA-binding domain-containin...    163   2e-42   
ref|XP_006663087.1|  PREDICTED: acyl-CoA-binding domain-containin...    163   2e-42   Oryza brachyantha
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...    162   5e-42   Setaria italica
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...    161   1e-41   
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...    158   1e-40   Brachypodium distachyon [annual false brome]
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...    158   1e-40   
ref|XP_008677101.1|  PREDICTED: uncharacterized protein LOC100279...    157   5e-40   Zea mays [maize]
ref|XP_003575710.1|  PREDICTED: acyl-CoA-binding domain-containin...    155   2e-39   Brachypodium distachyon [annual false brome]
ref|XP_006664610.1|  PREDICTED: acyl-CoA-binding domain-containin...    149   2e-37   Oryza brachyantha
ref|XP_010098333.1|  hypothetical protein L484_023581                   149   2e-37   
gb|KDO75103.1|  hypothetical protein CISIN_1g0050432mg                  145   2e-37   Citrus sinensis [apfelsine]
dbj|BAJ86800.1|  predicted protein                                      149   3e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00700.1|  predicted protein                                      149   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002442260.1|  hypothetical protein SORBIDRAFT_08g017180          145   2e-36   
ref|NP_001066944.1|  Os12g0538800                                       145   7e-36   
gb|EEC69433.1|  hypothetical protein OsI_38606                          145   7e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...    145   1e-35   
gb|AFW60227.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    144   2e-35   
ref|XP_004962837.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   2e-35   
dbj|BAK00043.1|  predicted protein                                      139   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004962833.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   2e-35   Setaria italica
ref|NP_001145999.1|  uncharacterized protein LOC100279529               144   3e-35   
ref|NP_001146281.1|  uncharacterized protein LOC100279856               143   4e-35   Zea mays [maize]
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...    139   2e-33   
gb|EMT26901.1|  hypothetical protein F775_29769                         133   6e-32   
gb|AFW60226.1|  hypothetical protein ZEAMMB73_572222                    127   2e-29   
ref|XP_002975032.1|  hypothetical protein SELMODRAFT_415315             125   7e-29   Selaginella moellendorffii
ref|XP_002977452.1|  hypothetical protein SELMODRAFT_417505             125   8e-29   Selaginella moellendorffii
gb|EMS52652.1|  Acyl-CoA-binding domain-containing protein 4            123   1e-27   Triticum urartu
gb|EMT25879.1|  hypothetical protein F775_10881                         115   4e-25   
gb|EMS62709.1|  Acyl-CoA-binding domain-containing protein 4            113   1e-24   Triticum urartu
ref|XP_001759823.1|  predicted protein                                  113   2e-24   
ref|XP_001760924.1|  predicted protein                                  107   1e-22   
ref|XP_001751751.1|  predicted protein                                97.4    5e-19   
ref|XP_001761501.1|  predicted protein                                84.0    7e-16   
gb|ABA95166.1|  Kelch motif family protein, expressed                 86.7    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        82.8    2e-14   
emb|CDY02611.1|  BnaC02g08240D                                        70.9    1e-12   
gb|ABR25493.1|  rangap1 interacting protein                           68.9    5e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_001765510.1|  predicted protein                                66.2    4e-09   
gb|EEE53353.1|  hypothetical protein OsJ_36377                        65.9    6e-09   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009759318.1| PREDICTED: tip elongation aberrant protein 3-like [Nicotiana 
sylvestris]
Length=634

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = -1

Query  735  ERGTRQLDSGLEHIDS--KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK  562
            E+G +QLD G++   S  K + EE+ TI ESG++  H +Q SGNF  D+DDFVFQESD K
Sbjct  416  EQGAKQLDVGIKTSSSGGKIVTEEMSTITESGHLPNHYRQASGNFFQDTDDFVFQESDYK  475

Query  561  FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLA  382
             G++A  G  Q YEAKL+AL+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ 
Sbjct  476  AGLTASSGACQQYEAKLSALMRKNEILEGQLAAALANREAAEKNLSSALKSKQDMEKRMG  535

Query  381  DAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG  202
            D +KE++LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG
Sbjct  536  DTVKEVELLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRG  595

Query  201  LLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            +L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  596  VLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  634



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   274 bits (700),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = -1

Query  735  ERGTRQLDSGLEHIDS--KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK  562
            E+G +QLD G++   S  K + EE+ TI ESG++  H +Q SGNF  D+DDFVFQESD K
Sbjct  489  EQGAKQLDIGIKTSSSGGKIVTEEMSTITESGHLPNHYRQASGNFFQDTDDFVFQESDYK  548

Query  561  FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLA  382
             G++A  G  Q YEAKL+AL+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ 
Sbjct  549  AGLTASSGACQQYEAKLSALMRKNEILEGQLAAALANREAAEKNLSSALKSKQDVEKRMG  608

Query  381  DAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG  202
            D +KE++LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG
Sbjct  609  DTVKEVELLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRG  668

Query  201  LLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            +L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  669  VLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  707



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 167/220 (76%), Gaps = 10/220 (5%)
 Frame = -1

Query  735  ERGTRQLDSGLEHIDS---KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDC  565
            E+G +QLD G     S   K + EE+ TI ESG++ TH +Q S NF  D+DDFVFQE D 
Sbjct  489  EQGAKQLDIGGPKTSSNGGKIMSEEMSTISESGHLPTHYRQASANFFQDTDDFVFQEGDY  548

Query  564  KFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKL  385
            K G+ A  G  Q YEAKL++L+RKN                A     +A+KSKQD EKK+
Sbjct  549  KAGLPASSGACQQYEAKLSSLMRKN-------GILEGQLATALAGREAAVKSKQDMEKKM  601

Query  384  ADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTR  205
            ADA+KE++LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELH+TR
Sbjct  602  ADAVKEMELLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHTTR  661

Query  204  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            G+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  662  GVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  701



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 169/219 (77%), Gaps = 9/219 (4%)
 Frame = -1

Query  735  ERGTRQLDSGLEHIDS--KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK  562
            E+G +QLD GL+   +  K + EE+ TI ESG++ TH +Q S NF  D+DDFV QE D K
Sbjct  489  EQGAKQLDIGLKTCSNGGKIMSEEMSTISESGHLPTHYRQASANFFQDTDDFVSQEGDYK  548

Query  561  FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLA  382
             G+ A  G  Q +EAKL++L+RKN               AA     +A++SKQD EKK++
Sbjct  549  AGLPASSGACQQHEAKLSSLMRKN-------GILEGQLAAALAGREAAVRSKQDMEKKMS  601

Query  381  DAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG  202
            DA+KE++LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHSTRG
Sbjct  602  DAVKEMELLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHSTRG  661

Query  201  LLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            +L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  662  VLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  700



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 185/221 (84%), Gaps = 2/221 (1%)
 Frame = -1

Query  744  QVMERGTRQLDSGLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESD  568
            ++ME+ T+ LDSG+        I EE   + ES N+    K GSG+  L+S+D VFQE+D
Sbjct  493  RMMEQNTKPLDSGIGVSYSGDRITEETSLVSESDNL-NLDKHGSGSLSLESEDLVFQETD  551

Query  567  CKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKK  388
             K  ISAP G+YQ YEAKL +LLRKNG+LEGQLAAALA+REAA+K+LS A+KS+QD E+K
Sbjct  552  GKSRISAPSGVYQIYEAKLASLLRKNGILEGQLAAALAAREAAEKNLSLAIKSRQDMERK  611

Query  387  LADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHST  208
            L +AM+EI+LLKEKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHST
Sbjct  612  LGEAMREIELLKEKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHST  671

Query  207  RGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            RG+L GERARAFQLQVEVFHLKQRLQ+LE RAPTPRKPFHV
Sbjct  672  RGVLAGERARAFQLQVEVFHLKQRLQTLETRAPTPRKPFHV  712



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 181/200 (91%), Gaps = 3/200 (2%)
 Frame = -1

Query  675  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQ---SYEAKLTA  505
            +EI +  ESGN+ TH++QGSG+  LDSDD +FQESD K G+S P  ++Q   SYE KL A
Sbjct  511  KEISSASESGNLETHRRQGSGSLSLDSDDLLFQESDGKAGVSVPSNVHQFHQSYELKLGA  570

Query  504  LLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELA  325
            L+RKNG+LEGQLAAA++SRE+A+K+LS+A+KS+Q+ EKKLADAMKE++LLKEKLAGVELA
Sbjct  571  LIRKNGILEGQLAAAISSRESAEKNLSTAVKSRQEMEKKLADAMKEMELLKEKLAGVELA  630

Query  324  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHL  145
            QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHL
Sbjct  631  QEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHL  690

Query  144  KQRLQSLENRAPTPRKPFHV  85
            KQRLQSLENRAPTPRKPFHV
Sbjct  691  KQRLQSLENRAPTPRKPFHV  710



>gb|KDO75101.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
 gb|KDO75102.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=365

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasre  445
            QG GNF +D+D+ +F ++D    +S P  +YQ YE+K+ AL+RKNG+LEGQLAAAL +RE
Sbjct  186  QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNRE  245

Query  444  aadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEH  265
            AA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEH
Sbjct  246  AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH  305

Query  264  DVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            DVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  306  DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  365



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 2/198 (1%)
 Frame = -1

Query  675  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALL  499
            +EI ++ +S N   +  QG+GN  +D+DD VF ES  K    SAP  +YQ YE K+ AL+
Sbjct  521  DEIPSVLDSENSNAYN-QGNGNLLVDNDDEVFPESHGKSVAFSAPSSIYQLYETKMAALI  579

Query  498  RKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQE  319
            RKNG+LEGQL AALASREA +K+LSS LK++Q+ EKKLAD +KE+++LKEKLAGVELAQE
Sbjct  580  RKNGILEGQLTAALASREAVEKNLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGVELAQE  639

Query  318  EANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQ  139
            EAN+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQ
Sbjct  640  EANNLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQ  699

Query  138  RLQSLENRAPTPRKPFHV  85
            RLQS+ENRAPTPRKPFHV
Sbjct  700  RLQSMENRAPTPRKPFHV  717



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  536  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  595

