BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048C13

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794726.1|  PREDICTED: polygalacturonase-1 non-catalytic...    412   2e-137   Nicotiana sylvestris
ref|XP_009596009.1|  PREDICTED: polygalacturonase-1 non-catalytic...    409   7e-136   Nicotiana tomentosiformis
gb|AHC69823.1|  polygalacturonase isoenzyme 1 beta subunit              408   1e-135   Nicotiana tabacum [American tobacco]
ref|XP_006365227.1|  PREDICTED: polygalacturonase-1 non-catalytic...    405   2e-134   Solanum tuberosum [potatoes]
ref|XP_009596020.1|  PREDICTED: polygalacturonase-1 non-catalytic...    404   5e-134   Nicotiana tomentosiformis
ref|XP_009794727.1|  PREDICTED: polygalacturonase-1 non-catalytic...    402   3e-133   Nicotiana sylvestris
ref|NP_001234835.1|  polygalacturonase-1 non-catalytic subunit be...    400   1e-132   Solanum lycopersicum
ref|XP_006365231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    398   7e-132   
ref|XP_004238668.1|  PREDICTED: polygalacturonase non-catalytic s...    398   1e-131   
ref|XP_006365229.1|  PREDICTED: polygalacturonase non-catalytic s...    396   3e-131   
ref|XP_006365226.1|  PREDICTED: polygalacturonase-1 non-catalytic...    397   3e-131   Solanum tuberosum [potatoes]
ref|XP_004238667.1|  PREDICTED: polygalacturonase non-catalytic s...    397   4e-131   
emb|CAN67205.1|  hypothetical protein VITISV_037214                     378   3e-129   Vitis vinifera
ref|XP_006365230.1|  PREDICTED: polygalacturonase-1 non-catalytic...    389   3e-128   Solanum tuberosum [potatoes]
ref|XP_009363553.1|  PREDICTED: probable polygalacturonase non-ca...    388   7e-128   
ref|XP_007223063.1|  hypothetical protein PRUPE_ppa003712mg             385   8e-128   
ref|XP_006365228.1|  PREDICTED: polygalacturonase non-catalytic s...    388   1e-127   Solanum tuberosum [potatoes]
ref|XP_008221810.1|  PREDICTED: probable polygalacturonase non-ca...    387   2e-127   Prunus mume [ume]
ref|XP_008340027.1|  PREDICTED: probable polygalacturonase non-ca...    387   2e-127   
emb|CAN66340.1|  hypothetical protein VITISV_018557                     373   2e-127   Vitis vinifera
ref|XP_011086565.1|  PREDICTED: polygalacturonase-1 non-catalytic...    387   3e-127   Sesamum indicum [beniseed]
ref|XP_011071083.1|  PREDICTED: polygalacturonase-1 non-catalytic...    385   1e-126   Sesamum indicum [beniseed]
ref|XP_008389645.1|  PREDICTED: probable polygalacturonase non-ca...    385   1e-126   Malus domestica [apple tree]
ref|XP_004238669.1|  PREDICTED: polygalacturonase-1 non-catalytic...    385   1e-126   Solanum lycopersicum
ref|XP_010100469.1|  hypothetical protein L484_027781                   384   2e-126   
ref|XP_008221868.1|  PREDICTED: probable polygalacturonase non-ca...    384   3e-126   Prunus mume [ume]
ref|XP_002266341.1|  PREDICTED: probable polygalacturonase non-ca...    384   4e-126   Vitis vinifera
gb|EYU31262.1|  hypothetical protein MIMGU_mgv1a002697mg                384   6e-126   Erythranthe guttata [common monkey flower]
gb|KDP26581.1|  hypothetical protein JCGZ_17739                         382   1e-125   Jatropha curcas
ref|XP_004298578.1|  PREDICTED: probable polygalacturonase non-ca...    382   2e-125   Fragaria vesca subsp. vesca
gb|KJB31246.1|  hypothetical protein B456_005G182600                    380   6e-125   Gossypium raimondii
ref|XP_002266815.1|  PREDICTED: probable polygalacturonase non-ca...    380   7e-125   Vitis vinifera
gb|KHG24447.1|  Polygalacturonase non-catalytic subunit protein         380   1e-124   Gossypium arboreum [tree cotton]
gb|KJB31245.1|  hypothetical protein B456_005G182600                    379   2e-124   Gossypium raimondii
gb|KDO82432.1|  hypothetical protein CISIN_1g044596mg                   380   2e-124   Citrus sinensis [apfelsine]
ref|XP_007224206.1|  hypothetical protein PRUPE_ppa017408mg             379   3e-124   
gb|KCW86731.1|  hypothetical protein EUGRSUZ_B03343                     378   3e-124   Eucalyptus grandis [rose gum]
ref|XP_002311777.2|  hypothetical protein POPTR_0008s19430g             379   3e-124   Populus trichocarpa [western balsam poplar]
ref|XP_010044636.1|  PREDICTED: polygalacturonase-1 non-catalytic...    378   4e-124   Eucalyptus grandis [rose gum]
ref|XP_009363551.1|  PREDICTED: probable polygalacturonase non-ca...    379   6e-124   Pyrus x bretschneideri [bai li]
ref|XP_006483847.1|  PREDICTED: probable polygalacturonase non-ca...    379   6e-124   Citrus sinensis [apfelsine]
ref|XP_006438392.1|  hypothetical protein CICLE_v10030930mg             377   2e-123   Citrus clementina [clementine]
ref|XP_010242994.1|  PREDICTED: probable polygalacturonase non-ca...    377   2e-123   Nelumbo nucifera [Indian lotus]
gb|KHN27021.1|  Putative polygalacturonase non-catalytic subunit        367   2e-123   Glycine soja [wild soybean]
ref|XP_007044636.1|  Polygalacturonase 2                                378   3e-123   
ref|XP_002525383.1|  Polygalacturonase-1 non-catalytic subunit be...    376   4e-123   Ricinus communis
ref|XP_011009539.1|  PREDICTED: probable polygalacturonase non-ca...    375   1e-122   Populus euphratica
ref|XP_011034135.1|  PREDICTED: probable polygalacturonase non-ca...    375   1e-122   Populus euphratica
gb|KDP26582.1|  hypothetical protein JCGZ_17740                         374   2e-122   Jatropha curcas
gb|KDO82433.1|  hypothetical protein CISIN_1g036311mg                   374   2e-122   Citrus sinensis [apfelsine]
ref|XP_003613234.1|  Polygalacturonase-1 non-catalytic subunit beta     374   2e-122   Medicago truncatula
ref|XP_002314620.2|  hypothetical protein POPTR_0010s05000g             374   4e-122   Populus trichocarpa [western balsam poplar]
ref|XP_004509821.1|  PREDICTED: probable polygalacturonase non-ca...    373   6e-122   Cicer arietinum [garbanzo]
ref|XP_008444317.1|  PREDICTED: probable polygalacturonase non-ca...    373   7e-122   Cucumis melo [Oriental melon]
ref|XP_006438394.1|  hypothetical protein CICLE_v10030947mg             372   1e-121   Citrus clementina [clementine]
ref|XP_003552018.1|  PREDICTED: probable polygalacturonase non-ca...    372   1e-121   Glycine max [soybeans]
gb|KDO38689.1|  hypothetical protein CISIN_1g045773mg                   361   1e-121   Citrus sinensis [apfelsine]
ref|XP_010251282.1|  PREDICTED: probable polygalacturonase non-ca...    372   1e-121   Nelumbo nucifera [Indian lotus]
ref|XP_010023570.1|  PREDICTED: probable polygalacturonase non-ca...    371   3e-121   
ref|XP_006438393.1|  hypothetical protein CICLE_v10033917mg             371   3e-121   
gb|KCW59875.1|  hypothetical protein EUGRSUZ_H02608                     371   3e-121   Eucalyptus grandis [rose gum]
ref|XP_003532010.1|  PREDICTED: probable polygalacturonase non-ca...    370   5e-121   Glycine max [soybeans]
ref|XP_004514684.1|  PREDICTED: polygalacturonase-1 non-catalytic...    370   5e-121   Cicer arietinum [garbanzo]
ref|XP_004173618.1|  PREDICTED: probable polygalacturonase non-ca...    370   6e-121   
ref|XP_004142981.1|  PREDICTED: probable polygalacturonase non-ca...    369   1e-120   Cucumis sativus [cucumbers]
gb|EYU22487.1|  hypothetical protein MIMGU_mgv1a002927mg                369   2e-120   Erythranthe guttata [common monkey flower]
ref|XP_003517743.1|  PREDICTED: probable polygalacturonase non-ca...    369   3e-120   Glycine max [soybeans]
ref|XP_003519820.2|  PREDICTED: probable polygalacturonase non-ca...    368   5e-120   Glycine max [soybeans]
ref|XP_006484316.1|  PREDICTED: probable polygalacturonase non-ca...    368   7e-120   
gb|KJB15113.1|  hypothetical protein B456_002G161400                    367   1e-119   Gossypium raimondii
ref|XP_010682558.1|  PREDICTED: probable polygalacturonase non-ca...    367   1e-119   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH20006.1|  polygalacturonase non-catalytic protein                 367   2e-119   Medicago truncatula
emb|CDP00165.1|  unnamed protein product                                366   3e-119   Coffea canephora [robusta coffee]
gb|EPS67761.1|  polygalacturonase-1 non-catalytic subunit beta          365   4e-119   Genlisea aurea
ref|XP_010477679.1|  PREDICTED: probable polygalacturonase non-ca...    365   5e-119   Camelina sativa [gold-of-pleasure]
gb|KEH20007.1|  polygalacturonase non-catalytic protein                 364   1e-118   Medicago truncatula
ref|XP_010551569.1|  PREDICTED: probable polygalacturonase non-ca...    363   2e-118   Tarenaya hassleriana [spider flower]
gb|KHG01313.1|  Polygalacturonase non-catalytic subunit protein         362   6e-118   Gossypium arboreum [tree cotton]
ref|XP_010520580.1|  PREDICTED: probable polygalacturonase non-ca...    362   8e-118   Tarenaya hassleriana [spider flower]
gb|KFK41456.1|  hypothetical protein AALP_AA2G132700                    362   1e-117   Arabis alpina [alpine rockcress]
ref|XP_009105700.1|  PREDICTED: probable polygalacturonase non-ca...    362   1e-117   Brassica rapa
ref|XP_007157462.1|  hypothetical protein PHAVU_002G071500g             361   2e-117   Phaseolus vulgaris [French bean]
ref|XP_009775426.1|  PREDICTED: probable polygalacturonase non-ca...    361   3e-117   Nicotiana sylvestris
ref|XP_010460151.1|  PREDICTED: probable polygalacturonase non-ca...    360   4e-117   Camelina sativa [gold-of-pleasure]
emb|CDY57845.1|  BnaA07g38770D                                          360   9e-117   Brassica napus [oilseed rape]
ref|XP_007153633.1|  hypothetical protein PHAVU_003G052000g             359   1e-116   Phaseolus vulgaris [French bean]
ref|XP_002318036.2|  hypothetical protein POPTR_0012s08060g             360   1e-116   Populus trichocarpa [western balsam poplar]
emb|CDP12374.1|  unnamed protein product                                360   1e-116   Coffea canephora [robusta coffee]
ref|XP_010498883.1|  PREDICTED: probable polygalacturonase non-ca...    359   1e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006390895.1|  hypothetical protein EUTSA_v10018277mg             359   1e-116   Eutrema salsugineum [saltwater cress]
ref|XP_006300881.1|  hypothetical protein CARUB_v10019971mg             359   2e-116   Capsella rubella
ref|XP_002890594.1|  hypothetical protein ARALYDRAFT_472637             359   2e-116   Arabidopsis lyrata subsp. lyrata
ref|XP_002888771.1|  hypothetical protein ARALYDRAFT_894840             357   7e-116   
gb|AAB39546.1|  polygalacturonase isoenzyme 1 beta subunit homolog      357   8e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509826.1|  PREDICTED: probable polygalacturonase non-ca...    357   8e-116   Cicer arietinum [garbanzo]
ref|XP_010471032.1|  PREDICTED: probable polygalacturonase non-ca...    357   8e-116   Camelina sativa [gold-of-pleasure]
ref|NP_177194.1|  polygalacturonase 2                                   357   8e-116   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23501.1|  BnaC06g24700D                                          357   8e-116   Brassica napus [oilseed rape]
ref|XP_010471031.1|  PREDICTED: probable polygalacturonase non-ca...    357   1e-115   
ref|XP_010427809.1|  PREDICTED: probable polygalacturonase non-ca...    357   1e-115   Camelina sativa [gold-of-pleasure]
ref|XP_006439797.1|  hypothetical protein CICLE_v10019363mg             356   1e-115   
emb|CBI15046.3|  unnamed protein product                                356   1e-115   Vitis vinifera
ref|XP_010415713.1|  PREDICTED: probable polygalacturonase non-ca...    356   2e-115   Camelina sativa [gold-of-pleasure]
ref|XP_002279813.2|  PREDICTED: probable polygalacturonase non-ca...    356   2e-115   Vitis vinifera
ref|XP_006303930.1|  hypothetical protein CARUB_v10008588mg             355   4e-115   
ref|XP_007036187.1|  Polygalacturonase 2, putative                      355   5e-115   
ref|XP_011044316.1|  PREDICTED: probable polygalacturonase non-ca...    354   1e-114   Populus euphratica
ref|NP_173788.1|  putative polygalacturonase non-catalytic subuni...    353   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009593470.1|  PREDICTED: probable polygalacturonase non-ca...    354   2e-114   Nicotiana tomentosiformis
ref|XP_006300871.1|  hypothetical protein CARUB_v10019963mg             353   2e-114   Capsella rubella
dbj|BAE99852.1|  putative polygalacuronase isoenzyme 1 beta subunit     353   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006476763.1|  PREDICTED: probable polygalacturonase non-ca...    353   2e-114   
ref|XP_007210277.1|  hypothetical protein PRUPE_ppa003003mg             353   3e-114   
ref|XP_010555103.1|  PREDICTED: probable polygalacturonase non-ca...    352   5e-114   Tarenaya hassleriana [spider flower]
gb|KEH20005.1|  polygalacturonase non-catalytic protein                 344   5e-114   Medicago truncatula
gb|KHN00353.1|  Polygalacturonase-1 non-catalytic subunit beta          346   7e-114   Glycine soja [wild soybean]
gb|KDP31113.1|  hypothetical protein JCGZ_11489                         352   9e-114   Jatropha curcas
emb|CCD74525.1|  polygalacturonase 1                                    352   1e-113   Arabidopsis halleri subsp. halleri
ref|XP_008374449.1|  PREDICTED: probable polygalacturonase non-ca...    352   1e-113   
ref|XP_010101197.1|  hypothetical protein L484_015001                   351   2e-113   
ref|XP_008239752.1|  PREDICTED: probable polygalacturonase non-ca...    351   2e-113   Prunus mume [ume]
ref|XP_010678748.1|  PREDICTED: probable polygalacturonase non-ca...    350   5e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008346742.1|  PREDICTED: probable polygalacturonase non-ca...    350   6e-113   
ref|XP_011071835.1|  PREDICTED: probable polygalacturonase non-ca...    350   7e-113   Sesamum indicum [beniseed]
gb|AAB39538.1|  aromatic rich glycoprotein JP630                        349   8e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345047.1|  PREDICTED: probable polygalacturonase non-ca...    350   1e-112   Solanum tuberosum [potatoes]
ref|XP_004300895.1|  PREDICTED: probable polygalacturonase non-ca...    348   3e-112   Fragaria vesca subsp. vesca
ref|XP_004236111.1|  PREDICTED: probable polygalacturonase non-ca...    348   4e-112   Solanum lycopersicum
ref|NP_176242.1|  polygalacturonase 1                                   346   2e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511417.1|  Polygalacturonase-1 non-catalytic subunit be...    346   3e-111   Ricinus communis
gb|EPS60630.1|  polygalacturonase-1 non-catalytic subunit beta          344   5e-111   Genlisea aurea
ref|XP_007141610.1|  hypothetical protein PHAVU_008G210500g             343   1e-110   Phaseolus vulgaris [French bean]
ref|XP_010473218.1|  PREDICTED: probable polygalacturonase non-ca...    341   1e-109   Camelina sativa [gold-of-pleasure]
emb|CDP00166.1|  unnamed protein product                                338   4e-109   Coffea canephora [robusta coffee]
ref|XP_010510953.1|  PREDICTED: probable polygalacturonase non-ca...    339   6e-109   Camelina sativa [gold-of-pleasure]
ref|XP_004138283.1|  PREDICTED: probable polygalacturonase non-ca...    340   7e-109   Cucumis sativus [cucumbers]
gb|KHG12475.1|  Polygalacturonase non-catalytic subunit protein         340   8e-109   Gossypium arboreum [tree cotton]
ref|XP_008453099.1|  PREDICTED: probable polygalacturonase non-ca...    340   8e-109   Cucumis melo [Oriental melon]
ref|XP_010417970.1|  PREDICTED: probable polygalacturonase non-ca...    338   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_002886622.1|  hypothetical protein ARALYDRAFT_475291             338   1e-108   
ref|XP_004166494.1|  PREDICTED: probable polygalacturonase non-ca...    340   2e-108   
gb|KJB30299.1|  hypothetical protein B456_005G136300                    338   3e-108   Gossypium raimondii
ref|XP_008800877.1|  PREDICTED: BURP domain-containing protein 12...    336   1e-107   Phoenix dactylifera
emb|CDY53059.1|  BnaA09g14240D                                          335   3e-107   Brassica napus [oilseed rape]
ref|XP_010936822.1|  PREDICTED: BURP domain-containing protein 12...    334   4e-107   Elaeis guineensis
ref|XP_010924225.1|  PREDICTED: BURP domain-containing protein 12...    334   8e-107   Elaeis guineensis
ref|XP_008776735.1|  PREDICTED: BURP domain-containing protein 12...    333   2e-106   Phoenix dactylifera
ref|XP_010553600.1|  PREDICTED: probable polygalacturonase non-ca...    333   2e-106   Tarenaya hassleriana [spider flower]
emb|CDX68345.1|  BnaA07g23850D                                          332   2e-106   
gb|KFK44451.1|  hypothetical protein AALP_AA1G258600                    332   5e-106   Arabis alpina [alpine rockcress]
ref|XP_009113216.1|  PREDICTED: probable polygalacturonase non-ca...    330   2e-105   Brassica rapa
ref|XP_010925453.1|  PREDICTED: BURP domain-containing protein 12...    330   3e-105   Elaeis guineensis
gb|KHN30893.1|  Polygalacturonase-1 non-catalytic subunit beta          327   4e-105   Glycine soja [wild soybean]
ref|XP_003601289.1|  Polygalacturonase-1 non-catalytic subunit beta     329   6e-105   Medicago truncatula
ref|XP_004501939.1|  PREDICTED: probable polygalacturonase non-ca...    329   6e-105   Cicer arietinum [garbanzo]
gb|KCW86729.1|  hypothetical protein EUGRSUZ_B03340                     317   7e-105   Eucalyptus grandis [rose gum]
ref|XP_006392169.1|  hypothetical protein EUTSA_v10023352mg             328   2e-104   Eutrema salsugineum [saltwater cress]
ref|XP_009393062.1|  PREDICTED: BURP domain-containing protein 12...    328   2e-104   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY47228.1|  BnaC09g14770D                                          327   2e-104   Brassica napus [oilseed rape]
ref|XP_010044627.1|  PREDICTED: polygalacturonase non-catalytic s...    319   3e-104   Eucalyptus grandis [rose gum]
ref|XP_006578624.1|  PREDICTED: polygalacturonase-1 non-catalytic...    327   3e-104   Glycine max [soybeans]
ref|XP_003610589.1|  Polygalacturonase-1 non-catalytic subunit beta     312   5e-104   
gb|KCW86723.1|  hypothetical protein EUGRSUZ_B03334                     314   8e-104   Eucalyptus grandis [rose gum]
gb|KCW86730.1|  hypothetical protein EUGRSUZ_B03341                     314   1e-103   Eucalyptus grandis [rose gum]
gb|KCW86720.1|  hypothetical protein EUGRSUZ_B03328                     310   4e-103   Eucalyptus grandis [rose gum]
ref|XP_010046642.1|  PREDICTED: polygalacturonase non-catalytic s...    316   5e-103   
ref|XP_003528153.1|  PREDICTED: polygalacturonase-1 non-catalytic...    324   6e-103   Glycine max [soybeans]
ref|XP_010028282.1|  PREDICTED: probable polygalacturonase non-ca...    324   7e-103   Eucalyptus grandis [rose gum]
ref|XP_010046648.1|  PREDICTED: polygalacturonase non-catalytic s...    315   1e-102   Eucalyptus grandis [rose gum]
ref|XP_007138090.1|  hypothetical protein PHAVU_009G179500g             323   1e-102   Phaseolus vulgaris [French bean]
emb|CDY59986.1|  BnaC06g43610D                                          321   5e-102   Brassica napus [oilseed rape]
gb|KCW86722.1|  hypothetical protein EUGRSUZ_B03333                     309   7e-102   Eucalyptus grandis [rose gum]
ref|XP_010046646.1|  PREDICTED: BURP domain-containing protein 16...    317   2e-101   
ref|XP_006659367.1|  PREDICTED: BURP domain-containing protein 12...    310   5e-99    Oryza brachyantha
ref|XP_009394250.1|  PREDICTED: BURP domain-containing protein 12...    314   6e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001061692.1|  Os08g0380100                                       309   3e-97    
ref|XP_004973305.1|  PREDICTED: BURP domain-containing protein 12...    305   2e-95    Setaria italica
ref|XP_009415276.1|  PREDICTED: BURP domain-containing protein 12...    305   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS68955.1|  hypothetical protein M569_05812                         301   2e-94    Genlisea aurea
ref|XP_010044626.1|  PREDICTED: polygalacturonase non-catalytic s...    291   1e-93    Eucalyptus grandis [rose gum]
dbj|BAJ92348.1|  predicted protein                                      299   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004956601.1|  PREDICTED: BURP domain-containing protein 14...    300   6e-93    Setaria italica
gb|EMS58973.1|  hypothetical protein TRIUR3_16136                       293   2e-92    Triticum urartu
ref|XP_010046641.1|  PREDICTED: polygalacturonase non-catalytic s...    288   3e-92    Eucalyptus grandis [rose gum]
ref|XP_010044635.1|  PREDICTED: probable polygalacturonase non-ca...    288   3e-92    Eucalyptus grandis [rose gum]
ref|XP_003574428.1|  PREDICTED: BURP domain-containing protein 12       295   5e-92    Brachypodium distachyon [annual false brome]
ref|XP_008652571.1|  PREDICTED: BURP domain-containing protein 14...    296   1e-91    
ref|NP_001146063.1|  uncharacterized protein LOC100279594 precursor     293   4e-91    Zea mays [maize]
gb|ACN34141.1|  unknown                                                 293   5e-91    Zea mays [maize]
gb|ACG28762.1|  polygalacturonase-1 non-catalytic beta subunit pr...    293   5e-91    Zea mays [maize]
ref|XP_002460065.1|  hypothetical protein SORBIDRAFT_02g022220          292   3e-90    Sorghum bicolor [broomcorn]
ref|NP_001062896.2|  Os09g0329000                                       290   4e-89    
gb|EEC84370.1|  hypothetical protein OsI_30914                          288   5e-89    Oryza sativa Indica Group [Indian rice]
gb|EMT30231.1|  hypothetical protein F775_20363                         278   2e-87    
dbj|BAJ97940.1|  predicted protein                                      286   3e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002444270.1|  hypothetical protein SORBIDRAFT_07g019310          282   1e-86    Sorghum bicolor [broomcorn]
dbj|BAK05386.1|  predicted protein                                      281   2e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO69699.1|  hypothetical protein CISIN_1g0378481mg                  263   3e-85    Citrus sinensis [apfelsine]
ref|XP_010046643.1|  PREDICTED: polygalacturonase-1 non-catalytic...    263   1e-84    
ref|NP_001064572.1|  Os10g0409400                                       268   2e-84    
gb|EEE68602.1|  hypothetical protein OsJ_27135                          276   8e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EEC83505.1|  hypothetical protein OsI_29064                          273   2e-83    Oryza sativa Indica Group [Indian rice]
gb|EEC77314.1|  hypothetical protein OsI_15976                          253   6e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_003576424.1|  PREDICTED: BURP domain-containing protein 14...    267   8e-80    
gb|ABR16440.1|  unknown                                                 263   3e-79    Picea sitchensis
ref|XP_002525381.1|  Polygalacturonase non-catalytic subunit AroG...    259   4e-79    
gb|KCW86721.1|  hypothetical protein EUGRSUZ_B03330                     249   7e-79    Eucalyptus grandis [rose gum]
gb|KCW86724.1|  hypothetical protein EUGRSUZ_B03335                     247   2e-78    Eucalyptus grandis [rose gum]
ref|XP_010046644.1|  PREDICTED: polygalacturonase-1 non-catalytic...    249   3e-78    
dbj|BAD23622.1|  polygalacturonase isoenzyme 1 beta subunit-like        256   2e-76    Oryza sativa Japonica Group [Japonica rice]
gb|AES96108.2|  BURP domain protein                                     241   1e-73    Medicago truncatula
ref|XP_003613150.1|  Polygalacturonase-1 non-catalytic subunit beta     241   2e-73    
gb|KCW86727.1|  hypothetical protein EUGRSUZ_B03337                     231   6e-72    Eucalyptus grandis [rose gum]
ref|XP_003613151.1|  Polygalacturonase-1 non-catalytic subunit beta     227   2e-70    
gb|EEE69479.1|  hypothetical protein OsJ_28904                          241   5e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003613149.1|  Polygalacturonase-1 non-catalytic subunit beta     238   7e-70    
ref|XP_010046647.1|  PREDICTED: polygalacturonase-1 non-catalytic...    209   4e-64    
ref|XP_003613152.1|  Polygalacturonase-1 non-catalytic subunit beta     204   4e-61    
ref|XP_010100468.1|  hypothetical protein L484_027780                   201   6e-61    
emb|CAN81758.1|  hypothetical protein VITISV_043391                     186   3e-51    Vitis vinifera
gb|AAT08718.1|  polygalacturonase                                       174   3e-50    Hyacinthus orientalis [common hyacinth]
gb|AAT08687.1|  polygalacturonase                                       171   4e-49    Hyacinthus orientalis [common hyacinth]
emb|CDP10831.1|  unnamed protein product                                172   6e-49    Coffea canephora [robusta coffee]
gb|EMT26618.1|  hypothetical protein F775_18544                         180   9e-49    
gb|AAL65393.1|  polygalacturonase isoenzyme 1 beta subunit              166   9e-48    Oryza sativa Japonica Group [Japonica rice]
emb|CDP10830.1|  unnamed protein product                                169   1e-46    Coffea canephora [robusta coffee]
gb|AAL15882.1|AF417294_1  putative polygalacturonase beta subunit       155   7e-44    Castanea sativa
ref|XP_006844960.1|  hypothetical protein AMTR_s00058p00173800          164   5e-43    
gb|EYU36709.1|  hypothetical protein MIMGU_mgv1a024306mg                157   1e-42    Erythranthe guttata [common monkey flower]
gb|AAL08244.1|  At1g70370/F17O7_9                                       162   1e-42    Arabidopsis thaliana [mouse-ear cress]
gb|EYU36708.1|  hypothetical protein MIMGU_mgv1a009279mg                159   2e-42    Erythranthe guttata [common monkey flower]
ref|XP_011091745.1|  PREDICTED: polygalacturonase-1 non-catalytic...    157   5e-42    Sesamum indicum [beniseed]
ref|XP_011091740.1|  PREDICTED: polygalacturonase-1 non-catalytic...    154   2e-41    Sesamum indicum [beniseed]
ref|XP_011074238.1|  PREDICTED: BURP domain-containing protein 16...    152   3e-40    Sesamum indicum [beniseed]
ref|XP_006661124.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...    154   1e-39    
ref|XP_001776362.1|  predicted protein                                  145   2e-38    
gb|AFV47141.1|  BURP domain RD22-like protein                           148   3e-38    Physcomitrella patens
gb|EMS64687.1|  hypothetical protein TRIUR3_01269                       150   3e-38    Triticum urartu
ref|XP_001783704.1|  predicted protein                                  142   4e-37    
ref|XP_006833278.1|  hypothetical protein AMTR_s00109p00021460          142   6e-36    Amborella trichopoda
ref|XP_003522684.1|  PREDICTED: dehydration-responsive protein RD...    139   4e-35    Glycine max [soybeans]
gb|ACU19496.1|  unknown                                                 138   8e-35    Glycine max [soybeans]
gb|KHN10237.1|  Dehydration-responsive protein RD22                     138   9e-35    Glycine soja [wild soybean]
ref|XP_003588551.1|  BURP domain-containing protein                     138   1e-34    Medicago truncatula
ref|XP_004498543.1|  PREDICTED: dehydration-responsive protein RD...    138   1e-34    Cicer arietinum [garbanzo]
ref|XP_003588464.1|  Dehydration-responsive protein RD22                137   1e-34    
emb|CAN75710.1|  hypothetical protein VITISV_004492                     138   2e-34    Vitis vinifera
ref|NP_001268112.1|  RD22-like protein precursor                        137   2e-34    Vitis vinifera
ref|XP_003588559.1|  BURP domain-containing protein                     137   2e-34    Medicago truncatula
ref|XP_002284368.1|  PREDICTED: dehydration-responsive protein RD22     135   3e-34    Vitis vinifera
ref|XP_004241419.1|  PREDICTED: BURP domain-containing protein 16...    138   3e-34    Solanum lycopersicum
emb|CBI20911.3|  unnamed protein product                                136   3e-34    Vitis vinifera
gb|AAL26909.1|AF319165_1  dehydration-responsive protein RD22           136   4e-34    Prunus persica
ref|XP_009373565.1|  PREDICTED: dehydration-responsive protein RD...    136   7e-34    
gb|ABK96092.1|  unknown                                                 132   7e-34    Populus trichocarpa [western balsam poplar]
ref|XP_002284380.1|  PREDICTED: BURP domain-containing protein 3-...    134   1e-33    Vitis vinifera
ref|XP_007221784.1|  hypothetical protein PRUPE_ppa005699mg             137   1e-33    
ref|XP_009373564.1|  PREDICTED: dehydration-responsive protein RD...    136   1e-33    
ref|XP_009373563.1|  PREDICTED: dehydration-responsive protein RD...    136   2e-33    
ref|XP_009373562.1|  PREDICTED: dehydration-responsive protein RD...    136   2e-33    Pyrus x bretschneideri [bai li]
ref|XP_001781225.1|  predicted protein                                  131   2e-33    
ref|XP_010249743.1|  PREDICTED: dehydration-responsive protein RD22     135   3e-33    Nelumbo nucifera [Indian lotus]
gb|AES58801.2|  dehydration-responsive protein RD22                     133   3e-33    Medicago truncatula
ref|XP_008337839.1|  PREDICTED: dehydration-responsive protein RD...    133   3e-33    Malus domestica [apple tree]
gb|ACD62790.1|  BURP domain-containing protein                          134   3e-33    Phaseolus vulgaris [French bean]
ref|XP_009762320.1|  PREDICTED: dehydration-responsive protein RD22     135   3e-33    Nicotiana sylvestris
gb|AAB38497.1|  female sex protein                                      131   3e-33    Mercurialis annua [annual mercury]
ref|XP_003588550.1|  BURP domain-containing protein                     133   4e-33    
ref|XP_010276358.1|  PREDICTED: dehydration-responsive protein RD...    134   4e-33    Nelumbo nucifera [Indian lotus]
ref|XP_002324250.2|  hypothetical protein POPTR_0018s00850g             132   5e-33    
dbj|BAB60848.1|  BURP domain-containing protein                         133   5e-33    Bruguiera gymnorhiza [Burma mangrove]
ref|XP_009628253.1|  PREDICTED: dehydration-responsive protein RD...    134   5e-33    Nicotiana tomentosiformis
ref|XP_011019672.1|  PREDICTED: dehydration-responsive protein RD...    134   5e-33    Populus euphratica
ref|XP_007137164.1|  hypothetical protein PHAVU_009G105300g             133   6e-33    Phaseolus vulgaris [French bean]
ref|XP_009628254.1|  PREDICTED: dehydration-responsive protein RD...    134   6e-33    Nicotiana tomentosiformis
ref|XP_010667774.1|  PREDICTED: dehydration-responsive protein RD...    133   6e-33    Beta vulgaris subsp. vulgaris [field beet]
gb|AFK48420.1|  unknown                                                 134   7e-33    Lotus japonicus
dbj|BAB60849.1|  BURP domain-containing protein                         133   7e-33    Bruguiera gymnorhiza [Burma mangrove]
ref|XP_003629327.1|  Polygalacturonase-1 non-catalytic subunit beta     125   1e-32    
ref|XP_004299100.1|  PREDICTED: BURP domain-containing protein 3-...    131   1e-32    
gb|AFI80905.1|  dehydration-responsive protein                          129   1e-32    
ref|XP_007012037.1|  BURP domain-containing protein, putative iso...    132   1e-32    
dbj|BAB60850.1|  BURP domain-containing protein                         131   2e-32    
ref|XP_009367927.1|  PREDICTED: dehydration-responsive protein RD...    132   2e-32    
ref|XP_009338714.1|  PREDICTED: dehydration-responsive protein RD...    129   2e-32    
ref|XP_007012036.1|  BURP domain-containing protein isoform 1           132   2e-32    
gb|EPS58650.1|  hypothetical protein M569_16161                         130   2e-32    
ref|XP_002308621.2|  Dehydration-responsive protein RD22 precursor      133   2e-32    
ref|XP_006388094.1|  hypothetical protein POPTR_0343s00200g             133   2e-32    
ref|NP_001235949.1|  BURP domain protein precursor                      132   2e-32    
gb|AGV54277.1|  BURP domain-containing protein                          132   2e-32    
gb|ACU21473.1|  unknown                                                 132   2e-32    
gb|AES58805.2|  dehydration-responsive RD22-like protein                129   2e-32    
gb|ABH09493.1|  RD22-like protein                                       132   3e-32    
ref|XP_010028578.1|  PREDICTED: BURP domain-containing protein 17       130   3e-32    
emb|CDP18474.1|  unnamed protein product                                130   3e-32    
ref|XP_010925837.1|  PREDICTED: BURP domain-containing protein 3-...    129   4e-32    
ref|XP_002516581.1|  Dehydration-responsive protein RD22 precurso...    132   4e-32    
ref|XP_011026571.1|  PREDICTED: dehydration-responsive protein RD...    132   4e-32    
ref|XP_007140998.1|  hypothetical protein PHAVU_008G158600g             131   4e-32    
ref|XP_008220021.1|  PREDICTED: dehydration-responsive protein RD...    131   4e-32    
ref|XP_003588556.1|  Dehydration-responsive protein RD22                130   5e-32    
ref|XP_010925836.1|  PREDICTED: BURP domain-containing protein 6-...    129   6e-32    
gb|AES58800.2|  dehydration-responsive protein RD22                     129   6e-32    
ref|XP_004291216.1|  PREDICTED: dehydration-responsive protein RD22     131   7e-32    
ref|XP_006371718.1|  hypothetical protein POPTR_0018s00850g             131   8e-32    
ref|NP_001275413.1|  BURP domain-containing protein precursor           130   8e-32    
ref|XP_009374195.1|  PREDICTED: BURP domain-containing protein 3-...    129   9e-32    
ref|XP_003588549.1|  BURP domain-containing protein                     129   9e-32    
ref|XP_010667747.1|  PREDICTED: dehydration-responsive protein RD...    131   9e-32    