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  596  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  655

Query  267  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+
Sbjct  656  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFN  715

Query  87   V  85
            V
Sbjct  716  V  716



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score =   234 bits (596),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 180/221 (81%), Gaps = 4/221 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES  571
            Q  E+   Q DSG++   + S+   EE+ +  E  N + H   G GN  +D++D +F E+
Sbjct  495  QPTEKKNSQSDSGVQTNVLGSRLYSEEMLSGYEYEN-SNHHNHGIGNLSVDNNDAMFLET  553

Query  570  DCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  394
            D K G +SAP  +Y  YE+K+ +L+RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E
Sbjct  554  DSKPGALSAPSSIYHYYESKMASLIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEME  613

Query  393  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  214
            +KLAD  KE++LLKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELH
Sbjct  614  RKLADTAKEMELLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  673

Query  213  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            STRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  674  STRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  714



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasre  445
            QG GNF +D+D+ +F ++D    +S P  +YQ YE K+  L+RKNG+LEGQLAAAL +RE
Sbjct  538  QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYETKMADLIRKNGILEGQLAAALVNRE  597

Query  444  aadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEH  265
            AA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEH
Sbjct  598  AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH  657

Query  264  DVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            DVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  658  DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasre  445
            QG GNF +D+D+ +F ++D    +S P  +YQ YE K+  L+RKNG+LEGQLAAAL +RE
Sbjct  538  QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYETKMADLIRKNGILEGQLAAALVNRE  597

Query  444  aadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEH  265
            AA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEH
Sbjct  598  AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH  657

Query  264  DVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            DVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  658  DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>emb|CAN77820.1| hypothetical protein VITISV_043441 [Vitis vinifera]
Length=1034

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  624   QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
             QG+GN  +D+DD VF ES  K    SAP  +YQ YE K+ AL+RKNG+LEGQL AALASR
Sbjct  854   QGNGNLLVDNDDEVFPESHGKSVAFSAPSSIYQLYETKMAALIRKNGILEGQLTAALASR  913

Query  447   eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
             EA +K+LSS LK++Q+ EKKLAD +KE+++LKEKLAGVELAQEEAN+LSNIVHSDNVRLE
Sbjct  914   EAVEKNLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGVELAQEEANNLSNIVHSDNVRLE  973

Query  267   HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
             HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH
Sbjct  974   HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFH  1033

Query  87    V  85
             V
Sbjct  1034  V  1034



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES  571
            Q +E+ T Q DSG++      +   EEI +  +  N   H   G+GN  +D++D VF E+
Sbjct  492  QPIEKKTSQSDSGVQTNIYGGRLFSEEILSGYDFENSNPHH-HGTGNLSMDNNDAVFPEN  550

Query  570  DCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  394
            D K G +S    +Y  YE+K+ AL+RKNG+LEG+LA  +AS+EAA+K+LSSALKS+Q+ E
Sbjct  551  DSKLGALSTASSMYHYYESKMAALIRKNGILEGKLATVMASQEAAEKNLSSALKSRQEME  610

Query  393  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  214
            +KL+D+ KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELH
Sbjct  611  RKLSDSAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  670

Query  213  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            STRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  671  STRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES  571
            Q +E+ T Q DSG++      +   EEI +  +  N   H   G+GN  +D++D VF E+
Sbjct  492  QPIEKKTSQSDSGVQTNIYGGRLFSEEILSGYDFENSNPHH-HGTGNLSMDNNDAVFPEN  550

Query  570  DCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  394
            D K G +S    +Y  YE+K+ AL+RKNG+LEG+LA  +A++EAA+K+LSSALKS+Q+ E
Sbjct  551  DSKLGALSTASSMYHYYESKMAALIRKNGILEGKLATVMANQEAAEKNLSSALKSRQEME  610

Query  393  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  214
            +KL+D+ KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELH
Sbjct  611  RKLSDSAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  670

Query  213  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            STRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  671  STRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_007222490.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
 gb|EMJ23689.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
Length=528

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES  571
            Q  E+   + DSG++   + ++   EE+ +  E  N + H   G GN  +D++D +F E+
Sbjct  309  QPTEKKNSRSDSGVQTNVLGNRLYSEEMLSGYEYEN-SNHHNHGIGNLSVDNNDAMFLET  367

Query  570  DCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  394
            D K G +SAP  +Y  YE+K+   +RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E
Sbjct  368  DSKPGALSAPSSIYHYYESKMATQIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEME  427

Query  393  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  214
            +KLAD  KE++LLKEK AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELH
Sbjct  428  RKLADTAKEMELLKEKAAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  487

Query  213  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            STRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  488  STRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  528



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 165/197 (84%), Gaps = 3/197 (2%)
 Frame = -1

Query  675  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  496
            EE   + +S N    +KQ + N   +SD+    E+D   G SAP  +YQ Y++K+ AL+R
Sbjct  514  EETPFVFDSENTRPLQKQANVNLLSESDEIAIPETD---GKSAPSNVYQLYDSKIAALVR  570

Query  495  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  316
            KNG+LE QLAA+LA REAA+K+LSS +KS+QD EKKLAD MKE+++LKEKLAGVELAQEE
Sbjct  571  KNGILEAQLAASLAGREAAEKNLSSVIKSRQDIEKKLADTMKEMEMLKEKLAGVELAQEE  630

Query  315  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  136
            ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQR
Sbjct  631  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQR  690

Query  135  LQSLENRAPTPRKPFHV  85
            LQS+ENRAPTPRKPFH+
Sbjct  691  LQSVENRAPTPRKPFHM  707



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+D+D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA ALASR
Sbjct  529  EGIANDPVDNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATALASR  588

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + A+++L++ALKSK++ EKK ADAMKE++LLKEKL G+ELA EEAN+LSNIVHSDNVRLE
Sbjct  589  DTAERTLAAALKSKEEMEKKFADAMKEMELLKEKLTGIELAHEEANNLSNIVHSDNVRLE  648

Query  267  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  649  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  708

Query  87   V  85
            V
Sbjct  709  V  709



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score =   229 bits (585),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+D+D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA ALASR
Sbjct  553  EGIANDPVDNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATALASR  612

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + A+++L++ALKSK++ EKK ADAMKE++LLKEKL G+ELA EEAN+LSNIVHSDNVRLE
Sbjct  613  DTAERTLAAALKSKEEMEKKFADAMKEMELLKEKLTGIELAHEEANNLSNIVHSDNVRLE  672

Query  267  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  673  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  732

Query  87   V  85
            V
Sbjct  733  V  733



>ref|XP_011012826.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=616

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = -1

Query  681  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTAL  502
            I  E+ +I E     +H  QG GN  +D++D V  +SDC  G  A   +YQ YE K+ AL
Sbjct  419  INAEMTSIFEMETPNSHN-QGIGNVSVDNEDVVSLDSDCTTG-GARASIYQLYETKIAAL  476

Query  501  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  322
            +RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DLLKEKLAGVELAQ
Sbjct  477  IRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDLLKEKLAGVELAQ  536

Query  321  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  142
            EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  537  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  596

Query  141  QRLQSLENRAPTPRKPFHV  85
            QRLQS+ENR  TPRKPFHV
Sbjct  597  QRLQSMENRTSTPRKPFHV  615



>gb|KJB72601.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=665

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR
Sbjct  485  EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASR  544

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLE
Sbjct  545  DTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLE  604

Query  267  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  605  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  664

Query  87   V  85
            V
Sbjct  665  V  665



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR
Sbjct  499  EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASR  558

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLE
Sbjct  559  DTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLE  618

Query  267  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  619  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  678

Query  87   V  85
            V
Sbjct  679  V  679



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR
Sbjct  526  EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASR  585

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLE
Sbjct  586  DTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLE  645

Query  267  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  646  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  705

Query  87   V  85
            V
Sbjct  706  V  706



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR
Sbjct  529  EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASR  588

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLE
Sbjct  589  DTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLE  648

Query  267  HDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  88
            HDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+
Sbjct  649  HDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFN  708

Query  87   V  85
            V
Sbjct  709  V  709



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  654  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  475
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  517  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  576

Query  474  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  295
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  577  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  636

Query  294  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  115
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  637  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  696

Query  114  APTPRKPFHV  85
            APTPRKPFH+
Sbjct  697  APTPRKPFHM  706



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 174/221 (79%), Gaps = 4/221 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES  571
            Q +E+ T Q DSG++      +   EEI +  +  N   H   G+GN   D++D VF E+
Sbjct  496  QPIEKKTSQSDSGVQTNIYGGRLFSEEILSGYDFENSNPHX-HGTGNLSXDNNDAVFPEN  554

Query  570  DCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  394
            D K G +S    +Y  YE+K+  L+RKNG+LEG+LA  +AS+EAA+K+LSSALKS+Q+ E
Sbjct  555  DSKLGALSTASSMYHYYESKMAXLIRKNGILEGKLATVMASQEAAEKNLSSALKSRQEME  614

Query  393  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  214
            +KL+D  KE++ LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELH
Sbjct  615  RKLSDTAKEMEFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  674

Query  213  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            STRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  675  STRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  715



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 172/220 (78%), Gaps = 0/220 (0%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDC  565
            Q ME+ +++ ++ ++   +  +      + +S N   ++KQG+ N   DS+     E D 
Sbjct  510  QAMEQRSKKHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPPEIDN  569

Query  564  KFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKL  385
            +  ++ P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKKL
Sbjct  570  RSVLTNPSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKKL  629

Query  384  ADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTR  205
            ADA+KE++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTR
Sbjct  630  ADAIKEVELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTR  689

Query  204  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            G+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  690  GVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  729



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  654  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  475
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  543  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  602

Query  474  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  295
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  603  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  662

Query  294  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  115
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  663  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  722

Query  114  APTPRKPFHV  85
            APTPRKPFH+
Sbjct  723  APTPRKPFHM  732



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  675  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  496
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  495  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  316
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  315  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  136
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVFHLKQR
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVFHLKQR  702

Query  135  LQSLENRAPTPRKPFHV  85
            LQS+ENR PTPRKPFHV
Sbjct  703  LQSMENRTPTPRKPFHV  719



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = -1

Query  681  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTAL  502
            I  E+ +I E     +H  QG GN  +D++D V  +SDC  G  A   +YQ YE K+ AL
Sbjct  524  INAEMTSIFEMETPNSHN-QGIGNVSVDNEDVVSLDSDCTTG-GARASIYQLYETKIAAL  581

Query  501  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  322
            +RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DLLKEKLAGVELAQ
Sbjct  582  IRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDLLKEKLAGVELAQ  641

Query  321  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  142
            EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  642  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  701

Query  141  QRLQSLENRAPTPRKPFHV  85
            QRLQS+ENR  TPRKPFHV
Sbjct  702  QRLQSMENRTSTPRKPFHV  720



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  675  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  496
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  495  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  316
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  315  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQR  136
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+EVFHLKQR
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQIEVFHLKQR  702

Query  135  LQSLENRAPTPRKPFHV  85
            LQS+ENR PTPRKPFHV
Sbjct  703  LQSMENRTPTPRKPFHV  719



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score =   226 bits (576),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 159/190 (84%), Gaps = 2/190 (1%)
 Frame = -1

Query  654  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  475
            ES N+  ++KQG+ N   DS+     E++ +  ++ P  +YQ YE K+  L RKN LLE 
Sbjct  541  ESSNL--YQKQGNNNLMSDSNHIAPPETENRSMLTNPSNIYQLYETKIVTLTRKNVLLEE  598

Query  474  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  295
            QL  A+AS+EA +K+LSSA+KS+QD EKK+ADAMKE++LLKEKLA VELAQEEANSLSN+
Sbjct  599  QLNVAMASQEATEKNLSSAIKSRQDMEKKIADAMKEVELLKEKLASVELAQEEANSLSNM  658

Query  294  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR  115
            VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENR
Sbjct  659  VHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENR  718

Query  114  APTPRKPFHV  85
            APTPRKPFH+
Sbjct  719  APTPRKPFHM  728



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  523
            +K   E+  ++  + +++  +KQGS  FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  502  AKITAEKTLSMVSNHDISNLQKQGSETFPLETVDGALIFQEMDNISFAGSMSSSSVYQFH  561

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  562  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  621

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  622  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  681

Query  162  VEVFHLKQRLQSLENRAPTPRKPFHV  85
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  682  VEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 167/208 (80%), Gaps = 5/208 (2%)
 Frame = -1

Query  708  GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQ  529
            G   I S+  P        S N+   +KQ    FP+++ D +F E+D     S+ +  YQ
Sbjct  496  GANKITSEKTPSMSSDREFSSNL---QKQCPETFPMENADGIFLETDTSLASSSSV--YQ  550

Query  528  SYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKE  349
             +EAK+ AL+R+NG+LEGQL AALA REAA+++LS A+++KQ+TEKKLADAM+E++L+KE
Sbjct  551  FHEAKMAALIRRNGILEGQLTAALAGREAAERNLSVAMRTKQETEKKLADAMREVELMKE  610

Query  348  KLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQ  169
            KL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQ
Sbjct  611  KLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQ  670

Query  168  LQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            LQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  671  LQVEVFHLKQRLQSLENRAATPRKPFHV  698



>gb|KJB38636.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=632

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 175/224 (78%), Gaps = 6/224 (3%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEHIDSKT---IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQE  574
            Q  E+ T Q D+G+E     T     E      E+ N +  + +G  + P+ +D+FVF E
Sbjct  411  QATEQKTNQTDTGVEVNAPGTKIRSDESFLYECENSNPSNPRVEGITSIPVGNDNFVFPE  470

Query  573  SDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  397
             + K G +SAP  +Y  YE ++ AL R+NG+LE QL AA+ASR+  +++L+SALKSK++ 
Sbjct  471  MEGKAGALSAPSSIY--YEMRMAALSRRNGILEVQLGAAMASRDTIERNLASALKSKEEM  528

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LAD +KE+DLLKEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAF+KAVLDDTQKEL
Sbjct  529  EKRLADTVKEMDLLKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFVKAVLDDTQKEL  588

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            HSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  589  HSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  632



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = -1

Query  681  IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTAL  502
            I  E+ +I E     +H  QG GN  +D++D V  ESDC  G  A   +YQ YE K+ AL
Sbjct  510  INAEMSSIFEMETPNSHN-QGIGNVSVDNEDVVSPESDCTTG-GARASIYQLYETKIAAL  567

Query  501  LRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQ  322
            +RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E++LLKEKLAGVELAQ
Sbjct  568  IRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMELLKEKLAGVELAQ  627

Query  321  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLK  142
            EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLK
Sbjct  628  EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK  687

Query  141  QRLQSLENRAPTPRKPFHV  85
            QRLQS+ENR  TPRKPF V
Sbjct  688  QRLQSMENRTSTPRKPFRV  706



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 163/183 (89%), Gaps = 5/183 (3%)
 Frame = -1

Query  636  THKKQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaa  460
            ++   G GNFP+D++D +F ESD K G +SAP  +YQ YE     L+RKNG+LEGQLAAA
Sbjct  531  SNHNHGLGNFPVDNNDALFPESDGKPGALSAPSSMYQYYEK----LIRKNGVLEGQLAAA  586

Query  459  lasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDN  280
            LASREAA+K+LSSALKS+Q+ EKKLAD+ KEI+LLK+KLAGVELAQEEAN+LS+IVHSDN
Sbjct  587  LASREAAEKNLSSALKSRQEIEKKLADSGKEIELLKDKLAGVELAQEEANNLSSIVHSDN  646

Query  279  VRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPR  100
            VRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPR
Sbjct  647  VRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPR  706

Query  99   KPF  91
            KPF
Sbjct  707  KPF  709



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 175/224 (78%), Gaps = 6/224 (3%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEHIDSKT---IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQE  574
            Q  E+ T Q D+G+E     T     E      E+ N +  + +G  + P+ +D+FVF E
Sbjct  485  QATEQKTNQTDTGVEVNAPGTKIRSDESFLYECENSNPSNPRVEGITSIPVGNDNFVFPE  544

Query  573  SDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  397
             + K G +SAP  +Y  YE ++ AL R+NG+LE QL AA+ASR+  +++L+SALKSK++ 
Sbjct  545  MEGKAGALSAPSSIY--YEMRMAALSRRNGILEVQLGAAMASRDTIERNLASALKSKEEM  602

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            EK+LAD +KE+DLLKEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAF+KAVLDDTQKEL
Sbjct  603  EKRLADTVKEMDLLKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFVKAVLDDTQKEL  662

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            HSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  663  HSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  706



>ref|XP_004486293.1| PREDICTED: uncharacterized protein LOC101494304 [Cicer arietinum]
Length=201

 Score =   210 bits (534),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -1

Query  648  GNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegql  469
             +++  K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL
Sbjct  14   SDISLQKNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQL  73

Query  468  aaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVH  289
             AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVH
Sbjct  74   LAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVH  133

Query  288  SDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP  109
            SDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAP
Sbjct  134  SDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAP  193

Query  108  TPRKPFHV  85
            TPRKPFHV
Sbjct  194  TPRKPFHV  201



>gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 166/201 (83%), Gaps = 2/201 (1%)
 Frame = -1

Query  687  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  508
            K I EE     ES N+ + +    GN P+D+DD +  E+D   G  A   +YQ YE K+ 
Sbjct  511  KIIAEEASCGFESENLNS-QNPAIGNHPVDNDDVLVPETDGMAG-GAHSSIYQLYETKIA  568

Query  507  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  328
            AL+RKNG+LEGQLAAAL+SR++A+K+LSS LKSKQ+ EKKL DA++E++LLKE+LA VEL
Sbjct  569  ALIRKNGVLEGQLAAALSSRDSAEKNLSSVLKSKQELEKKLTDALREMELLKERLASVEL  628

Query  327  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  148
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  629  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFH  688

Query  147  LKQRLQSLENRAPTPRKPFHV  85
            LKQRLQS+ENR PTPRKPF+V
Sbjct  689  LKQRLQSMENRVPTPRKPFNV  709



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 177/222 (80%), Gaps = 5/222 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSGLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESD  568
            Q  E+ T Q D+G+E +     I  +   + E  N +  + +G  + P+ +D+FVF E +
Sbjct  485  QATEQKTNQTDTGVEVNAPGTKIRSDESFLYECEN-SNPRVEGITSVPVGNDNFVFPEVE  543

Query  567  CKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEK  391
             K G +SAP  +Y  YE ++ AL RKNG+LE QL AA+ASR++ +++L+SALKSK++ EK
Sbjct  544  GKAGALSAPSSIY--YEMRMAALSRKNGILEVQLGAAMASRDSIERNLASALKSKEEMEK  601

Query  390  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  211
            +LAD +KE+DL+KEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAFLKAVLDDTQKELHS
Sbjct  602  RLADTVKEMDLVKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  661

Query  210  TRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            TRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  662  TRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  703



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 172/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  523
            +K   E+  ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  486  AKITAEKTLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSSSVYQFH  545

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            EAK+TAL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  546  EAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  605

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  606  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  665

Query  162  VEVFHLKQRLQSLENRAPTPRKPFHV  85
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  666  VEVFHLKQRLQSLENRAATPRKPFHV  691



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 172/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  523
            +K   E+  ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +   +YQ +
Sbjct  502  AKITAEKTLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSSSVYQFH  561

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            EAK+TAL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  562  EAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  621

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  622  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  681

Query  162  VEVFHLKQRLQSLENRAPTPRKPFHV  85
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  682  VEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 168/210 (80%), Gaps = 2/210 (1%)
 Frame = -1

Query  711  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG-L  535
            S L+  + K+I EE     E  N++  +  G+ + P+++DD  + E++CK G       +
Sbjct  488  SSLQATECKSIGEETALAFEDENLSP-RINGNDSLPVNNDDLAYAETNCKVGAPPSTSSI  546

Query  534  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  355
             Q Y+ K+ +L+RKNG+LEGQLAAALA++EA +KS SS LKSKQ+ +KKLAD MKE+++L
Sbjct  547  CQLYKTKIDSLIRKNGILEGQLAAALANQEATEKSFSSILKSKQEVDKKLADTMKEMEVL  606