ref|XP_008387386.1|  PREDICTED: BURP domain-containing protein 3-...    129   1e-31    
ref|XP_007200499.1|  hypothetical protein PRUPE_ppa009236mg             129   1e-31    
ref|XP_009367929.1|  PREDICTED: dehydration-responsive protein RD...    130   1e-31    
ref|XP_008348420.1|  PREDICTED: dehydration-responsive protein RD...    129   1e-31    
gb|KDP34221.1|  hypothetical protein JCGZ_07792                         130   2e-31    
ref|XP_009367928.1|  PREDICTED: BURP domain-containing protein 3-...    130   2e-31    
gb|EPS61992.1|  hypothetical protein M569_12801                         128   2e-31    
ref|XP_009375835.1|  PREDICTED: BURP domain-containing protein 17...    128   2e-31    
ref|XP_009374194.1|  PREDICTED: BURP domain-containing protein 17...    128   2e-31    
ref|XP_007200547.1|  hypothetical protein PRUPE_ppa009549mg             127   3e-31    
ref|XP_002514311.1|  polygalacturonase, putative                        128   3e-31    
ref|XP_003588552.1|  BURP domain protein                                128   3e-31    
gb|ABK95182.1|  unknown                                                 129   3e-31    
gb|AGV54733.1|  dehydration-responsive protein RD22-like protein        128   3e-31    
ref|XP_003588554.1|  BURP domain-containing protein                     128   3e-31    
ref|XP_003588558.1|  BURP domain protein                                128   3e-31    
ref|XP_008380463.1|  PREDICTED: dehydration-responsive protein RD...    129   4e-31    
ref|XP_004500819.1|  PREDICTED: BURP domain-containing protein 17...    127   4e-31    
ref|XP_003569738.1|  PREDICTED: BURP domain-containing protein 3-...    130   5e-31    
ref|XP_010690912.1|  PREDICTED: BURP domain-containing protein 3-...    127   5e-31    
gb|AFW85139.1|  hypothetical protein ZEAMMB73_186505                    124   5e-31    
emb|CAH59196.1|  BURP-domain containing protein                         128   5e-31    
ref|XP_010100465.1|  hypothetical protein L484_027777                   120   6e-31    
emb|CDP16139.1|  unnamed protein product                                127   8e-31    
ref|XP_003603899.1|  BURP domain-containing protein                     127   8e-31    
ref|XP_008363539.1|  PREDICTED: BURP domain-containing protein 5-...    126   8e-31    
ref|XP_009607060.1|  PREDICTED: BURP domain-containing protein 3-...    128   9e-31    
ref|XP_010925834.1|  PREDICTED: BURP domain-containing protein 6-...    126   9e-31    
dbj|BAB60847.1|  BURP domain-containing protein                         126   1e-30    
ref|XP_008792350.1|  PREDICTED: BURP domain-containing protein 3        127   1e-30    
gb|KDO79705.1|  hypothetical protein CISIN_1g018131mg                   127   1e-30    
ref|XP_003606871.1|  BURP domain-containing protein                     126   1e-30    
ref|XP_007224966.1|  hypothetical protein PRUPE_ppa020936mg             127   1e-30    
ref|XP_010924753.1|  PREDICTED: BURP domain-containing protein 3-...    127   1e-30    
gb|KHN25362.1|  Protein RAFTIN 1B                                       124   1e-30    
ref|XP_008219773.1|  PREDICTED: dehydration-responsive protein RD...    125   1e-30    
gb|AFK43537.1|  unknown                                                 126   1e-30    
ref|NP_001132751.1|  hypothetical protein precursor                     127   1e-30    
ref|XP_009375834.1|  PREDICTED: BURP domain-containing protein 3-...    126   1e-30    
ref|XP_003588548.1|  BURP domain-containing protein                     126   2e-30    
gb|KDO79703.1|  hypothetical protein CISIN_1g018131mg                   126   2e-30    
emb|CDP16137.1|  unnamed protein product                                126   2e-30    
gb|ACV60360.1|  RD22-like protein                                       126   2e-30    
ref|XP_006476150.1|  PREDICTED: dehydration-responsive protein RD...    127   2e-30    
ref|XP_009798351.1|  PREDICTED: BURP domain-containing protein 3-...    127   2e-30    
gb|KHN15367.1|  Dehydration-responsive protein RD22                     127   2e-30    
ref|XP_008226517.1|  PREDICTED: dehydration-responsive protein RD...    126   2e-30    
gb|EPS64452.1|  hypothetical protein M569_10329                         125   2e-30    
gb|ACU20207.1|  unknown                                                 127   2e-30    
ref|XP_010049078.1|  PREDICTED: dehydration-responsive protein RD22     126   2e-30    
ref|XP_011048729.1|  PREDICTED: BURP domain-containing protein 3-...    125   2e-30    
gb|ACF84595.1|  unknown                                                 123   2e-30    
ref|XP_008226515.1|  PREDICTED: dehydration-responsive protein RD...    126   2e-30    
ref|XP_010106680.1|  BURP domain-containing protein 3                   125   2e-30    
ref|XP_006450616.1|  hypothetical protein CICLE_v10008742mg             126   2e-30    
ref|XP_007227268.1|  hypothetical protein PRUPE_ppa017769mg             126   2e-30    
gb|ACH97124.1|  BURP domain-containing protein                          126   3e-30    
gb|ACU19518.1|  unknown                                                 125   3e-30    
ref|XP_009338715.1|  PREDICTED: BURP domain-containing protein 3-...    127   3e-30    
ref|XP_009338717.1|  PREDICTED: BURP domain-containing protein 3-...    127   3e-30    
ref|NP_001237833.1|  seed coat BURP domain protein 1 precursor          125   3e-30    
ref|XP_007224866.1|  hypothetical protein PRUPE_ppa022737mg             125   3e-30    
ref|XP_009338716.1|  PREDICTED: dehydration-responsive protein RD...    127   3e-30    
ref|XP_006450615.1|  hypothetical protein CICLE_v10008742mg             126   3e-30    
ref|XP_003603599.1|  BURP domain protein                                125   4e-30    
ref|XP_008226516.1|  PREDICTED: dehydration-responsive protein RD...    125   4e-30    
ref|NP_001238316.1|  BURP domain-containing protein precursor           125   4e-30    
ref|XP_008457931.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...    124   6e-30    
ref|NP_001234521.1|  BURP domain-containing protein precursor           125   6e-30    
ref|XP_002313054.2|  hypothetical protein POPTR_0009s11750g             124   6e-30    
ref|NP_001236126.1|  BURP domain protein 2 precursor                    125   6e-30    
emb|CAN83032.1|  hypothetical protein VITISV_006147                     124   8e-30    
ref|XP_007221811.1|  hypothetical protein PRUPE_ppa004101mg             125   8e-30    
dbj|BAC22501.1|  resistant specific protein-3                           123   8e-30    
gb|KDP22142.1|  hypothetical protein JCGZ_25973                         125   8e-30    
gb|ABK96114.1|  unknown                                                 123   9e-30    
ref|XP_010667737.1|  PREDICTED: dehydration-responsive protein RD...    125   1e-29    
ref|XP_008236869.1|  PREDICTED: BURP domain-containing protein 9-...    126   1e-29    
ref|XP_007211649.1|  hypothetical protein PRUPE_ppa008874mg             124   1e-29    
ref|XP_002509472.1|  Dehydration-responsive protein RD22 precurso...    123   1e-29    
emb|CDP16143.1|  unnamed protein product                                123   1e-29    
emb|CDP16148.1|  unnamed protein product                                124   1e-29    
ref|XP_008245942.1|  PREDICTED: BURP domain-containing protein 3-...    123   1e-29    
emb|CDP21613.1|  unnamed protein product                                123   2e-29    
ref|XP_007222162.1|  hypothetical protein PRUPE_ppa005767mg             125   2e-29    
gb|ACU24326.1|  unknown                                                 122   2e-29    
ref|NP_001267970.1|  rd22-c protein precursor                           123   2e-29    
ref|XP_010648537.1|  PREDICTED: dehydration-responsive protein RD...    120   2e-29    
ref|XP_007221812.1|  hypothetical protein PRUPE_ppa004101mg             124   2e-29    
gb|KJB54860.1|  hypothetical protein B456_009G052200                    120   2e-29    
ref|XP_011014851.1|  PREDICTED: dehydration-responsive protein RD...    120   3e-29    
ref|XP_007200832.1|  hypothetical protein PRUPE_ppa025935mg             124   3e-29    
ref|XP_004148853.1|  PREDICTED: BURP domain-containing protein 17...    122   3e-29    
ref|XP_004507419.1|  PREDICTED: BURP domain-containing protein 3-...    122   4e-29    
ref|XP_007225010.1|  hypothetical protein PRUPE_ppa020264mg             121   4e-29    
ref|XP_004299102.1|  PREDICTED: BURP domain-containing protein 3-...    122   4e-29    
dbj|BAC22498.1|  resistant specific protein-1(4)                        123   4e-29    
gb|KDP33666.1|  hypothetical protein JCGZ_07237                         122   4e-29    
gb|EYU20466.1|  hypothetical protein MIMGU_mgv1a020040mg                122   4e-29    
emb|CDP21056.1|  unnamed protein product                                122   4e-29    
ref|XP_011088371.1|  PREDICTED: BURP domain-containing protein 3-...    122   5e-29    
gb|KJB54854.1|  hypothetical protein B456_009G052100                    123   5e-29    
ref|XP_003537889.1|  PREDICTED: BURP domain-containing protein 3-...    122   5e-29    
emb|CDP01516.1|  unnamed protein product                                122   5e-29    
gb|KHN15366.1|  Dehydration-responsive protein RD22                     122   5e-29    
ref|NP_001141101.1|  hypothetical protein precursor                     123   6e-29    
ref|NP_001236706.1|  uncharacterized protein LOC100527485               119   6e-29    
gb|KJB54857.1|  hypothetical protein B456_009G052200                    121   7e-29    
ref|XP_008781671.1|  PREDICTED: BURP domain-containing protein 6-...    122   7e-29    
ref|XP_007222322.1|  hypothetical protein PRUPE_ppa008080mg             122   7e-29    
ref|XP_008219775.1|  PREDICTED: dehydration-responsive protein RD...    121   8e-29    
ref|XP_007223280.1|  hypothetical protein PRUPE_ppa005535mg             123   8e-29    
ref|XP_008220015.1|  PREDICTED: BURP domain-containing protein 5-...    122   8e-29    
ref|XP_010256408.1|  PREDICTED: BURP domain-containing protein 6-...    121   9e-29    
ref|XP_011081829.1|  PREDICTED: dehydration-responsive protein RD22     122   9e-29    
gb|KJB54859.1|  hypothetical protein B456_009G052200                    121   1e-28    
ref|XP_007225722.1|  hypothetical protein PRUPE_ppa006739mg             122   1e-28    
gb|KJB83557.1|  hypothetical protein B456_013G252700                    119   1e-28    
ref|XP_010112167.1|  hypothetical protein L484_019906                   124   1e-28    
ref|XP_002456304.1|  hypothetical protein SORBIDRAFT_03g033760          123   1e-28    
ref|XP_004136300.1|  PREDICTED: dehydration-responsive protein RD...    122   1e-28    
gb|KJB54858.1|  hypothetical protein B456_009G052200                    121   1e-28    
emb|CDP16146.1|  unnamed protein product                                121   1e-28    
gb|KJB54856.1|  hypothetical protein B456_009G052200                    121   1e-28    
ref|XP_002523253.1|  Polygalacturonase non-catalytic subunit AroG...    122   1e-28    
ref|XP_007015178.1|  BURP domain-containing protein, putative           122   1e-28    
ref|XP_008466264.1|  PREDICTED: dehydration-responsive protein RD...    122   1e-28    
gb|KJB54864.1|  hypothetical protein B456_009G052200                    121   2e-28    
gb|KJB54863.1|  hypothetical protein B456_009G052200                    121   2e-28    
ref|XP_011016123.1|  PREDICTED: dehydration-responsive protein RD...    121   2e-28    
ref|XP_006592108.1|  PREDICTED: putative GPI-anchored protein PB1...    122   2e-28    
gb|KJB21816.1|  hypothetical protein B456_004G015500                    120   2e-28    
ref|XP_002306019.2|  embryonic abundant family protein                  118   2e-28    
gb|KJB54861.1|  hypothetical protein B456_009G052200                    120   2e-28    
emb|CDP21057.1|  unnamed protein product                                121   2e-28    
ref|XP_007222784.1|  hypothetical protein PRUPE_ppa006620mg             122   2e-28    
ref|XP_007221813.1|  hypothetical protein PRUPE_ppa004101mg             122   2e-28    
gb|AAT66913.1|  dehydration-induced protein RD22-like protein 2         121   2e-28    
ref|XP_006592107.1|  PREDICTED: putative GPI-anchored protein PB1...    122   2e-28    
gb|KJB54855.1|  hypothetical protein B456_009G052200                    121   2e-28    
gb|AAL67991.1|  dehydration-induced protein RD22-like protein           120   2e-28    
emb|CDP21280.1|  unnamed protein product                                120   2e-28    
ref|XP_008466262.1|  PREDICTED: dehydration-responsive protein RD...    121   2e-28    
ref|XP_008245628.1|  PREDICTED: dehydration-responsive protein RD...    119   3e-28    
ref|XP_007222614.1|  hypothetical protein PRUPE_ppa008481mg             120   3e-28    
ref|NP_001274155.1|  uncharacterized protein LOC101767742 precursor     121   3e-28    
ref|XP_008245112.1|  PREDICTED: dehydration-responsive protein RD...    120   4e-28    
gb|KJB21815.1|  hypothetical protein B456_004G015400                    117   4e-28    
ref|XP_007138104.1|  hypothetical protein PHAVU_009G180600g             121   4e-28    
emb|CDP16140.1|  unnamed protein product                                118   5e-28    
ref|XP_007225823.1|  hypothetical protein PRUPE_ppa011523mg             117   6e-28    
gb|KHF97444.1|  Dehydration-responsive RD22 -like protein               119   7e-28    
ref|XP_006384368.1|  hypothetical protein POPTR_0004s14410g             119   7e-28    
ref|XP_006388650.1|  hypothetical protein POPTR_0129s00200g             119   7e-28    
ref|XP_010911557.1|  PREDICTED: BURP domain-containing protein 6-...    118   7e-28    
ref|XP_006384370.1|  hypothetical protein POPTR_0004s14430g             119   8e-28    
ref|XP_007227727.1|  hypothetical protein PRUPE_ppa007469mg             119   8e-28    
ref|XP_002534535.1|  Dehydration-responsive protein RD22 precurso...    117   8e-28    
emb|CDM84063.1|  unnamed protein product                                120   9e-28    
ref|XP_008245114.1|  PREDICTED: BURP domain-containing protein 5-...    119   9e-28    
gb|AAQ22345.1|  BURP domain-containing protein                          119   1e-27    
ref|NP_001044161.1|  Os01g0733500                                       119   1e-27    
ref|XP_010648541.1|  PREDICTED: dehydration-responsive protein RD...    117   1e-27    
ref|XP_010999677.1|  PREDICTED: dehydration-responsive protein RD...    119   1e-27    
gb|KJB55405.1|  hypothetical protein B456_009G074500                    116   1e-27    
gb|KHG03003.1|  Dehydration-responsive RD22 -like protein               119   1e-27    
gb|KHN14854.1|  BURP domain-containing protein 3                        119   1e-27    
ref|XP_008219790.1|  PREDICTED: dehydration-responsive protein RD...    118   2e-27    
ref|XP_004230963.1|  PREDICTED: BURP domain-containing protein 5-...    117   2e-27    
ref|XP_002284434.1|  PREDICTED: dehydration-responsive protein RD...    118   2e-27    
ref|XP_010925838.1|  PREDICTED: BURP domain-containing protein 6-...    118   2e-27    
gb|KHG19017.1|  BURP domain-containing 17                               117   2e-27    
ref|XP_002522983.1|  polygalacturonase, putative                        117   2e-27    
gb|AFM91994.1|  RD-22 like protein                                      115   2e-27    
ref|XP_009400562.1|  PREDICTED: BURP domain-containing protein 3-...    118   2e-27    
ref|XP_003613159.1|  Polygalacturonase-1 non-catalytic beta subunit     112   2e-27    
gb|EAY75726.1|  hypothetical protein OsI_03637                          119   2e-27    
ref|XP_010925835.1|  PREDICTED: BURP domain-containing protein 6-...    118   2e-27    
ref|XP_008219789.1|  PREDICTED: dehydration-responsive protein RD...    118   2e-27    
ref|XP_009400564.1|  PREDICTED: BURP domain-containing protein 3-...    118   2e-27    
ref|XP_002281750.2|  PREDICTED: dehydration-responsive protein RD...    116   3e-27    
ref|XP_010648550.1|  PREDICTED: dehydration-responsive protein RD...    116   3e-27    
ref|XP_008219787.1|  PREDICTED: dehydration-responsive protein RD...    117   3e-27    
ref|XP_009400563.1|  PREDICTED: BURP domain-containing protein 3-...    117   3e-27    
ref|XP_006423241.1|  hypothetical protein CICLE_v10029064mg             116   3e-27    
gb|AGE46023.1|  dehydration-responsive protein RD22-like isoform 2      117   4e-27    
ref|XP_010106056.1|  hypothetical protein L484_021234                   117   4e-27    
gb|KDP45575.1|  hypothetical protein JCGZ_17182                         119   4e-27    
ref|XP_007227242.1|  hypothetical protein PRUPE_ppa018182mg             116   4e-27    
ref|XP_008219786.1|  PREDICTED: dehydration-responsive protein RD...    117   4e-27    