Query  354  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  175
            KEKLA +E+ QEEANSL+NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR 
Sbjct  607  KEKLADLEVTQEEANSLNNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERART  666

Query  174  FQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            FQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  667  FQLQVEVFHLKQRLQSIENRAPTPRKPFHV  696



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 173/220 (79%), Gaps = 5/220 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDC  565
             VM++  + LD G++  D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  
Sbjct  496  HVMKQRAKALDMGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGD  553

Query  564  KFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKL  385
            K   S P  + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKL
Sbjct  554  K---SVPSNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKL  610

Query  384  ADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTR  205
            AD +KE+++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTR
Sbjct  611  ADTIKEVEILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTR  670

Query  204  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            G+L GERARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  671  GVLAGERARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  710



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKFGIS-APIGLYQSY  523
            +K   E+  ++  + +++   KQ S  FPL++ D   +FQE D  KFG S +   +YQ +
Sbjct  502  AKITEEKTLSMVSNHDISNLHKQCSETFPLENVDGALIFQEMDNIKFGGSMSSSSVYQFH  561

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  562  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  621

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  622  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  681

Query  162  VEVFHLKQRLQSLENRAPTPRKPFHV  85
            VEVFHLKQRLQSLENRA T RKPFHV
Sbjct  682  VEVFHLKQRLQSLENRAATHRKPFHV  707



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  523
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  162  VEVFHLKQRLQSLENRAPTPRKPFHV  85
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  523
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  162  VEVFHLKQRLQSLENRAPTPRKPFHV  85
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 4/206 (2%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSY  523
            +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++   +YQ +
Sbjct  503  AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSSSVYQFH  562

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL
Sbjct  563  EAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKL  622

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ
Sbjct  623  TGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQ  682

Query  162  VEVFHLKQRLQSLENRAPTPRKPFHV  85
            VEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  683  VEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score =   219 bits (557),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 174/223 (78%), Gaps = 6/223 (3%)
 Frame = -1

Query  744  QVMERGTRQLDSGLEHIDSKTI---PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQE  574
            + ME+ +++L++ +E +D   I    EE     ES N+   +K G+ +   DS+     E
Sbjct  496  KAMEQRSKKLETAVE-MDIAGILASTEENLFDSESSNLC--QKLGNNDLMADSNHIAPPE  552

Query  573  SDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  394
            +D   G+ A   +YQ YE K+  L RKN LLE QL AALA++EAA+K+LSSALKS+QD E
Sbjct  553  TDGISGLLANPYIYQLYETKIVTLTRKNVLLEEQLTAALANQEAAEKNLSSALKSRQDME  612

Query  393  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  214
            KKLADAMKE++LLKEKLAG+ELAQEEAN+LSN+ HSDNVRLEHDVAFLKAVLDDTQKELH
Sbjct  613  KKLADAMKEVELLKEKLAGMELAQEEANNLSNMSHSDNVRLEHDVAFLKAVLDDTQKELH  672

Query  213  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            STRG+L GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH+
Sbjct  673  STRGVLAGERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHI  715



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = -1

Query  630  KKQGSGNFPLDSDD--FVFQESD-CKF-GISAPIGLYQSYEAKLTALLRKNgllegqlaa  463
            +KQ S  FPL++ D   + QE D   F G ++   +YQ +EAK+TAL+R+NG+LEGQL A
Sbjct  524  QKQCSETFPLENVDGTLIIQEMDNINFAGSASSSSVYQFHEAKMTALIRRNGILEGQLEA  583

Query  462  alasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSD  283
            ALA REAA++++S AL+SKQ+T+KKL+DAM++++LLKEKL G+ELAQEEANSLSN+VHSD
Sbjct  584  ALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEEANSLSNMVHSD  643

Query  282  NVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  103
            NVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQSLENRA TP
Sbjct  644  NVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATP  703

Query  102  RKPFHV  85
            RKPFHV
Sbjct  704  RKPFHV  709



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score =   217 bits (553),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = -1

Query  627  KQGSGNFPLDSDDFVFQESDCKFGISAPIG-LYQSYEAKLTALLRKNgllegqlaaalas  451
            K+G G  P+D+ D +F E+  K   S+    +YQ YEAK+ AL+RKNG+LEGQLAAA AS
Sbjct  497  KEGVGYHPIDNTD-LFSENSGKIVTSSTFSSIYQFYEAKMAALIRKNGVLEGQLAAATAS  555

Query  450  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  271
            REA +K+LSSALK +Q+ EK++AD +KE+++L++KLAGVE+A+EEANSLSNIVHSDNVRL
Sbjct  556  REAVEKNLSSALKIRQEMEKRIADMIKEMEMLRDKLAGVEIAKEEANSLSNIVHSDNVRL  615

Query  270  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            EHDVAFLKAVLDDTQKELHSTRG+L GER+RAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  616  EHDVAFLKAVLDDTQKELHSTRGVLAGERSRAFQLQVEVFHLKQRLQSMENRAPTPRKPF  675

Query  90   HV  85
            H+
Sbjct  676  HM  677



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 150/189 (79%), Gaps = 7/189 (4%)
 Frame = -1

Query  651  SGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegq  472
            SG+ +  ++QG+    +          D K G+ A  G  Q YEAKL++L+RKNG+LEGQ
Sbjct  481  SGDESPSQEQGAKQLDIGGPKTSSNGGDYKAGLPASSGACQQYEAKLSSLMRKNGILEGQ  540

Query  471  laaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIV  292
            LA ALA REAA KS        QD EKK+ADA+KE++LLKEKLA VE+AQEEANSLSNIV
Sbjct  541  LATALAGREAAVKSK-------QDMEKKMADAVKEMELLKEKLASVEMAQEEANSLSNIV  593

Query  291  HSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRA  112
            HSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERARAFQLQVEVFHLKQRLQSLENR+
Sbjct  594  HSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERARAFQLQVEVFHLKQRLQSLENRS  653

Query  111  PTPRKPFHV  85
            PTPRKPFHV
Sbjct  654  PTPRKPFHV  662



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 169/213 (79%), Gaps = 5/213 (2%)
 Frame = -1

Query  723  RQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  544
            + LD G++  D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P
Sbjct  497  KALDMGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVP  551

Query  543  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  364
              + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+
Sbjct  552  SNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEV  611

Query  363  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  184
            ++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GER
Sbjct  612  EILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGER  671

Query  183  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            ARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  672  ARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  704



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 169/213 (79%), Gaps = 5/213 (2%)
 Frame = -1

Query  723  RQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  544
            + LD G++  D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P
Sbjct  498  KALDMGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVP  552

Query  543  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  364
              + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+
Sbjct  553  SNVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEV  612

Query  363  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  184
            ++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GER
Sbjct  613  EILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGER  672

Query  183  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            ARAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  673  ARAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  705



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score =   214 bits (546),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = -1

Query  627  KQGSG-NFPLDSDDFVFQESDCKFGISAPIG-LYQSYEAKLTALLRKNgllegqlaaala  454
            K+G G + P+D+ D +F ES  K   S+    +YQ YEAK+ AL+RKNG+LEGQLAAA A
Sbjct  497  KEGVGYHHPIDNTD-LFSESSGKIVTSSTFSSIYQFYEAKMAALIRKNGVLEGQLAAATA  555

Query  453  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  274
            SREA +K+LSSALK +Q+ EK++AD +KE+++L++KLAGVE+A+EEANSLSNIVHSDNVR
Sbjct  556  SREAVEKNLSSALKIRQEMEKRIADMIKEMEMLRDKLAGVEIAKEEANSLSNIVHSDNVR  615

Query  273  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            LEHDVAFLKAVLDDTQKELHSTRG+L GER+RAFQLQVEVFHLKQRLQS+ENRAPTPRKP
Sbjct  616  LEHDVAFLKAVLDDTQKELHSTRGVLAGERSRAFQLQVEVFHLKQRLQSMENRAPTPRKP  675

Query  93   FHV  85
            FH+
Sbjct  676  FHM  678



>ref|XP_010931596.1| PREDICTED: tip elongation aberrant protein 3 isoform X5 [Elaeis 
guineensis]
Length=629

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  684  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  508
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  432  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  488

Query  507  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  328
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  489  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  548

Query  327  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  148
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  549  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  608

Query  147  LKQRLQSLENRAPTPRKPFHV  85
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  609  LKQRLQSMENRAPTPRKPFHT  629



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  558  GISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLAD  379
             +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK AD
Sbjct  449  ALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFAD  508

Query  378  AMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGL  199
            AMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+
Sbjct  509  AMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGV  568

Query  198  LGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  569  LAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  606



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  600  DSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslss  421
            +++D + QE+D K  ++AP G+YQ  EAKL +L+RKNG+LEGQLAAALA+REAA+K+LS+
Sbjct  531  ETEDLILQENDGKSRMTAPPGVYQVSEAKLASLMRKNGILEGQLAAALAAREAAEKNLSA  590

Query  420  alksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  241
            A++S+ + EKKL +AMKE+++L+EK+  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAV
Sbjct  591  AIRSRLEMEKKLGEAMKEMEMLREKVTSVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  650

Query  240  LDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            LDDTQKELHSTRG+L GE  RAFQLQVEVFHLKQRLQSLE RAPTPRKP+HV
Sbjct  651  LDDTQKELHSTRGVLAGEHGRAFQLQVEVFHLKQRLQSLEPRAPTPRKPYHV  702



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -1

Query  687  KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLT  508
            K I EE   + +S N +  + QG  N  ++++D +  E D   G  A   +YQ YE K+ 
Sbjct  515  KIIAEETSCVFDSEN-SHSQNQGVENHLVENEDALVSEPDGMTG-GAHSSIYQLYETKIA  572

Query  507  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  328
            +L+RKNG+LEGQLAAALASREAA+K+LSS LKS+Q+ E+KL D ++E++LLKEKLAGVEL
Sbjct  573  SLIRKNGVLEGQLAAALASREAAEKNLSSVLKSRQEIERKLTDTLREMELLKEKLAGVEL  632

Query  327  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  148
            AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFH
Sbjct  633  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLTGERARAFQLQVEVFH  692

Query  147  LKQRLQSLENRAPTPRKPFHV  85
            LKQRLQS+ENR PTPRKPF+V
Sbjct  693  LKQRLQSMENRVPTPRKPFNV  713



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   213 bits (541),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  684  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  508
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  536  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  592

Query  507  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  328
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  593  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  652

Query  327  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  148
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  653  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  712

Query  147  LKQRLQSLENRAPTPRKPFHV  85
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  713  LKQRLQSMENRAPTPRKPFHT  733



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score =   213 bits (541),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  684  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  508
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  530  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  586

Query  507  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  328
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  587  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  646

Query  327  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  148
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  647  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  706

Query  147  LKQRLQSLENRAPTPRKPFHV  85
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  707  LKQRLQSMENRAPTPRKPFHT  727



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   213 bits (541),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  684  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  508
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  533  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  589

Query  507  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  328
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  590  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  649

Query  327  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  148
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  650  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  709

Query  147  LKQRLQSLENRAPTPRKPFHV  85
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  710  LKQRLQSMENRAPTPRKPFHT  730



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score =   213 bits (541),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  684  TIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-PIGLYQSYEAKLT  508
            +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P  + Q YE K+ 
Sbjct  520  SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQPSNICQLYETKIY  576

Query  507  ALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVEL  328
             L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE++LLKEKLAG+EL
Sbjct  577  TLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEVELLKEKLAGMEL  636

Query  327  AQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFH  148
            AQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVE FH
Sbjct  637  AQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEAFH  696

Query  147  LKQRLQSLENRAPTPRKPFHV  85
            LKQRLQS+ENRAPTPRKPFH 
Sbjct  697  LKQRLQSMENRAPTPRKPFHT  717



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score =   212 bits (540),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 6/207 (3%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISA---PIGLYQS  526
            +K   E+  +      M+  +KQ S  FP     D  +F   D K  ++A      +YQ 
Sbjct  496  AKITAEKTLSTVSDREMSNLQKQCSETFPFAHIDDALIFPGMD-KTNLAANASSSSVYQF  554

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL DAM++++LLKEK
Sbjct  555  HEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLCDAMRDVELLKEK  614

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            L G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQL
Sbjct  615  LTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQL  674

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFHV  85
            QVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  675  QVEVFHLKQRLQSLENRAATPRKPFHV  701



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 7/162 (4%)
 Frame = -1

Query  570  DCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEK  391
            D K G+ A  G  Q +EAKL++L+RKNG+LEGQLAAALA REAA +S        QD EK
Sbjct  507  DYKAGLPASSGACQQHEAKLSSLMRKNGILEGQLAAALAGREAAVRSK-------QDMEK  559

Query  390  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  211
            K++DA+KE++LLKEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHS
Sbjct  560  KMSDAVKEMELLKEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHS  619

Query  210  TRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            TRG+L GERARAFQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  620  TRGVLAGERARAFQLQVEVFHLKQRLQSLENRSPTPRKPFHV  661



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = -1

Query  627  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  454
            KQ S +FP     D  +F E D    +++   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  492  KQTSESFPFAHIDDALIFPEMDNAATLASSSSVYQFHEAKMTALIRRNGILEGQLEAALA  551

Query  453  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  274
             REAA++++S AL+SKQ+++KKL+DA+++++LLKEKL G+ELAQ+EANSLSN+VHSDNVR
Sbjct  552  GREAAERNVSVALRSKQESDKKLSDALRDVELLKEKLTGLELAQDEANSLSNMVHSDNVR  611

Query  273  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  612  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  671

Query  93   FHV  85
            FHV
Sbjct  672  FHV  674



>ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=610

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  630  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  451
            K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL AA+AS
Sbjct  429  KNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLLAAIAS  488

Query  450  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  271
            +EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHSDNVRL
Sbjct  489  KEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHSDNVRL  548

Query  270  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            EHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  549  EHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  608

Query  90   HV  85
            HV
Sbjct  609  HV  610



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = -1

Query  627  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  454
            KQ S  FP     D  +F E D      +   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  518  KQSSEPFPFAHIDDALIFPEMDNATLAPSSSSVYQFHEAKMTALIRRNGVLEGQLEAALA  577

Query  453  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  274
             REAA++++S AL+SKQ+T+KKL+DA+++++LLKEKL G+EL+Q+EANSLSN+VHSDNVR
Sbjct  578  GREAAERNVSVALRSKQETDKKLSDALRDVELLKEKLTGLELSQDEANSLSNMVHSDNVR  637

Query  273  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  638  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  697

Query  93   FHV  85
            FHV
Sbjct  698  FHV  700



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -1

Query  573  SDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  394
            SDC  G  A   +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSALKS+Q+ E
Sbjct  501  SDCTTG-GARASIYRLYETKIAALTRKNRVLEGQLAAAFIGREAAEKNVSSALKSRQEME  559

Query  393  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH  214
            KKL D ++E++LLKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELH
Sbjct  560  KKLVDTVREMELLKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELH  619

Query  213  STRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            STRG+L GERARAFQLQ+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  620  STRGVLSGERARAFQLQIEVFHLKQRLQSMENRTPTPRKPFHV  662



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = -1

Query  627  KQGSGNFPLD--SDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaala  454
            K  S +FP     D  +F E D      +   +YQ +EAK+TAL+R+NG+LEGQL AALA
Sbjct  518  KPPSESFPFAHIDDALIFPEMDNATLAPSSSSVYQFHEAKMTALIRRNGVLEGQLEAALA  577

Query  453  sreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVR  274
             REAA++++S AL+SKQ+T+KKL+DA++++DLLKEKL G+EL+Q+EANSLSN+VHSDNVR
Sbjct  578  GREAAERNVSVALRSKQETDKKLSDALRDVDLLKEKLTGLELSQDEANSLSNMVHSDNVR  637

Query  273  LEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            LEHDVAFL+AVLDDTQKEL STRG+L GERARAFQLQVEVFHLKQRLQSLENRA TPRKP
Sbjct  638  LEHDVAFLRAVLDDTQKELQSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATPRKP  697

Query  93   FHV  85
            FHV
Sbjct  698  FHV  700



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score =   207 bits (526),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  630  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  451
            K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL AA+AS
Sbjct  528  KNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLLAAIAS  587

Query  450  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  271
            +EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHSDNVRL
Sbjct  588  KEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHSDNVRL  647

Query  270  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            EHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  648  EHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  707

Query  90   HV  85
            HV
Sbjct  708  HV  709



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score =   207 bits (526),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  546  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  604

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  605  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  664

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  665  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  718



>gb|KEH32273.1| acyl-CoA-binding domain protein [Medicago truncatula]
Length=718

 Score =   207 bits (526),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  545  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  603

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  604  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  663

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  664  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  717



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  570  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  628

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  629  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  688

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  689  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  742



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  576  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  397
            E+D +  ++ P  +YQ YE K+ +L RKN LLE QL AAL  REAA+K+LSSA+KSKQ+ 
Sbjct  542  ETDGRSVLTNPSNIYQLYETKIASLTRKNVLLEEQLKAALTCREAAEKNLSSAVKSKQEV  601

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            E KLAD +KE++LLKEKLAGVELAQEEANSLSNIVHS NVRLEHDVAFLKA+LDDTQKEL
Sbjct  602  ETKLADTVKEVELLKEKLAGVELAQEEANSLSNIVHSHNVRLEHDVAFLKAILDDTQKEL  661

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV*SSIL  70
            +STRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  + + +L
Sbjct  662  YSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPIQICNDVL  710



>gb|KHN47303.1| hypothetical protein glysoja_020171 [Glycine soja]
Length=261

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  511
            +KT  EE   +  S N    +  G GN  L+SDD  F ++     +S    ++  YE K+
Sbjct  63   AKTNMEEQVLVSGSSN---QQNLGFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKV  119

Query  510  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  331
             +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   E
Sbjct  120  ASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAE  179

Query  330  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  151
            LAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVF
Sbjct  180  LAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVF  239

Query  150  HLKQRLQSLENRAPTPRKPFHV  85
            HLKQRLQS+ENR PTPRKPF V
Sbjct  240  HLKQRLQSMENRVPTPRKPFQV  261



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 168/222 (76%), Gaps = 5/222 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES  571
            Q  +  T Q D G  +    +KT  EE  ++  SGN +  +  G GN  L+SDD  F E+
Sbjct  492  QAGDHRTSQNDPGNQMRSSGAKTNMEEQVSV--SGN-SNQQNLGFGNPFLESDDVSFPEN  548

Query  570  DCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEK  391
                 +SA   ++  YE K+ +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+  K
Sbjct  549  SKSGSLSAASSIHHYYETKVASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMGK  608

Query  390  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  211
            KLAD +KE++LL EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHS
Sbjct  609  KLADTLKEMELLSEKLVSAELAQEEANNLSNLVHADNVRLEHDVAFLKAVLDDTQKELHS  668

Query  210  TRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            TRG+L  ER RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  669  TRGVLAAERTRAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  710



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  630  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  451
            K  G GN  ++SD     E+     +S    +Y  YE K+++L+ K G+LE QLAA+LAS
Sbjct  517  KNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSSLITKFGILEAQLAASLAS  576

Query  450  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  271
            +EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELAQEEAN+LSNIVHSDNVRL
Sbjct  577  KEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELAQEEANNLSNIVHSDNVRL  636

Query  270  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  637  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  696

Query  90   HV  85
            HV
Sbjct  697  HV  698



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 157/202 (78%), Gaps = 3/202 (1%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  511
            +KT  EE  ++  S N    K  G GN  L+SDD  F E+     +SA   ++  YE K+
Sbjct  517  AKTNMEEQVSVSRSSN---QKNLGFGNPVLESDDVSFPENSKSGSLSAASDIHHYYETKV  573

Query  510  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  331
             +L+RK G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   E
Sbjct  574  ASLMRKFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEMELLREKLVSAE  633