>ref|XP_009794726.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=628

 Score =   412 bits (1060),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGT+MPMPDIKD+MPKRSFLPRVIA+KLPFSTSKIG LK++FHAADDS +AKM+
Sbjct  415  REKMLKSGTVMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIGELKKIFHAADDSPVAKMI  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL+ECERAPS GETKRC+ S EDMIDFATSVLGRNVVVRTTENT+GS ++IMIGS+KG
Sbjct  475  GDALTECERAPSAGETKRCINSAEDMIDFATSVLGRNVVVRTTENTKGSKENIMIGSVKG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTSSW
Sbjct  535  INGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              THGAF+ALGSGPGKIEVCHWIFENDMTWA+AD
Sbjct  595  GPTHGAFVALGSGPGKIEVCHWIFENDMTWAIAD  628



>ref|XP_009596009.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=629

 Score =   409 bits (1050),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPRVIA+KLPFSTSKIG +K++FHA DDS +AKM+
Sbjct  416  REKMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIGEMKKIFHAGDDSPVAKMI  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL+ECERAPS GETKRC+ S EDMIDFATSVLGRNVVVRTTENT+GS ++I+IGS+KG
Sbjct  476  GDALTECERAPSAGETKRCINSAEDMIDFATSVLGRNVVVRTTENTKGSKENIIIGSVKG  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTSSW
Sbjct  536  INGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAF+ALGSGPGKIEVCHWIFENDMTWA+AD
Sbjct  596  GPSHGAFVALGSGPGKIEVCHWIFENDMTWAIAD  629



>gb|AHC69823.1| polygalacturonase isoenzyme 1 beta subunit [Nicotiana tabacum]
Length=628

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPRVIA+KLPFSTSKIG +K++FHA DDS +AKM+
Sbjct  415  REKMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIGEMKKIFHAGDDSPVAKMI  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL+ECERAPS GETKRC+ S EDMIDFATSVLGRNVVVRTTENT+GS ++I+IGS+KG
Sbjct  475  GDALTECERAPSAGETKRCINSAEDMIDFATSVLGRNVVVRTTENTKGSKENIIIGSVKG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTSSW
Sbjct  535  INGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAF+ALGSGPGKIEVCHWIFENDMTWA+AD
Sbjct  595  GPSHGAFVALGSGPGKIEVCHWIFENDMTWAIAD  628