Query  330  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  151
            L QEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RAFQLQVEVF
Sbjct  634  LVQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRAFQLQVEVF  693

Query  150  HLKQRLQSLENRAPTPRKPFHV  85
            HLKQRLQS+E RAPTPRKPF V
Sbjct  694  HLKQRLQSMEKRAPTPRKPFQV  715



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  630  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  451
            K  G GN  ++SD     E+     +S    +Y  YE K+++L+ K G+LE QLAA+LAS
Sbjct  582  KNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSSLITKFGILEAQLAASLAS  641

Query  450  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  271
            +EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELAQEEAN+LSNIVHSDNVRL
Sbjct  642  KEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELAQEEANNLSNIVHSDNVRL  701

Query  270  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  91
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  702  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  761

Query  90   HV  85
            HV
Sbjct  762  HV  763



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 157/202 (78%), Gaps = 3/202 (1%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  511
            +KT  EE  ++  S N    K  G GN  L+SDD  F E+     +SA   ++  YE K+
Sbjct  513  AKTNMEEQVSVSRSSN---QKNLGFGNPVLESDDVSFPENSKSGSLSAASDIHHYYETKV  569

Query  510  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  331
             +L+RK G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   E
Sbjct  570  ASLMRKFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEMELLREKLVSAE  629

Query  330  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  151
            L QEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RAFQLQVEVF
Sbjct  630  LVQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRAFQLQVEVF  689

Query  150  HLKQRLQSLENRAPTPRKPFHV  85
            HLKQRLQS+E RAPTPRKPF V
Sbjct  690  HLKQRLQSMEKRAPTPRKPFQV  711



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 169/208 (81%), Gaps = 2/208 (1%)
 Frame = -1

Query  705  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGI-SAPIGLYQ  529
            L     + I E+I ++ ESGN +      S  FPLD++  +F ES+ K G+ SAP  +YQ
Sbjct  502  LAETSGRFIMEDIPSLSESGNFSV-PSCVSEKFPLDNEAIIFPESEDKCGVFSAPSSIYQ  560

Query  528  SYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKE  349
             YE ++ AL+RKNG+LEGQLAAALASREAA+K++SS LKS+Q+TEKKL D  KE++LLKE
Sbjct  561  LYETRMAALIRKNGMLEGQLAAALASREAAEKNVSSVLKSRQETEKKLVDTGKELELLKE  620

Query  348  KLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQ  169
            KL G+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ERARAFQ
Sbjct  621  KLGGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGMLANERARAFQ  680

Query  168  LQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            LQVEVFHLKQRLQSLENR  TPRKPF V
Sbjct  681  LQVEVFHLKQRLQSLENRTATPRKPFQV  708



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 145/193 (75%), Gaps = 3/193 (2%)
 Frame = -1

Query  654  ESGNMATHKKQGSGNFPLDSDD---FVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgl  484
            ESG    H K G G   L +D    F          ++ P  +YQ YE K  +L RKN L
Sbjct  541  ESGGTTVHHKHGIGISSLTADAEHLFPLGVDGGGLVLTNPTDVYQVYETKTASLTRKNVL  600

Query  483  legqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSL  304
            LE QL AA  SRE A+++LS  ++ KQD E+KLADA++E++LLK+K+AG+E+AQEEAN L
Sbjct  601  LEEQLKAATTSREIAERNLSCTVERKQDRERKLADALREVELLKDKVAGMEVAQEEANGL  660

Query  303  SNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSL  124
            SNI HSDNVRLEHDVAFLKA+L+DTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS 
Sbjct  661  SNIGHSDNVRLEHDVAFLKAILEDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSG  720

Query  123  ENRAPTPRKPFHV  85
            ++RAPTPRKPF +
Sbjct  721  DHRAPTPRKPFQM  733



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 152/173 (88%), Gaps = 2/173 (1%)
 Frame = -1

Query  600  DSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslss  421
            +SD+  F E++    +S+   +Y  YE+K+ +L+RKNG+LEGQLAA+LAS+EAA+KSL+S
Sbjct  537  ESDNLSFSENNKSASLSSS-NVYHYYESKVASLIRKNGILEGQLAASLASKEAAEKSLTS  595

Query  420  alksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAV  241
             LKS+Q+ E+KLADA KE++L++EKLA +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAV
Sbjct  596  VLKSRQEMERKLADAHKEMELMREKLASLELAQEEANNLSNIVHSDNVRLEHDVAFLKAV  655

Query  240  LDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  85
            LDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  656  LDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  708



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+SD+  F E + K G      +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+
Sbjct  535  LESDNVSFTE-NIKSGSLTTSNVYHCYESKLASLIRKNGILEGQLAASLASKEAAEKSLA  593

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S LKS+Q+ E+KLA++ KE++L++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  594  SVLKSRQEMERKLAESHKEMELMREKLTSLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  653

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  85
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  654  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  707



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score =   196 bits (497),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+SD+  F E + K G      +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+
Sbjct  563  LESDNVSFTE-NIKSGSLTTSNVYHCYESKLASLIRKNGILEGQLAASLASKEAAEKSLA  621

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S LKS+Q+ E+KLA++ KE++L++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  622  SVLKSRQEMERKLAESHKEMELMREKLTSLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  681

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAP-TPRKPFHV  85
            VLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  682  VLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  735



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = -1

Query  690  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  511
            +KT  EE   +  S N    +  G GN  L+SDD  F ++     +S    ++  YE K+
Sbjct  512  AKTNMEEQVLVSGSSN---QQNLGFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKV  568

Query  510  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  331
             +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   E
Sbjct  569  ASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAE  628

Query  330  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  151
            LAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVF
Sbjct  629  LAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVF  688

Query  150  HLKQRLQSLENRAPTPRKPFHV  85
            HLKQRLQS+ENR PTPRKPF V
Sbjct  689  HLKQRLQSMENRVPTPRKPFQV  710



>gb|EPS74438.1| hypothetical protein M569_00314, partial [Genlisea aurea]
Length=449

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 142/182 (78%), Gaps = 18/182 (10%)
 Frame = -1

Query  609  FPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  430
            FP +SDD + Q              +  YE K+ AL++K G+LEGQLAAA A+REAA+K+
Sbjct  278  FPSESDDVLLQTRRS----------HHVYEEKIAALMKKTGILEGQLAAATAAREAAEKN  327

Query  429  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  250
             +SA +S+Q+ EKKL D +KEIDLLKEKL+ VE++QEEAN+LSNIVHSDNVRLEHDVAFL
Sbjct  328  SASATRSRQEMEKKLVDTLKEIDLLKEKLSSVEISQEEANNLSNIVHSDNVRLEHDVAFL  387

Query  249  KAVLDDTQK--------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            KAVLDDTQK        ELHSTRG+L GERARAFQLQVEVFHLKQRLQSLE RAPTPRK 
Sbjct  388  KAVLDDTQKASWKQKRLELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLETRAPTPRKQ  447

Query  93   FH  88
            FH
Sbjct  448  FH  449



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -1

Query  621  GSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasrea  442
            G GN  L+SDD  F ++     +S    ++  YE K+ +L+RK G+LEGQL+AALASREA
Sbjct  521  GFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKVASLMRKFGILEGQLSAALASREA  580

Query  441  adkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHD  262
            A+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   ELAQEEAN+LSN+VH+DNVRLEHD
Sbjct  581  AEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAELAQEEANNLSNMVHADNVRLEHD  640

Query  261  VAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            VAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  641  VAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  699



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 150/177 (85%), Gaps = 5/177 (3%)
 Frame = -1

Query  600  DSDDFVFQES---DCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadks  430
            +SD+ +F E+   +   G      +Y  YE+KL +L+RKNG+LEGQLAA++AS+EAA+KS
Sbjct  538  ESDNLLFSENINININSGSLTTSNVYYYYESKLASLIRKNGILEGQLAASIASKEAAEKS  597

Query  429  lssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFL  250
            L+S LKS+Q+ ++KL ++ KE++L++EKLAG+ELAQEE N+LSNIVHSDNVRLEHDVAFL
Sbjct  598  LTSVLKSRQEMDRKLTESEKEMELMREKLAGLELAQEETNNLSNIVHSDNVRLEHDVAFL  657

Query  249  KAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLE-NRAP-TPRKPFHV  85
            KAVLDDTQKELHSTRG++ GERARAFQLQ EVFHLKQRLQS+E NRA  TPRKPFHV
Sbjct  658  KAVLDDTQKELHSTRGVIAGERARAFQLQYEVFHLKQRLQSMEKNRASTTPRKPFHV  714



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 146/174 (84%), Gaps = 10/174 (6%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  546  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  604

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  605  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  664

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            VLDDTQKELHSTRG++ GERARAFQL        QRLQS+ENR + TPRKPFHV
Sbjct  665  VLDDTQKELHSTRGVIAGERARAFQL--------QRLQSMENRTSTTPRKPFHV  710



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 146/174 (84%), Gaps = 10/174 (6%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+S+   F E+D K G  +   +YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LS
Sbjct  570  LESEVVSFPEND-KSGSLSSTNIYQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLS  628

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S  KS+Q+ EKKLADA+KE++LL+EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKA
Sbjct  629  SVHKSRQEMEKKLADALKEMELLREKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKA  688

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENR-APTPRKPFHV  85
            VLDDTQKELHSTRG++ GERARAFQL        QRLQS+ENR + TPRKPFHV
Sbjct  689  VLDDTQKELHSTRGVIAGERARAFQL--------QRLQSMENRTSTTPRKPFHV  734



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  544  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  602

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  603  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  662

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  663  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  715



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  518  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  576

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  577  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  636

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  637  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  689



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  610  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  668

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  669  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  728

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  729  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  781



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  603  LDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadksls  424
            L+SD  +F E + K G      +Y  YE+++TAL +KN +LE QL A+LAS + A K+L 
Sbjct  604  LESDSELFPE-NSKAGSFFNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLE  662

Query  423  salksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA  244
            S L+S+Q+ E+KL+D +KE+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKA
Sbjct  663  SILRSRQEIEEKLSDTLKEMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKA  722

Query  243  VLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
            VLDDTQKELHSTRG++  ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  723  VLDDTQKELHSTRGVVARERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  775



>ref|XP_006855461.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
 gb|ERN16928.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
Length=692

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  555  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  376
            + AP   +Q YE K+ AL +KNG+LEGQL+AALA REA  K+LS+ LKS+QD EKKL+++
Sbjct  536  VIAPANSHQEYEIKVAALQKKNGVLEGQLSAALAGREAIAKNLSAVLKSRQDIEKKLSES  595

Query  375  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  196
            +KE+++L EKLA  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL STRG+L
Sbjct  596  LKEMEVLSEKLAAAELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELQSTRGVL  655

Query  195  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  85
             GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKP+H+
Sbjct  656  AGERARAFQLQVEVFHLKQRLQSVENRAPTPRKPYHI  692



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -1

Query  675  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  496
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  495  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  316
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  315  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  160
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQL  694



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -1

Query  675  EEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLR  496
            EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   +Y+ YE K+ AL R
Sbjct  525  EEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHASIYRLYETKIAALTR  582

Query  495  KNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEE  316
            KN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++LLKEKLA VELAQEE
Sbjct  583  KNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMELLKEKLACVELAQEE  642

Query  315  ANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQV  160
            ANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQ+
Sbjct  643  ANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQLQL  694



>ref|NP_001068393.1| Os11g0657000 [Oryza sativa Japonica Group]
 dbj|BAF28756.1| Os11g0657000, partial [Oryza sativa Japonica Group]
Length=530

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  384  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  443

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  444  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  503

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  504  QVEVFHLKQRLQTMEGRSPTPRKP  527



>gb|EEC68565.1| hypothetical protein OsI_36893 [Oryza sativa Indica Group]
Length=685

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>gb|EEE52499.1| hypothetical protein OsJ_34700 [Oryza sativa Japonica Group]
Length=685

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  658

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>ref|XP_006663088.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Oryza brachyantha]
Length=684

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  538  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  597

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  598  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  657

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFHV  85
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  658  QLEVFHLKQRLQTMEGRSPTPRKPLNL  684



>ref|XP_006663087.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Oryza brachyantha]
Length=690

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  544  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  603

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  604  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  663

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFHV  85
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  664  QLEVFHLKQRLQTMEGRSPTPRKPLNL  690



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            ++ ++T L+R+N  LE QL+AAL +++ A+K+LS  + SK + EK+LA+  +E++ LKEK
Sbjct  539  HDTRITTLVRRNMALEEQLSAALTTKDEAEKNLSLVIDSKDELEKRLAERDREVEALKEK  598

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQR+Q++E R+PTPRKP
Sbjct  659  QVEVFHLKQRVQTMEGRSPTPRKP  682



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  536  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  595

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  596  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  655

Query  267  HDVAFLKAVLDDTQKELHSTRGLL  196
            HDVAFLKAVLDDTQKELHSTRG+L
Sbjct  656  HDVAFLKAVLDDTQKELHSTRGVL  679



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK
Sbjct  539  YDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEK  598

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRL +++ R+PTPRKP
Sbjct  659  QVEVFHLKQRLPTMDGRSPTPRKP  682



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++ LKEK
Sbjct  536  YDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVEALKEK  595

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            + G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  596  VTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  655

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRL +++ R+PTPRKP
Sbjct  656  QVEVFHLKQRLPTMDGRSPTPRKP  679



>ref|XP_008677101.1| PREDICTED: uncharacterized protein LOC100279529 isoform X1 [Zea 
mays]
Length=695

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -1

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  162  VEVFHLKQRLQSLENRAP-TPRKP  94
            VEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VEVFHLKQRLQTMEGRSPAAPRKP  692



>ref|XP_003575710.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237192.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237193.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
Length=693

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y +K+T L+R+N  LE QLAAALAS++ A+K+LS  + S++  EK+LA+  KE +LLKEK
Sbjct  547  YNSKITDLIRRNAALEDQLAAALASKDQAEKNLSLVINSREQLEKRLANKGKEAELLKEK  606

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            ++G+ELAQEE+N++SN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  607  ISGLELAQEESNNISNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  666

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ +E RA TPRKP
Sbjct  667  QVEVFHLKQRLQLVEGRAGTPRKP  690



>ref|XP_006664610.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Oryza brachyantha]
Length=698

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y AK+T L++++  LE QLA ALAS++ A+K+LS  + S++  E++LA+  KE ++LKEK
Sbjct  554  YNAKITDLIKRSSALEDQLATALASKDQAEKNLSLVINSREQLERRLANKDKEAEVLKEK  613

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  614  IAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  673

Query  165  QVEVFHLKQRLQSLENRAPTPRKPF  91
            QVEVFHLKQRLQ +E RA TP+ P 
Sbjct  674  QVEVFHLKQRLQMVEGRAGTPKNPL  698



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 129/177 (73%), Gaps = 4/177 (2%)
 Frame = -1

Query  744  QVMERGTRQLDSGL--EHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES  571
            Q  E    Q DSG     +  K   E++  + E  N+  H  QGS N P+DS D VF  +
Sbjct  493  QAAEHKISQSDSGTRTSTVGGKLCTEDMVAVYEPENLNPHN-QGSANLPVDSSDSVFPVN  551

Query  570  DCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTE  394
            D K G + AP  + Q YE K+T L+RKN +LEGQLAAA ASREA +K+LSSALKSKQ+ E
Sbjct  552  DIKLGSVPAPSSVSQFYETKITQLIRKNAILEGQLAAAFASREAVEKNLSSALKSKQEME  611

Query  393  KKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  223
            KKLA+ MK ++LLKEKLAGVELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  612  KKLAEMMKGMELLKEKLAGVELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQK  668



>gb|KDO75103.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=342

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasre  445
            QG GNF +D+D+ +F ++D    +S P  +YQ YE+K+ AL+RKNG+LEGQLAAAL +RE
Sbjct  186  QGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNRE  245

Query  444  aadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEH  265
            AA+K+ SS LKS+Q+ EKKLAD++KE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEH
Sbjct  246  AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH  305

Query  264  DVAFLKAVLDDTQK  223
            DVAFLKAVLDDTQK
Sbjct  306  DVAFLKAVLDDTQK  319



>dbj|BAJ86800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLRAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>dbj|BAK00700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLGAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>ref|XP_002442260.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
 gb|EES16098.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
Length=620

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+  L+R+N  LE QL+ ALAS++  +KSLSS + S++  EK LA+  KE ++LKEK
Sbjct  475  YNTKIADLIRRNTTLEDQLSTALASKDQLEKSLSSVIHSREQLEKMLANKDKEAEMLKEK  534

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++RAFQL
Sbjct  535  IACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLAGEQSRAFQL  594

Query  165  QVEVFHLKQRLQSLENRAPTPRK  97
            QVEVFHLKQRLQ LE R+ TP K
Sbjct  595  QVEVFHLKQRLQILEGRSGTPTK  617



>ref|NP_001066944.1| Os12g0538800 [Oryza sativa Japonica Group]
 gb|ABA99338.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29963.1| Os12g0538800 [Oryza sativa Japonica Group]
Length=698

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>gb|EEC69433.1| hypothetical protein OsI_38606 [Oryza sativa Indica Group]
Length=698

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  396  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  217
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  216  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = -1

Query  624  QGSGNFPLDSDDFVFQESDCK-FGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasr  448
            +G  N P+D+D+FVF E+D K   +SAP  +YQ YE ++ AL RKNG+LE QLAAALASR
Sbjct  541  EGIANVPVDNDNFVFPEADGKSAALSAPSSIYQFYETRMAALSRKNGILEVQLAAALASR  600

Query  447  eaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLE  268
            + ++++L+SALKSK++ EK+ AD MKE++LLKEKLAG+ELAQEEANSLSNIVHSDNVRLE
Sbjct  601  DTSERNLASALKSKEEMEKRFADTMKEMELLKEKLAGIELAQEEANSLSNIVHSDNVRLE  660

Query  267  HDVAFLKAVLDDTQKEL  217
            HDVAFLKAVLDDTQK L
Sbjct  661  HDVAFLKAVLDDTQKVL  677



>gb|AFW60227.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_572222 [Zea 
mays]
Length=716

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 122/165 (74%), Gaps = 22/165 (13%)
 Frame = -1

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL-  166
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL 
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  165  --------------------QVEVFHLKQRLQSLENRAP-TPRKP  94
                                QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VRPYHARLSFFFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  713



>ref|XP_004962837.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X5 [Setaria italica]
Length=688

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  541  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  600

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  601  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  660

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFH  88
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  661  QVEVFHLKQRLQILEGRSGTPTKQPH  686



>dbj|BAK00043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  405  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  226
            ++ EKKLA+  +E+  LKEK+ G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQ
Sbjct  173  EELEKKLAERDREVVALKEKVGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQ  232

Query  225  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            KELH TRG+L GERARAFQLQVEVFHLKQRLQS++  +   RKP
Sbjct  233  KELHLTRGVLAGERARAFQLQVEVFHLKQRLQSMDGLSSAQRKP  276



>ref|XP_004962833.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Setaria italica]
 ref|XP_004962834.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Setaria italica]
 ref|XP_004962835.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X3 [Setaria italica]
 ref|XP_004962836.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X4 [Setaria italica]
Length=695

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  548  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  607

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  608  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  667

Query  165  QVEVFHLKQRLQSLENRAPTPRKPFH  88
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  668  QVEVFHLKQRLQILEGRSGTPTKQPH  693



>ref|NP_001145999.1| uncharacterized protein LOC100279529 [Zea mays]
 gb|ACL53010.1| unknown [Zea mays]
Length=717

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 122/166 (73%), Gaps = 23/166 (14%)
 Frame = -1

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL-  166
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL 
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  165  ---------------------QVEVFHLKQRLQSLENRAP-TPRKP  94
                                 QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  669  VRPYHARLSFFLFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  714



>ref|NP_001146281.1| uncharacterized protein LOC100279856 [Zea mays]
 gb|ACL53624.1| unknown [Zea mays]
 gb|ACN34064.1| unknown [Zea mays]
 gb|AFW56517.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=690