>ref|XP_006365227.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=629

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPRVIA+KLPFSTSKI  LK++FHA DDS + KM+
Sbjct  416  REKMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIAELKKIFHAGDDSQVEKMI  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETK+CV S EDMIDFATSVLGRNVVVRTTENT+GS  +IMIGS+KG
Sbjct  476  GDALSECERAPSAGETKQCVNSAEDMIDFATSVLGRNVVVRTTENTKGSNGNIMIGSVKG  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQ+L+PYL+YYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTSSW
Sbjct  536  INGGKVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              THGAF+ALGSGPGKIEVCHWIFENDMTWA+AD
Sbjct  596  GPTHGAFVALGSGPGKIEVCHWIFENDMTWAIAD  629



>ref|XP_009596020.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=628

 Score =   404 bits (1038),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK+GTIMPMPDI+D+MPKRSFLPRVIASKLPFSTSKI  LK +FHA DDS M KM+
Sbjct  415  REKMLKTGTIMPMPDIRDKMPKRSFLPRVIASKLPFSTSKISDLKTIFHARDDSQMGKMM  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DAL+ECER+PS GETKRCV SVEDMIDF+TSVLGR+VVVRTTENT+GS  +IMIGS+KG
Sbjct  475  SDALTECERSPSAGETKRCVNSVEDMIDFSTSVLGRDVVVRTTENTKGSKGNIMIGSVKG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEAD+LDP SK+KINHG+AICH+DTSSW
Sbjct  535  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKAKINHGIAICHVDTSSW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAFIALGSGPGKIEVCHWIFENDMTWA+AD
Sbjct  595  GANHGAFIALGSGPGKIEVCHWIFENDMTWALAD  628



>ref|XP_009794727.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=625

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK+ TIMPMPDI+D+MPKRSFLPRVIASKLPFSTSKI  LK +FHA DD+ M KM+
Sbjct  412  REKMLKTETIMPMPDIQDKMPKRSFLPRVIASKLPFSTSKIRDLKTIFHAGDDTQMGKMM  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL+ECER+PS GETKRCV SVEDMIDF+TSVLGRNVVVRTTENT+GS  +IMIGS+KG
Sbjct  472  LDALTECERSPSAGETKRCVASVEDMIDFSTSVLGRNVVVRTTENTKGSKGNIMIGSVKG  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTSSW
Sbjct  532  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             ++HGAFIALGSGPGKIEVCHWIFENDMTWAVAD
Sbjct  592  GASHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  625



>ref|NP_001234835.1| polygalacturonase-1 non-catalytic subunit beta precursor [Solanum 
lycopersicum]
 sp|Q40161.1|GP1_SOLLC RecName: Full=Polygalacturonase-1 non-catalytic subunit beta; 
AltName: Full=AroGP1; AltName: Full=Polygalacturonase converter; 
Short=PG converter; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34181.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
 gb|AAB39547.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
Length=630

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPRVIASKLPFSTSKI  LK++FHA D+S + KM+
Sbjct  417  REKMLKSGTIMPMPDIKDKMPKRSFLPRVIASKLPFSTSKIAELKKIFHAGDESQVEKMI  476

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETKRCV S EDMIDFATSVLGRNVVVRTTE+T+GS  +IMIGS+KG
Sbjct  477  GDALSECERAPSAGETKRCVNSAEDMIDFATSVLGRNVVVRTTEDTKGSNGNIMIGSVKG  536

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQ+L+PYL+YYCHSVPKVRVYEAD+LDP SK KINHGVAICH+DTSSW
Sbjct  537  INGGKVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADILDPNSKVKINHGVAICHVDTSSW  596

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAF+ALGSGPGKIEVCHWIFENDMTWA+AD
Sbjct  597  GPSHGAFVALGSGPGKIEVCHWIFENDMTWAIAD  630



>ref|XP_006365231.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase non-catalytic 
subunit AroGP3-like [Solanum tuberosum]
Length=628

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPRVIASKLPFSTSKI  LK++FHAA+DS +AKM+
Sbjct  415  REKMLKSGTIMPMPDIKDKMPKRSFLPRVIASKLPFSTSKIDELKKIFHAANDSQVAKMI  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETKRC  S EDMIDFATSVLG NVVVRTTENT+GS  +IMIG++KG
Sbjct  475  GDALSECERAPSAGETKRCANSAEDMIDFATSVLGGNVVVRTTENTKGSKGNIMIGAVKG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQ+LFPYL+YYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTS W
Sbjct  535  INGGKVTKSVSCHQTLFPYLLYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSLW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAFIALGSGPGKIEVCHWIFENDMTWA AD
Sbjct  595  GPKHGAFIALGSGPGKIEVCHWIFENDMTWATAD  628



>ref|XP_004238668.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2 [Solanum 
lycopersicum]
 sp|P93217.1|GP2_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP2; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39556.1| AROGP2 [Solanum lycopersicum]
Length=629

 Score =   398 bits (1023),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPR IA+KLPFSTSKI  LK++FHAA+DS +AKM+
Sbjct  416  REKMLKSGTIMPMPDIKDKMPKRSFLPRAIAAKLPFSTSKIDELKKIFHAANDSQVAKMI  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETK+CV S EDMIDFATSVLGRNVVVRTTENT GS  +IMIGSIKG
Sbjct  476  GDALSECERAPSPGETKQCVNSAEDMIDFATSVLGRNVVVRTTENTNGSKGNIMIGSIKG  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQ+L+P L+YYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTSSW
Sbjct  536  INGGKVTKSVSCHQTLYPSLLYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAFIALGSGPGKIEVCHWIFENDMTWA AD
Sbjct  596  GPRHGAFIALGSGPGKIEVCHWIFENDMTWATAD  629



>ref|XP_006365229.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=611

 Score =   396 bits (1018),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPRVIA+KLPFSTSKI  LK++FHAA+DS +AK++
Sbjct  398  REKMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIDELKKIFHAANDSQVAKII  457

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETKRC  S EDMIDFATSVLGRNVVVRTTENT+GS  +IMIG++KG
Sbjct  458  GDALSECERAPSAGETKRCAKSAEDMIDFATSVLGRNVVVRTTENTKGSNGNIMIGAVKG  517

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQ+LFPYL+YYCHSVPKVRVYEAD+LDP SK+ INHGVAICH+DTS W
Sbjct  518  INGGKVTKSVSCHQTLFPYLLYYCHSVPKVRVYEADILDPNSKANINHGVAICHVDTSLW  577

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAFIALGSGPGKIEVCHWIFENDMTWA AD
Sbjct  578  GPKHGAFIALGSGPGKIEVCHWIFENDMTWATAD  611



>ref|XP_006365226.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=625

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK GTIMPMPDI+D+MPKRSFLPRVIASKLPFSTSKIG LK++FHA +DS M KM+
Sbjct  412  REKMLKIGTIMPMPDIQDKMPKRSFLPRVIASKLPFSTSKIGNLKKIFHAGNDSQMGKMI  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECER+PS GETKRCV+S+EDMIDF+TSVLG+N++VRTTEN +GS  DI+IGS+KG
Sbjct  472  DDALVECERSPSAGETKRCVSSIEDMIDFSTSVLGQNIIVRTTENIKGSKGDILIGSVKG  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKS+SCHQSLFPYLVYYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTS+W
Sbjct  532  INGGKVTKSISCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSTW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAF+ALGSGPGKIEVCHWIFENDMTW +AD
Sbjct  592  GANHGAFMALGSGPGKIEVCHWIFENDMTWTIAD  625



>ref|XP_004238667.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP3 [Solanum 
lycopersicum]
 sp|P93218.1|GP3_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP3; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39557.1| AROGP3 [Solanum lycopersicum]
Length=632

 Score =   397 bits (1019),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPR IA+KLPFSTSKI  LK++FHAA+DS +AKM+
Sbjct  419  REKMLKSGTIMPMPDIKDKMPKRSFLPRAIAAKLPFSTSKIDELKKIFHAANDSQVAKMI  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETK+CV S EDMIDFATSVLGRNVVVRTTENT GS  +IMIGSIKG
Sbjct  479  GDALSECERAPSPGETKQCVNSAEDMIDFATSVLGRNVVVRTTENTNGSKGNIMIGSIKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQ+L+P L+YYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTSSW
Sbjct  539  INGGKVTKSVSCHQTLYPSLLYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSW  598

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALGSGPGKIEVCHWIFENDMTWA AD
Sbjct  599  GPRHGAFVALGSGPGKIEVCHWIFENDMTWATAD  632



>emb|CAN67205.1| hypothetical protein VITISV_037214 [Vitis vinifera]
Length=235

 Score =   378 bits (970),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MPKRSFLPR I+SKLPFSTSK+  +K++FHAAD+S+M  M 
Sbjct  22   RESMLKKGTVMPMPDIRDKMPKRSFLPRTISSKLPFSTSKLEEMKKIFHAADNSSMEHMF  81

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL +CERAPS+GETKRCV S+EDMIDFAT+VLGRNVVVRTT++ EGS +++MIGS+KG
Sbjct  82   TEALDDCERAPSKGETKRCVPSIEDMIDFATTVLGRNVVVRTTQSVEGSKQNVMIGSVKG  141

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK+K+ +NHGVAICH+DTS W
Sbjct  142  INGGQVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKANVNHGVAICHLDTSDW  201

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+ HGAF+ALGSGPG+IEVCHWIFENDMTW +AD
Sbjct  202  SAGHGAFVALGSGPGRIEVCHWIFENDMTWTIAD  235



>ref|XP_006365230.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=627

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPRVIA+KLPFSTSKIG LK++FHAA+D  +AKM+
Sbjct  414  REKMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIGELKKIFHAANDFQVAKMI  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETKRC  S EDMIDFA SVLG+NVVVRTTENT+GS  +IMIGS+KG
Sbjct  474  GDALSECERAPSAGETKRCANSAEDMIDFAISVLGQNVVVRTTENTKGSNGNIMIGSVKG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQ+L+P L+YYCHSVPKVRVYE D+LDP SK+KINHG+AICH+DTS W
Sbjct  534  INGGKVTKSVSCHQTLYPSLLYYCHSVPKVRVYEVDILDPNSKAKINHGIAICHVDTSLW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF ALGSGPGKIEVCHWIFENDMTWA+AD
Sbjct  594  GPKHGAFNALGSGPGKIEVCHWIFENDMTWAIAD  627



>ref|XP_009363553.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009363554.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X3 [Pyrus x bretschneideri]
Length=632

 Score =   388 bits (997),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMPDI+D+MPKRSFLPR I SKLPF+TSKI ALKQ+FHAAD+STM K++
Sbjct  419  RESMLKKGVVMPMPDIQDKMPKRSFLPRTILSKLPFATSKIAALKQIFHAADNSTMEKII  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFAT++LGRN+VVR+TEN  G+  D+MIGS+KG
Sbjct  479  VDALQECERAPSAGETKRCVGSAEDMIDFATTILGRNIVVRSTENVNGAKHDVMIGSVKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP SK+K+NHGVAICH+DTS+W
Sbjct  539  INGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPVSKAKVNHGVAICHLDTSAW  598

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THG+F+ALGSGPG+IEVCHWIF+NDMTW +AD
Sbjct  599  SPTHGSFLALGSGPGRIEVCHWIFQNDMTWTIAD  632



>ref|XP_007223063.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
 gb|EMJ24262.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
Length=554

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMPDI+D+MPKRSFLPR I+SKLPF+TSK+  LKQ+FHA D+STM K++
Sbjct  341  RESMLKKGVVMPMPDIQDKMPKRSFLPRTISSKLPFATSKMAELKQIFHADDNSTMEKII  400

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFAT+VLGRNVVVR+TEN  G+  ++MIGS+KG
Sbjct  401  LDALQECERAPSAGETKRCVGSAEDMIDFATTVLGRNVVVRSTENVNGAKHNVMIGSVKG  460

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTS+W
Sbjct  461  INGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPLSKAKINHGVAICHLDTSAW  520

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THG+F+ALGSGPG+IEVCHWIF+NDMTWA+AD
Sbjct  521  SPTHGSFMALGSGPGQIEVCHWIFQNDMTWAIAD  554



>ref|XP_006365228.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=632

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/214 (81%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLKSGTIMPMPDIKD+MPKRSFLPR IA+KLPFS SKI  L ++FHAA+DS +AKM+
Sbjct  419  REKMLKSGTIMPMPDIKDKMPKRSFLPRTIAAKLPFSYSKIDELNKIFHAANDSQVAKMI  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +ALSECERAPS GE K+CV S EDMIDF TSVLGRNVVVRTTENT+GS  +IMIGS+KG
Sbjct  479  GNALSECERAPSAGEMKQCVNSAEDMIDFTTSVLGRNVVVRTTENTKGSNGNIMIGSVKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQ+L+P L+YYCHSVPKVRVY+AD+LDP SK+KINHGVAICH+DTSSW
Sbjct  539  INGGKVTKSVSCHQTLYPSLLYYCHSVPKVRVYQADILDPNSKAKINHGVAICHVDTSSW  598

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAFIALGSGPGKIEVCHWIFENDMTW  AD
Sbjct  599  GPSHGAFIALGSGPGKIEVCHWIFENDMTWTTAD  632



>ref|XP_008221810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=632

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMPDI+D+MPKRSFLPR I+SKLPF+TSKI  LKQ+FHA D+STM K++
Sbjct  419  RESMLKKGVVMPMPDIQDKMPKRSFLPRAISSKLPFATSKIAELKQIFHADDNSTMEKII  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFAT+VLGRNVVVR+TEN  G+  ++MIGS+KG
Sbjct  479  LDALQECERAPSAGETKRCVGSAEDMIDFATTVLGRNVVVRSTENVNGAKHNVMIGSVKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTS+W
Sbjct  539  INGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPLSKAKINHGVAICHLDTSAW  598