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -1

Query  555  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  376
             S+ +G    Y  K+  L+R+N  LE QLA ALAS++  DKSL+S + S+   EK LA+ 
Sbjct  535  CSSDVGQSHLYNTKIADLIRRNTTLEDQLATALASKDQLDKSLASVIHSRGQLEKMLANK  594

Query  375  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  196
             KE ++LKEK+A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV  +TQKELHSTR +L
Sbjct  595  DKEAEMLKEKIACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTGETQKELHSTRRVL  654

Query  195  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRK  97
             GE++RAFQLQVEVFHLKQRLQ LE R+ TP K
Sbjct  655  AGEQSRAFQLQVEVFHLKQRLQILEGRSGTPNK  687



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  654  ESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNglleg  475
            +S N   ++KQG+ N   DS+     E D +  ++ P  LYQ YE K+  L RKN LLE 
Sbjct  543  DSENSNLYQKQGNNNLVSDSNHVAPPEIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEE  602

Query  474  qlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNI  295
            QL  AL S+EAA+K+LSSA KS+Q+TEKKLADA+KE++LLKEKLAGVELAQEEANSLSN+
Sbjct  603  QLNVALGSQEAAEKNLSSATKSRQETEKKLADAIKEVELLKEKLAGVELAQEEANSLSNM  662

Query  294  VHSDNVRLEHDVAFLKAVLDDTQKEL  217
            VHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  663  VHSDNVRLEHDVAFLKAVLDDTQKSL  688



>gb|EMT26901.1| hypothetical protein F775_29769 [Aegilops tauschii]
Length=612

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 120/171 (70%), Gaps = 27/171 (16%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            ++ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + +K++ E++LA+  +E+  LKEK
Sbjct  439  HDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDTKEELERRLAERDREVVALKEK  498

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK-------------------  223
            + G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQK                   
Sbjct  499  VGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQKAKNNNIPVISNCTSVYAVV  558

Query  222  --------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
                    ELHSTRG+L GERARAFQLQVEVFHLKQRLQS++ R+PT RKP
Sbjct  559  LTILPPKQELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRSPTQRKP  609



>gb|AFW60226.1| hypothetical protein ZEAMMB73_572222 [Zea mays]
Length=695

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+EK 
Sbjct  549  DARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALREKA  608

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQ  163
             G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQLQ
Sbjct  609  TGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQLQ  668

Query  162  VEVFHLK  142
            V  +H +
Sbjct  669  VRPYHAR  675



>ref|XP_002975032.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
 gb|EFJ23817.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  405  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  226
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  225  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  127
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>ref|XP_002977452.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
 gb|EFJ21456.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  405  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  226
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  225  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  127
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>gb|EMS52652.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=1002

 Score =   123 bits (308),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 112/167 (67%), Gaps = 27/167 (16%)
 Frame = -1

Query  531  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  352
              ++ K+  L+R+N  LE +L+AA+AS++ A+K+LS  + +K++ EK+LA+  +E+  LK
Sbjct  672  HQHDTKIANLVRRNMALEEKLSAAMASKDEAEKNLSLVIDTKEELEKRLAERDREVVALK  731

Query  351  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK-----------------  223
            EK+ G+E A E+ N+ SN VH+DNVRLE +VAFLKAV+D+TQK                 
Sbjct  732  EKVGGLEQAHEDLNNASNTVHADNVRLEREVAFLKAVMDETQKAKKIKIPVISHCTSVYA  791

Query  222  ----------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRA  112
                      E +STRG+L GERARAFQLQVEVFHLKQRLQS++ R 
Sbjct  792  VALTILPPKQEFYSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRG  838



>gb|EMT25879.1| hypothetical protein F775_10881 [Aegilops tauschii]
Length=758

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+T L+R+N  LE QLAAAL S+E A+K+LS  + S++  EK+LA   KE +LLKEK
Sbjct  631  YNTKITDLIRRNAALEDQLAAALESKEQAEKNLSLVMSSREQLEKRLASRGKEAELLKEK  690

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  691  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  731

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  732  QVEVFHLKQRLQTAEGRSGTPRKP  755



>gb|EMS62709.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=641

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 19/144 (13%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y  K+T L+R+N  LE QLAAALAS+E A+K+LS  + S++  EK+LA   K+ +LLKEK
Sbjct  514  YNNKITDLIRRNAALEDQLAAALASKEQAEKNLSLVMSSREQLEKRLASRGKDAELLKEK  573

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  166
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  574  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  614

Query  165  QVEVFHLKQRLQSLENRAPTPRKP  94
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  615  QVEVFHLKQRLQTAEGRSVTPRKP  638



>ref|XP_001759823.1| predicted protein [Physcomitrella patens]
 gb|EDQ75327.1| predicted protein [Physcomitrella patens]
Length=1020

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -1

Query  531  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  352
            QS+E KL A +R+    EGQL   L  +E A+  L+SAL+++Q TE KLA A+ +   +K
Sbjct  863  QSFEIKLAAAVRRGEQAEGQLTTVLRGKEEAENRLASALQTRQQTESKLAVALTKQAEIK  922

Query  351  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  172
            E +AG E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ERA++ 
Sbjct  923  EAVAGAERAQEDSNNLCNLVHSENLRLEHDLAFLKAVLEDTQKELDSTREALATERAKSS  982

Query  171  QLQVEVFHLKQRL  133
            QLQ+EVF+L +RL
Sbjct  983  QLQMEVFNLNKRL  995



>ref|XP_001760924.1| predicted protein [Physcomitrella patens]
 gb|EDQ74313.1| predicted protein, partial [Physcomitrella patens]
Length=617

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -1

Query  531  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  352
            QS+E KL A +R+  L EGQL+ AL  +E A+KSL  ALK++Q  E KLA ++K    LK
Sbjct  481  QSFEMKLAAAVRRGELAEGQLSTALKGKEEAEKSLQLALKTRQHAEGKLAASLKGQMDLK  540

Query  351  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  172
            E++A  E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQ EL STR LL  ER R+F
Sbjct  541  ERVAAAERAQEDSNNLCNVVHSENLRLEHDLAFLKAVLEDTQMELQSTRELLATERTRSF  600

Query  171  QLQVEVFHLKQRLQSL  124
             LQV V HL   L +L
Sbjct  601  NLQVTVDHLPPLLHAL  616



>ref|XP_001751751.1| predicted protein [Physcomitrella patens]
 gb|EDQ83186.1| predicted protein [Physcomitrella patens]
Length=1071

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  531   QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  352
             QS+E KL A +R+    EGQ+  AL ++E     L+SALK +Q  E +LA A+     LK
Sbjct  915   QSFEMKLAAAVRRAEQAEGQVTTALRAKEEIANRLASALKMRQHAEGQLAAALTAQAELK  974

Query  351   EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  172
             E +A  E AQE++N+L ++VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ER+++F
Sbjct  975   ETVAAAERAQEDSNNLCSVVHSENLRLEHDLAFLKAVLEDTQKELDSTREGLVTERSKSF  1034

Query  171   QLQVEVFHLKQR-LQSLENRAPTP  103
             +LQ+E+F LK++ L SL     TP
Sbjct  1035  KLQMEIFDLKKKTLLSLSEEDATP  1058



>ref|XP_001761501.1| predicted protein [Physcomitrella patens]
 gb|EDQ73569.1| predicted protein [Physcomitrella patens]
Length=230

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = -1

Query  390  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  211
            KLA ++K    L+E+ A  + AQE++N+L N++H +N+RLEHD+AF KAVL+DTQK+L S
Sbjct  141  KLAASLKGRMDLEERSAAAKRAQEDSNNLRNVIHLENLRLEHDLAFFKAVLEDTQKDLQS  200

Query  210  TRGLLGGERARAFQLQVEVFHLKQRLQSL  124
             R L+  +R R+F LQ+ V HL   L +L
Sbjct  201  NRELIATKRTRSFNLQLTVDHLPFLLPAL  229



>gb|ABA95166.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -1

Query  525  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  346
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  545  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  604

Query  345  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  223
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  605  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQK  645



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
Length=649

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -1

Query  522  EAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKL  343
            + ++T L+R+N  LE QL+AALAS++ A+K+LS  + SK + EK+LA+  +E++ LKEK 
Sbjct  548  DTRITTLIRRNMALEEQLSAALASKDEAEKNLSLVIDSKDELEKRLAEKDREVEALKEKA  607

Query  342  AGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  223
             G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  608  TGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQK  647



>emb|CDY02611.1| BnaC02g08240D [Brassica napus]
 emb|CDY02612.1| BnaC02g08230D [Brassica napus]
Length=63

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -1

Query  297  IVHSDNVRLEHDVAFLKAVLDDTQKE--LHSTRGLLGGERARAFQLQV  160
            +VH DNVRLEHDVA +K VLDD Q++  LHSTRG+L GERAR FQLQV
Sbjct  1    MVHFDNVRLEHDVALVKYVLDDKQRKMFLHSTRGVLAGERARMFQLQV  48



>gb|ABR25493.1| rangap1 interacting protein [Oryza sativa Indica Group]
Length=40

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  204  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            G+L GER+RAFQLQVEVFHLKQRLQ++E R+PTPRKP
Sbjct  1    GVLAGERSRAFQLQVEVFHLKQRLQTMEGRSPTPRKP  37



>ref|XP_001765510.1| predicted protein [Physcomitrella patens]
 gb|EDQ69771.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 24/101 (24%)
 Frame = -1

Query  405  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  226
            Q  E K A ++K   + KE++A  E AQE++N+L N+VHS N+RLEHD AFLKAVL+DTQ
Sbjct  290  QHAEGKFAASLKA-QIEKERVAVAERAQEDSNNLCNVVHSGNLRLEHDFAFLKAVLEDTQ  348

Query  225  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  103
                                 +EVF LK++L       PTP
Sbjct  349  --------------------NMEVFDLKKKLLP---TIPTP  366



>gb|EEE53353.1| hypothetical protein OsJ_36377 [Oryza sativa Japonica Group]
Length=549

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -1

Query  222  ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  94
            ELHSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  506  ELHSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566999573790