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THG+F+ALGSGPG+IEVCHWIF+NDMTWA+AD
Sbjct  599  SPTHGSFMALGSGPGRIEVCHWIFQNDMTWAIAD  632



>ref|XP_008340027.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=636

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMPDI+D+ PKRSFLPR I SKLPF+TSKI ALKQ+FHAAD+STM K++
Sbjct  423  RESMLKKGVVMPMPDIQDKTPKRSFLPRTILSKLPFATSKIAALKQIFHAADNSTMEKII  482

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFAT+VLGRNVVVR+TEN  G+  D+MIGS+KG
Sbjct  483  VDALQECERAPSAGETKRCVGSAEDMIDFATTVLGRNVVVRSTENVNGAKHDVMIGSVKG  542

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQS+FPYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTS+W
Sbjct  543  INGGKVTQSVSCHQSMFPYLLYYCHSVPKVRVYEADLLDPVSKAKINHGVAICHLDTSAW  602

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THG+F+ALGSGPG+IEVCHWIF+NDMTW +AD
Sbjct  603  SPTHGSFMALGSGPGRIEVCHWIFQNDMTWTIAD  636



>emb|CAN66340.1| hypothetical protein VITISV_018557 [Vitis vinifera]
Length=226

 Score =   373 bits (957),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MPKRSFLPR I+SKLPFSTSK+  +K++FHAA++S+M  M 
Sbjct  13   RESMLKKGTVMPMPDIRDKMPKRSFLPRSISSKLPFSTSKLEEMKKIFHAABNSSMEHMF  72

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL +CERAPS+GETKRCV S+EDMIDFAT+VLGRNVVVRTT++ EGS +++MIGS+KG
Sbjct  73   TEALDDCERAPSKGETKRCVPSIEDMIDFATTVLGRNVVVRTTQSVEGSKQNVMIGSVKG  132

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSLFPYL+YYCH VPKVRVYEADLLDPK+K+ INHGVAICH+DTS W
Sbjct  133  INGGQVTKSVSCHQSLFPYLLYYCHXVPKVRVYEADLLDPKTKANINHGVAICHLDTSDW  192

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+ HGAF+ALGSGPG+IEVCHWIFENDMTW + D
Sbjct  193  SAGHGAFVALGSGPGRIEVCHWIFENDMTWTIVD  226



>ref|XP_011086565.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=634

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK+ TIMPMPDI+D+MPKRSFLPRVI SKLPFSTSK+G LK+LFH  D+S+M  M+
Sbjct  421  RESMLKTDTIMPMPDIRDKMPKRSFLPRVIVSKLPFSTSKLGDLKKLFHTEDNSSMTSMI  480

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECER PS GETKRCV S+EDMIDFATSVLGRNV VR+TE T+GS   IM+G +KG
Sbjct  481  TDALGECERVPSPGETKRCVASIEDMIDFATSVLGRNVAVRSTETTKGSNGKIMLGQVKG  540

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LDPKSK+KINHGVAICH+DTSSW
Sbjct  541  INGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPKSKAKINHGVAICHLDTSSW  600

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFIALGSGPGKIEVCHWIFENDMTW +AD
Sbjct  601  SPGHGAFIALGSGPGKIEVCHWIFENDMTWTIAD  634



>ref|XP_011071083.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=628

 Score =   385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+MLKSG++MPMPDI+D+MPKRSFLPR I +KLPFSTSKI  LK +FHA +DS+M  ML
Sbjct  415  REEMLKSGSVMPMPDIRDKMPKRSFLPRAIVTKLPFSTSKIDELKNIFHAENDSSMTSML  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             ++L+ECERAPS GETKRCV S+EDMIDFATSVLGRNV VRTTENT+GS  +I IG +KG
Sbjct  475  VNSLNECERAPSPGETKRCVASIEDMIDFATSVLGRNVAVRTTENTQGSNGNITIGQVKG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSLFPYLVYYCHSVPKVRVYEAD+LD +SK++INHGVAICH+DTSSW
Sbjct  535  INGGNVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDAESKARINHGVAICHLDTSSW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFIALGSGPGKIEVCHWIFENDMTW VAD
Sbjct  595  SPGHGAFIALGSGPGKIEVCHWIFENDMTWTVAD  628



>ref|XP_008389645.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=632

 Score =   385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMPDI+D+MPKRSFLPR I SKLPF+TSKI  LKQ+FHAAD+S+M K++
Sbjct  419  RESMLKKGVVMPMPDIQDKMPKRSFLPRTILSKLPFATSKIATLKQIFHAADNSSMEKII  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFAT++LGRNVVVR+TEN  G+  D+M+GS+KG
Sbjct  479  VDALQECERAPSAGETKRCVGSAEDMIDFATTILGRNVVVRSTENVNGAKHDVMVGSVKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTS+W
Sbjct  539  INGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPVSKAKINHGVAICHLDTSAW  598

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THG+F+ALGSGPG+IEVCHWIF+NDMTW +AD
Sbjct  599  SPTHGSFLALGSGPGRIEVCHWIFQNDMTWTIAD  632



>ref|XP_004238669.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum lycopersicum]
Length=622

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK GTIMPMPDI+D+MPKRSFLPRVI+SKLPFSTSKIG LK++FHA +DS M KM+
Sbjct  409  REKMLKIGTIMPMPDIQDKMPKRSFLPRVISSKLPFSTSKIGDLKKIFHAGNDSQMEKMI  468

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECER+PS GETK+CV+S+EDMIDF+TSVLG+NVV+RTTEN +GS  DI+IGS+K 
Sbjct  469  DDALLECERSPSTGETKKCVSSIEDMIDFSTSVLGQNVVLRTTENIKGSKGDILIGSVKR  528

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
             N GKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEAD+LDP SK+KINHGVAICH+DTS+W
Sbjct  529  TNDGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSAW  588

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAF ALGSGPGKIEVCHWIFENDM WAVAD
Sbjct  589  GANHGAFTALGSGPGKIEVCHWIFENDMNWAVAD  622



>ref|XP_010100469.1| hypothetical protein L484_027781 [Morus notabilis]
 gb|EXB82603.1| hypothetical protein L484_027781 [Morus notabilis]
Length=608

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK G +MPMPDIKD+MP+RSFLPRVI SKLPFSTSK   LK++FHAAD+STM K++
Sbjct  395  RESKLKKGVVMPMPDIKDKMPERSFLPRVITSKLPFSTSKASDLKKIFHAADNSTMEKII  454

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D L+ECERAPSRGETKRCV+SVEDMIDFATSVLGRNVV RTTE+  GS K+IMIGS+KG
Sbjct  455  VDTLAECERAPSRGETKRCVSSVEDMIDFATSVLGRNVVARTTESVSGSKKNIMIGSVKG  514

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYLVYYCHSVPKVRVY AD+LDP SK+KINHGVAICH+DTS+W
Sbjct  515  INGGKVTQSVSCHQSLFPYLVYYCHSVPKVRVYTADILDPNSKAKINHGVAICHLDTSAW  574

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGS PG+IEVCHWIFEND+TW+V+D
Sbjct  575  SPTHGAFLALGSKPGRIEVCHWIFENDLTWSVSD  608



>ref|XP_008221868.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=619

 Score =   384 bits (985),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMP+I+D+MPKRSFLPR I+SKLPF+TSKI  LK++F A D+STM K++
Sbjct  406  RESMLKKGIVMPMPNIQDKMPKRSFLPRFISSKLPFATSKIYELKRIFQAPDNSTMEKIM  465

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFATSVLG NVVVRTT+N  GS+ D++IGS+KG
Sbjct  466  VDALEECERAPSAGETKRCVASAEDMIDFATSVLGTNVVVRTTDNVNGSSDDVLIGSVKG  525

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTS+W
Sbjct  526  INGGNVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPISKAKINHGVAICHLDTSAW  585

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIF+NDMTWAVAD
Sbjct  586  SPTHGAFVALGSGPGRIEVCHWIFQNDMTWAVAD  619



>ref|XP_002266341.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Vitis vinifera]
Length=633

 Score =   384 bits (986),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MPKRSFLPR I+SK PFSTSK+  +K++FHAAD+S+M  M 
Sbjct  420  RESMLKKGTVMPMPDIRDKMPKRSFLPRTISSKFPFSTSKLEEMKKIFHAADNSSMEHMF  479

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL +CERAPS+GETKRCV S+EDMIDFAT+VLGRNVVVRTT++ EGS +++MIGS+KG
Sbjct  480  TEALDDCERAPSKGETKRCVPSIEDMIDFATTVLGRNVVVRTTQSVEGSKQNLMIGSVKG  539

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK+K+ +NHGVAICH+DTS W
Sbjct  540  INGGQVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKANVNHGVAICHLDTSDW  599

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+ HGAF+ALGSGPG+IEVCHWIFENDMTW +AD
Sbjct  600  SAGHGAFVALGSGPGRIEVCHWIFENDMTWTIAD  633



>gb|EYU31262.1| hypothetical protein MIMGU_mgv1a002697mg [Erythranthe guttata]
Length=646

 Score =   384 bits (986),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 194/216 (90%), Gaps = 2/216 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADD--STMAK  595
            RE MLK+GT+MPMPDI+D+MPKRSFLPR I SKLPFSTSK+  +K++FHA DD  STMAK
Sbjct  431  REAMLKTGTVMPMPDIRDKMPKRSFLPRTIVSKLPFSTSKLAEMKKIFHAGDDADSTMAK  490

Query  594  MLADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSI  415
            ML DAL ECERAPS GETKRCV S+EDMIDFAT+VLGRNVVVRTT NT G   DI++G +
Sbjct  491  MLTDALHECERAPSPGETKRCVASIEDMIDFATTVLGRNVVVRTTANTAGHGGDILLGEV  550

Query  414  KGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTS  235
            KG+NGGKVT+SVSCHQSL+PYL+YYCHSVPKVRVYEAD+LDP +K+KINHGVAICH+DTS
Sbjct  551  KGVNGGKVTRSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNTKTKINHGVAICHLDTS  610

Query  234  SWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SWS  HG+F+ LGSGPGKIEVCHWIFENDMTWAVAD
Sbjct  611  SWSPGHGSFVLLGSGPGKIEVCHWIFENDMTWAVAD  646



>gb|KDP26581.1| hypothetical protein JCGZ_17739 [Jatropha curcas]
Length=629

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK G +MPMPDI+D+MPKRSFLPR I SKLPFSTSKI  LK+ FHA D+STM  ++
Sbjct  416  RESELKKGNVMPMPDIRDKMPKRSFLPRSIISKLPFSTSKISQLKETFHAIDNSTMESII  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETKRCV S EDMIDFATSVLGRNV  RTTEN  GS + IMIGSIKG
Sbjct  476  LDALSECERAPSPGETKRCVGSAEDMIDFATSVLGRNVAARTTENVNGSKQKIMIGSIKG  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTSSW
Sbjct  536  INGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPNSKAKINHGVAICHLDTSSW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFEND+TW++AD
Sbjct  596  SPTHGAFLALGSGPGRIEVCHWIFENDLTWSIAD  629



>ref|XP_004298578.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Fragaria vesca subsp. vesca]
Length=624

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MP PDIKD+MP+RSFLPR I+SKLPF+T+K+  LK++FHA D+STM K++
Sbjct  411  RESMLKKGTVMPFPDIKDKMPERSFLPRTISSKLPFATAKLSELKRIFHAEDNSTMEKII  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS+GETKRCV S EDMIDFATSVLGRNVVVRTT+N  G+  DI++GS+KG
Sbjct  471  TDALQECERAPSKGETKRCVASAEDMIDFATSVLGRNVVVRTTDNVSGAKGDIVVGSVKG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTS+W
Sbjct  531  INGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPTSKAKINHGVAICHLDTSAW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THG+F ALGSGPG+IEVCHWIF+ND+TW +AD
Sbjct  591  SPTHGSFAALGSGPGRIEVCHWIFQNDLTWTIAD  624



>gb|KJB31246.1| hypothetical protein B456_005G182600 [Gossypium raimondii]
Length=611

 Score =   380 bits (976),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REK+LK GT+MPMPDIKD+MP RSFLPR I SKLPFS+SKIG LK++FHA D+ST+  ++
Sbjct  397  REKLLKQGTVMPMPDIKDKMPVRSFLPRTIVSKLPFSSSKIGELKRIFHAGDNSTLETVM  456

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFA SVLGRNV VRTTEN +GS ++I IGS+KG
Sbjct  457  LDALKECERAPSPGETKRCVGSAEDMIDFAASVLGRNVEVRTTENVKGSKQNIKIGSVKG  516

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+LDPKS  KINHGVAICH+DTSSW
Sbjct  517  INGGKVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILDPKSLEKINHGVAICHLDTSSW  576

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SS HGAF+ALGSGPG+IEVCHWIFENDMTW ++D
Sbjct  577  SSNHGAFLALGSGPGRIEVCHWIFENDMTWTISD  610



>ref|XP_002266815.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=624

 Score =   380 bits (977),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MPKRSFLPR I+SKLPFSTSK+  +K++FHAAD+S+M  M 
Sbjct  411  RESMLKKGTVMPMPDIRDKMPKRSFLPRSISSKLPFSTSKLEEMKKIFHAADNSSMEHMF  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL +CERAPS+GET+RCV S+EDMIDFAT+VLGRNVVVRTT++ EGS +++MIGS+KG
Sbjct  471  TEALDDCERAPSKGETRRCVPSIEDMIDFATTVLGRNVVVRTTQSVEGSKQNVMIGSVKG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSLFPYL+YYCH VPKVRVYEADLLDPK+K+ INHGVAICH+DTS W
Sbjct  531  INGGQVTKSVSCHQSLFPYLLYYCHFVPKVRVYEADLLDPKTKANINHGVAICHLDTSDW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+ HGAF+ALGSGPG+IEVCHWIFENDMTW + D
Sbjct  591  SAGHGAFVALGSGPGRIEVCHWIFENDMTWTIVD  624



>gb|KHG24447.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=628

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REK+LK GT+MPMPDIKD+MP RSFLPR I SKLPFS+SK G LK++FHA D+ST+  ++
Sbjct  414  REKLLKQGTVMPMPDIKDKMPVRSFLPRTIVSKLPFSSSKFGELKRIFHAGDNSTLETVM  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFATSVLGRNV VRTTEN +GS ++I IGS+KG
Sbjct  474  LDALKECERAPSPGETKRCVGSAEDMIDFATSVLGRNVEVRTTENVKGSKQNIKIGSVKG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+LDPKS  KINHGVAICH+DTSSW
Sbjct  534  INGGKVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILDPKSLEKINHGVAICHLDTSSW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SS HGAF+ALGSGPG+IEVCHWIFENDMTW ++D
Sbjct  594  SSNHGAFLALGSGPGRIEVCHWIFENDMTWTISD  627



>gb|KJB31245.1| hypothetical protein B456_005G182600 [Gossypium raimondii]
Length=628

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REK+LK GT+MPMPDIKD+MP RSFLPR I SKLPFS+SKIG LK++FHA D+ST+  ++
Sbjct  414  REKLLKQGTVMPMPDIKDKMPVRSFLPRTIVSKLPFSSSKIGELKRIFHAGDNSTLETVM  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFA SVLGRNV VRTTEN +GS ++I IGS+KG
Sbjct  474  LDALKECERAPSPGETKRCVGSAEDMIDFAASVLGRNVEVRTTENVKGSKQNIKIGSVKG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+LDPKS  KINHGVAICH+DTSSW
Sbjct  534  INGGKVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILDPKSLEKINHGVAICHLDTSSW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SS HGAF+ALGSGPG+IEVCHWIFENDMTW ++D
Sbjct  594  SSNHGAFLALGSGPGRIEVCHWIFENDMTWTISD  627



>gb|KDO82432.1| hypothetical protein CISIN_1g044596mg [Citrus sinensis]
Length=644

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK+GT+MPMPDI+D+MP+RSFLPR I SKLPFS+S +  LK++FHA+++S+M  ++
Sbjct  428  RESMLKTGTVMPMPDIRDKMPQRSFLPRAIVSKLPFSSSNVNVLKEIFHASENSSMESII  487

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECER PS+GETKRC+ S EDMIDFATSVLG +V +RTT+N +GS ++IMIGS+KG
Sbjct  488  KDALSECERQPSKGETKRCIGSAEDMIDFATSVLGNSVTLRTTQNVQGSKQNIMIGSVKG  547

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK+K+KINHGVAICHIDTS+W
Sbjct  548  INGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKAKINHGVAICHIDTSAW  607

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFEND+TW + D
Sbjct  608  SQTHGAFLALGSGPGRIEVCHWIFENDLTWTIVD  641



>ref|XP_007224206.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
 gb|EMJ25405.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
Length=620

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMP+I+D+MPKRSFLP+ I+SKLPF+TSKI  LK++F A D+STM K++
Sbjct  406  RESMLKKGIVMPMPNIQDKMPKRSFLPQFISSKLPFATSKIYELKRIFQAPDNSTMEKIM  465

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFATSVLG NVVVRTT+N  GS+ +++IGS+KG
Sbjct  466  LDALEECERAPSAGETKRCVASAEDMIDFATSVLGTNVVVRTTDNVNGSSHEVLIGSVKG  525

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTS+W
Sbjct  526  INGGNVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPISKAKINHGVAICHLDTSAW  585

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIF+NDMTWAVAD
Sbjct  586  SPTHGAFVALGSGPGRIEVCHWIFQNDMTWAVAD  619



>gb|KCW86731.1| hypothetical protein EUGRSUZ_B03343 [Eucalyptus grandis]
Length=610

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MP+RSFLPR IASKLPFS++K+  LKQ+FHA  +STM K++
Sbjct  397  RESMLKMGTVMPMPDIRDKMPRRSFLPRSIASKLPFSSTKVDELKQIFHAGQNSTMEKIM  456

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            ADAL+ECERAPSRGE+K+CV+S+EDMIDFATS+LGRN+ VR+TE+ EGS + I+IG +KG
Sbjct  457  ADALAECERAPSRGESKQCVSSIEDMIDFATSILGRNMAVRSTESIEGSNRKILIGQVKG  516

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK ++KINHGVAICH+DTS+W
Sbjct  517  INGGEVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKLRTKINHGVAICHLDTSAW  576

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S++HGAF+ LGS PG IEVCHWIFENDMTW VAD
Sbjct  577  SASHGAFLTLGSSPGHIEVCHWIFENDMTWTVAD  610



>ref|XP_002311777.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
 gb|EEE89144.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
Length=633

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G++MPMPDI+D+MPKRSFLPR I SKLPFSTSKI  LK++FHA+D+S+M +++
Sbjct  419  RESMLKKGSVMPMPDIRDKMPKRSFLPRSIISKLPFSTSKIDQLKEIFHASDNSSMERII  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECER+PS GETKRC  S EDMIDFATSVLGRNV VRTT+N  GS K+IMIGSIKG
Sbjct  479  LDALEECERSPSPGETKRCAGSAEDMIDFATSVLGRNVAVRTTDNVNGSKKNIMIGSIKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VT+SVSCHQ+L+PYL+YYCHSVPKVRVYEADLLDP SK+ INHGVAICH+DTSSW
Sbjct  539  INGGRVTRSVSCHQTLYPYLLYYCHSVPKVRVYEADLLDPNSKATINHGVAICHLDTSSW  598

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFENDMTW +A+
Sbjct  599  SPTHGAFLALGSGPGRIEVCHWIFENDMTWTIAE  632



>ref|XP_010044636.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=621

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MP+RSFLPR IASKLPFS++K+  LKQ+FHA  +STM K++
Sbjct  408  RESMLKMGTVMPMPDIRDKMPRRSFLPRSIASKLPFSSTKVDELKQIFHAGQNSTMEKIM  467

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            ADAL+ECERAPSRGE+K+CV+S+EDMIDFATS+LGRN+ VR+TE+ EGS + I+IG +KG
Sbjct  468  ADALAECERAPSRGESKQCVSSIEDMIDFATSILGRNMAVRSTESIEGSNRKILIGQVKG  527

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK ++KINHGVAICH+DTS+W
Sbjct  528  INGGEVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKLRTKINHGVAICHLDTSAW  587

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S++HGAF+ LGS PG IEVCHWIFENDMTW VAD
Sbjct  588  SASHGAFLTLGSSPGHIEVCHWIFENDMTWTVAD  621



>ref|XP_009363551.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Pyrus x bretschneideri]
Length=646

 Score =   379 bits (972),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 195/228 (86%), Gaps = 14/228 (6%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMPDI+D+MPKRSFLPR I SKLPF+TSKI ALKQ+FHAAD+STM K++
Sbjct  419  RESMLKKGVVMPMPDIQDKMPKRSFLPRTILSKLPFATSKIAALKQIFHAADNSTMEKII  478

Query  588  ADALSE--------------CERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENT  451
             DAL E              CERAPS GETKRCV S EDMIDFAT++LGRN+VVR+TEN 
Sbjct  479  VDALQEXXXXXXXXXXXXXXCERAPSAGETKRCVGSAEDMIDFATTILGRNIVVRSTENV  538

Query  450  EGSTKDIMIGSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKI  271
             G+  D+MIGS+KGINGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP SK+K+
Sbjct  539  NGAKHDVMIGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPVSKAKV  598

Query  270  NHGVAICHIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            NHGVAICH+DTS+WS THG+F+ALGSGPG+IEVCHWIF+NDMTW +AD
Sbjct  599  NHGVAICHLDTSAWSPTHGSFLALGSGPGRIEVCHWIFQNDMTWTIAD  646



>ref|XP_006483847.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
Length=644

 Score =   379 bits (972),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK+GT+MPMPDI+D+MP+RSFLPR I SKLPFS+S +  LK++FHA+++S+M  ++
Sbjct  428  RESMLKTGTVMPMPDIRDKMPQRSFLPRAIVSKLPFSSSNVNVLKEIFHASENSSMESII  487

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECER PS+GETKRC+ S EDMIDFATSVLG +V +RTT+N +GS ++IMIGS+KG
Sbjct  488  KDALSECERPPSKGETKRCIDSAEDMIDFATSVLGNSVTLRTTQNVQGSKQNIMIGSVKG  547

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK+K+KINHGVAICHIDTS+W
Sbjct  548  INGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKAKINHGVAICHIDTSAW  607

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFEND+TW + D
Sbjct  608  SQTHGAFLALGSGPGRIEVCHWIFENDLTWTIVD  641



>ref|XP_006438392.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
 gb|ESR51632.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
Length=644

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK+GT+MPMPDI+D+MP+RSFLPR I SK PFS+S +  LK++FHA+++S+M  ++
Sbjct  428  RESMLKTGTVMPMPDIRDKMPQRSFLPRAIVSKFPFSSSNVNVLKEIFHASENSSMESII  487

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECER PS+GETKRC+ S EDMIDFATSVLG +V +RTT+N +GS ++IMIGS+KG
Sbjct  488  KDALSECERPPSKGETKRCIGSAEDMIDFATSVLGNSVTLRTTQNVQGSKQNIMIGSVKG  547

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK+K+KINHGVAICHIDTS+W
Sbjct  548  INGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKAKINHGVAICHIDTSAW  607

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFEND+TW + D
Sbjct  608  SQTHGAFLALGSGPGRIEVCHWIFENDLTWTIVD  641



>ref|XP_010242994.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=641

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MP RSFLPR I SKLPFS+S+I  LKQ+FHA ++STM  +L
Sbjct  425  REAMLKEGTVMPMPDIRDKMPPRSFLPRSITSKLPFSSSRISELKQIFHATENSTMEXIL  484

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + L ECERAPSRGETK+CV S+EDMIDFA SVLG NVVVRTTE+ EGS +++MIG++KG
Sbjct  485  RNTLEECERAPSRGETKKCVGSIEDMIDFAVSVLGHNVVVRTTESVEGSKQNVMIGAVKG  544

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+TKSVSCHQSLFP+LVYYCH+VPKVRVYEAD+L+PKSK+KINHGVAICH+DTS+W
Sbjct  545  INGGKITKSVSCHQSLFPFLVYYCHAVPKVRVYEADILEPKSKAKINHGVAICHVDTSAW  604

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGS PGKIEVCHWIFENDMTWAVAD
Sbjct  605  SPGHGAFVALGSSPGKIEVCHWIFENDMTWAVAD  638



>gb|KHN27021.1| Putative polygalacturonase non-catalytic subunit [Glycine soja]
Length=340

 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MPKRSFLPR I +KLPFS++K+  LK++F  +++S+M KM+
Sbjct  127  RETMLKEGTVMPMPDIRDKMPKRSFLPRAILTKLPFSSAKVDELKRVFKVSENSSMDKMI  186

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L ECER PS GETKRCV SVEDMIDF+TSVLGRNV V TTEN +GS K++M+G +KG
Sbjct  187  MDSLGECEREPSVGETKRCVGSVEDMIDFSTSVLGRNVAVWTTENVKGSNKNVMVGRVKG  246

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP+SK+KINHGVAICH+DT++W
Sbjct  247  MNGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKAKINHGVAICHLDTTAW  306

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFEND+TW +AD
Sbjct  307  SPTHGAFLALGSGPGRIEVCHWIFENDLTWTIAD  340



>ref|XP_007044636.1| Polygalacturonase 2 [Theobroma cacao]
 gb|EOY00468.1| Polygalacturonase 2 [Theobroma cacao]
Length=682

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK GT++PMPDI+D+MP+RSFLPR I SKLPFS+SKIG LK++FHA D+ST+  ++
Sbjct  468  REKMLKRGTVLPMPDIRDKMPERSFLPRTIVSKLPFSSSKIGELKRIFHAGDNSTLETVM  527

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFATSVLGRNV VRTTEN +GS ++I IG+++G
Sbjct  528  LDALKECERAPSAGETKRCVGSAEDMIDFATSVLGRNVEVRTTENVKGSKQNIKIGTVRG  587

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            IN GKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LDP S+ KINHGVAICH+DTS+W
Sbjct  588  INSGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNSREKINHGVAICHLDTSAW  647

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SS HGAF+ALGSGPG+IEVCHWIFENDMTW +AD
Sbjct  648  SSGHGAFLALGSGPGRIEVCHWIFENDMTWTIAD  681



>ref|XP_002525383.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF37021.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=631

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT+MPMPDI+D+MPKRSFLPR I SKLPFSTS    LKQ FHA D+STM  ++
Sbjct  418  RESKLKKGTVMPMPDIRDKMPKRSFLPRSITSKLPFSTSNFAQLKQTFHAFDNSTMETLM  477

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL+ECERAPS GETKRC+ S ED+IDFATSVLGRNVV RTT N  GS K+I IGSIKG
Sbjct  478  LDALTECERAPSPGETKRCIGSAEDLIDFATSVLGRNVVARTTANVNGSKKNIKIGSIKG  537

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSL+PYL+YYCHSVPKVRVYEAD+LDP S SKINHGVAICH+DTSSW
Sbjct  538  INGGKVTESVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNSNSKINHGVAICHLDTSSW  597

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFEND+TW  AD
Sbjct  598  SPTHGAFVALGSGPGRIEVCHWIFENDLTWTTAD  631



>ref|XP_011009539.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=633

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G+ MPMPDI+D+MPKRSFLPR I SK+PFSTSK+G +K++FHA+D+S+M +++
Sbjct  418  RESMLKEGSEMPMPDIRDKMPKRSFLPRSIISKIPFSTSKMGLIKEIFHASDNSSMERII  477

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA+ ECERAPS GETKRCV S ED+IDF  SVLGRNV VRTT+N EGS K++ IGSIKG
Sbjct  478  LDAVEECERAPSPGETKRCVGSAEDLIDFVISVLGRNVAVRTTDNVEGSKKNVTIGSIKG  537

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTSSW
Sbjct  538  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPNSKTKINHGVAICHLDTSSW  597

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFENDMTW +A+
Sbjct  598  SPTHGAFLALGSGPGRIEVCHWIFENDMTWTIAE  631



>ref|XP_011034135.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=636

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 193/217 (89%), Gaps = 3/217 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G++MPMPDI+D+MPKRSFLPR I SKLPFSTSKI  LK++FHA+D+S+M +++
Sbjct  419  RESMLKKGSVMPMPDIRDKMPKRSFLPRSIISKLPFSTSKIYQLKEIFHASDNSSMERII  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECER+PS GETKRCV S EDMIDFATSVLGRNV VRTT+N  GS K+IMIGSIKG
Sbjct  479  LDALEECERSPSPGETKRCVGSAEDMIDFATSVLGRNVAVRTTDNVNGSKKNIMIGSIKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVY---EADLLDPKSKSKINHGVAICHIDT  238
            INGG+VT+SVSCHQSL+PYL+YYCHSVPKVRVY   EADLLDP SK+ INHGVAICH+DT
Sbjct  539  INGGRVTRSVSCHQSLYPYLLYYCHSVPKVRVYEADEADLLDPNSKATINHGVAICHLDT  598

Query  237  SSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SSWS THGAF+ALG GPG+IEVCHWIFENDMTW +AD
Sbjct  599  SSWSPTHGAFLALGPGPGRIEVCHWIFENDMTWTIAD  635



>gb|KDP26582.1| hypothetical protein JCGZ_17740 [Jatropha curcas]
Length=625

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G++MPMPDI+D+MPKR+FLPR I SKLPFST +I  LKQ+F+A D S+M  ++
Sbjct  412  RESMLKKGSVMPMPDIRDKMPKRAFLPRWIVSKLPFSTDQISQLKQIFNAGDGSSMETII  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA+ ECERAPS GETKRCV S ED+IDFATSVLGRN VV TTEN  GS KD+MIG++KG
Sbjct  472  LDAIKECERAPSPGETKRCVGSAEDLIDFATSVLGRNAVVWTTENVSGSKKDVMIGTVKG  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LDP SK KINHGVAICH+DTSSW
Sbjct  532  MNGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNSKEKINHGVAICHLDTSSW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFENDMTW +AD
Sbjct  592  SPTHGAFLALGSGPGQIEVCHWIFENDMTWTIAD  625



>gb|KDO82433.1| hypothetical protein CISIN_1g036311mg [Citrus sinensis]
Length=632

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE +LK G++M MPDI+D+MPKRSFLPR I SKLPFS+SKI  +K++FHA D+S+M  ++
Sbjct  419  RESVLKKGSVMAMPDIQDKMPKRSFLPRTIVSKLPFSSSKIKDMKEIFHAVDNSSMESII  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL +CERAPS GETKRCV SVEDMIDFATS+LGRNVVVRTTEN  GS K IMIGS+KG
Sbjct  479  KEALGDCERAPSAGETKRCVGSVEDMIDFATSILGRNVVVRTTENVNGSKKKIMIGSVKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVYEAD+LD  +K+KINHGVAICH+DTS+W
Sbjct  539  INGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADVLDANTKAKINHGVAICHLDTSAW  598

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPGKIEVCHWIFENDMTW  AD
Sbjct  599  SPTHGAFLALGSGPGKIEVCHWIFENDMTWTTAD  632



>ref|XP_003613234.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96192.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=630

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK GT+MPMPDI+D++PKRSFLPR I +KLPFSTSKI  +K LF A+D+ +M KM+
Sbjct  417  REKMLKEGTVMPMPDIRDKLPKRSFLPRSILAKLPFSTSKIDEMKGLFKASDNGSMEKMM  476

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L +CER P++GETKRCV S+EDMIDFATSVLGRNVVVRTTEN  GS KD+M+G + G
Sbjct  477  RDSLGDCERVPAKGETKRCVGSIEDMIDFATSVLGRNVVVRTTENVNGSKKDVMVGRVNG  536

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVY+A+LLDPKSK KIN GVA+CH+DTS W
Sbjct  537  INGGKVTRSVSCHQSLFPYLLYYCHSVPKVRVYQAELLDPKSKDKINQGVAVCHLDTSDW  596

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF++LGSGPG+IEVCHWIFEND++W VAD
Sbjct  597  SPTHGAFMSLGSGPGRIEVCHWIFENDLSWTVAD  630



>ref|XP_002314620.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
 gb|EEF00791.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
Length=633

 Score =   374 bits (959),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G+ MPMPDI+D+MPKRSFLPR I SK+PFSTSK+G +K++FHA+D+S+M +++
Sbjct  418  RESMLKEGSEMPMPDIRDKMPKRSFLPRSIISKIPFSTSKMGLIKEIFHASDNSSMERII  477

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA+ ECERAPS GETKRCV S ED+IDF  SVLGRNV VRTT+N EGS K++ IG+IKG
Sbjct  478  LDAVEECERAPSPGETKRCVGSAEDLIDFVISVLGRNVAVRTTDNVEGSKKNVTIGTIKG  537

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYEADLLDP SK+KINHGVAICH+DTSSW
Sbjct  538  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPNSKTKINHGVAICHLDTSSW  597

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFENDMTW +A+
Sbjct  598  SPTHGAFLALGSGPGRIEVCHWIFENDMTWTLAE  631



>ref|XP_004509821.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=624

 Score =   373 bits (957),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDIKD++PKRSFLPR I +KLPFS+SK+  LKQ+F  +D+S+M KM+
Sbjct  411  REMMLKQGTVMPMPDIKDKLPKRSFLPRTILTKLPFSSSKLNELKQVFKVSDNSSMEKMI  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+LSECERAPS+GE KRCV S+EDMIDFATSVLGRNV VR+TEN  GS K+IM+G + G
Sbjct  471  VDSLSECERAPSKGENKRCVGSLEDMIDFATSVLGRNVTVRSTENVNGSGKNIMVGRVNG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSV CHQSLFPYL+YYCHSVPKVRVYEADLLDP+SK K+NHGVAICH+DT++W
Sbjct  531  INGGKVTKSVWCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKVKVNHGVAICHLDTTTW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALG GPG+IEVCHWIFENDMTW  AD
Sbjct  591  SPSHGAFMALGFGPGRIEVCHWIFENDMTWTTAD  624



>ref|XP_008444317.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=623

 Score =   373 bits (957),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+ G++M MPDI+D+MPKRSFLPR I SKLPFS+SK+G +KQ+FHA D+S+M  M+
Sbjct  410  RESMLRKGSVMAMPDIRDKMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGDNSSMETMM  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + + ECER PS GETKRCV SVEDMIDFATSVLGRNVVVRTTENT+GS  +IMIG +KG
Sbjct  470  TETVRECERVPSAGETKRCVGSVEDMIDFATSVLGRNVVVRTTENTKGSKGNIMIGKVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYE DLLDP SK+ INHGVAICH+DTS+W
Sbjct  530  MNGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEVDLLDPASKATINHGVAICHLDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFIALGS PG++EVCHWIFENDMTW VAD
Sbjct  590  SPAHGAFIALGSAPGRVEVCHWIFENDMTWTVAD  623



>ref|XP_006438394.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
 ref|XP_006483846.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
 gb|ESR51634.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
Length=632

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE +LK G++M MPDI+D+MPKRSFLPR I SKLPFS+SKI  +K++FHA D+S+M  ++
Sbjct  419  RESVLKKGSVMAMPDIQDKMPKRSFLPRTIVSKLPFSSSKIKDMKEIFHAVDNSSMESII  478

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL +CERAPS GETKRCV SVEDMIDFATS+LGRNVVVRTTEN  GS K I+IGS+KG
Sbjct  479  KEALGDCERAPSAGETKRCVGSVEDMIDFATSILGRNVVVRTTENVNGSKKKIVIGSVKG  538

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVYEAD+LD  +K+KINHGVAICH+DTS+W
Sbjct  539  INGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDANTKAKINHGVAICHLDTSAW  598

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPGKIEVCHWIFENDMTW  AD
Sbjct  599  SPTHGAFLALGSGPGKIEVCHWIFENDMTWTTAD  632



>ref|XP_003552018.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=622

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MPKRSFLPR I +KLPFS++K+  LK++F  +++S+M KM+
Sbjct  409  RETMLKEGTVMPMPDIRDKMPKRSFLPRAILTKLPFSSAKVDELKRVFKVSENSSMDKMI  468

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L ECERAPS GETKRCV SVEDMIDF+TSVLGRNV V TTEN +GS K++M+G +KG
Sbjct  469  MDSLGECERAPSVGETKRCVASVEDMIDFSTSVLGRNVAVWTTENVKGSNKNVMVGRVKG  528

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP+SK+KINHGVAICH+DT++W
Sbjct  529  MNGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKAKINHGVAICHLDTTAW  588

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFEND+TW +AD
Sbjct  589  SPTHGAFLALGSGPGRIEVCHWIFENDLTWTIAD  622



>gb|KDO38689.1| hypothetical protein CISIN_1g045773mg [Citrus sinensis]
Length=303

 Score =   361 bits (927),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK+GT+MPMPDI+DRMP+RS LPR I S LPF++SK+  LK++FHA+D+STM  ++
Sbjct  87   RESMLKNGTLMPMPDIRDRMPRRSLLPRSIVSNLPFTSSKLNQLKEIFHASDNSTMESII  146

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALS+CERAPS+GETKRCV S EDMIDFATSVLG NV + TTEN +GS +DIMIG++KG
Sbjct  147  KDALSDCERAPSKGETKRCVGSAEDMIDFATSVLGNNVALHTTENAKGSKQDIMIGTVKG  206

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+L+PK+ +KINHGVAICH+DTSSW
Sbjct  207  INGGEVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILEPKTMAKINHGVAICHLDTSSW  266

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+TH AF+ LGS PG+IEVCHWIFEND+TW +AD
Sbjct  267  SATHEAFLTLGSSPGRIEVCHWIFENDLTWTIAD  300



>ref|XP_010251282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=639

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +MPMPDI+D+MP RSFLPR I SKLPFS+S+I  LKQ+FHAA++STM ++L
Sbjct  426  RESMLKEGIVMPMPDIRDKMPPRSFLPRSITSKLPFSSSRISELKQIFHAAENSTMERVL  485

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + L ECERAPSRGETK+CV S+E MIDFA SVLG NVVVR+TEN  GSTK++MIG++KG
Sbjct  486  QNTLEECERAPSRGETKKCVGSLEGMIDFAVSVLGHNVVVRSTENVNGSTKNVMIGAVKG  545

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSLFPYLVYYCHSVPKVRVYEAD+LD  SK+KIN+GVAICHIDTS+W
Sbjct  546  INGGRVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDANSKAKINNGVAICHIDTSAW  605

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFI+LGS PGKIEVCHWIFENDMTW VAD
Sbjct  606  SPGHGAFISLGSSPGKIEVCHWIFENDMTWTVAD  639



>ref|XP_010023570.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
Length=624

 Score =   371 bits (953),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI D+MPKRSFLPR I SKLPFSTSK+  LK++FHA D+S+M  M+
Sbjct  411  RESMLKKGTVMPMPDIGDKMPKRSFLPRTILSKLPFSTSKLPELKRIFHAGDNSSMESMM  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A+AL+ECERAPS GETKRCV S+EDMIDFATS+LGR+V  R+TE+T GS +++M+G++KG
Sbjct  471  ANALAECERAPSAGETKRCVGSMEDMIDFATSILGRDVEARSTESTAGSKQEVMVGTVKG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK+K KINHGVA+CHIDTS+W
Sbjct  531  INGGMVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKVKINHGVAVCHIDTSAW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+THGAF+ALGS PG+IEVCHWIFE+DMTW +AD
Sbjct  591  SATHGAFLALGSRPGQIEVCHWIFESDMTWTIAD  624



>ref|XP_006438393.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
 gb|ESR51633.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
Length=618

 Score =   371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK+GT+MPMPDI+DRMP+RSFLPR I S LPF++SK+  LK++FHA+D+STM  ++
Sbjct  402  RESMLKNGTLMPMPDIRDRMPRRSFLPRSIVSNLPFTSSKLNQLKEIFHASDNSTMESII  461

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALS+CERAPS+GETKRCV S EDMIDFATSVLG NV + TTEN +GS +DIMIG +KG
Sbjct  462  KDALSDCERAPSKGETKRCVGSAEDMIDFATSVLGNNVALHTTENAKGSKQDIMIGMVKG  521

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+L+PK+ +KINHGVAICH+DTSSW
Sbjct  522  INGGEVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILEPKTMAKINHGVAICHLDTSSW  581

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+THGAF+ LGS PG+IEVCHWIFEND+TW +AD
Sbjct  582  STTHGAFLTLGSSPGRIEVCHWIFENDLTWTIAD  615



>gb|KCW59875.1| hypothetical protein EUGRSUZ_H02608 [Eucalyptus grandis]
Length=623

 Score =   371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI D+MPKRSFLPR I SKLPFSTSK+  LK++FHA D+S+M  M+
Sbjct  410  RESMLKKGTVMPMPDIGDKMPKRSFLPRTILSKLPFSTSKLPELKRIFHAGDNSSMESMM  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A+AL+ECERAPS GETKRCV S+EDMIDFATS+LGR+V  R+TE+T GS +++M+G++KG
Sbjct  470  ANALAECERAPSAGETKRCVGSMEDMIDFATSILGRDVEARSTESTAGSKQEVMVGTVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPK+K KINHGVA+CHIDTS+W
Sbjct  530  INGGMVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKVKINHGVAVCHIDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+THGAF+ALGS PG+IEVCHWIFE+DMTW +AD
Sbjct  590  SATHGAFLALGSRPGQIEVCHWIFESDMTWTIAD  623



>ref|XP_003532010.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=627

 Score =   370 bits (951),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI+D+MPKRSFLPR I +KLPFS+SK+  LK+LF  +D+S+M KM+
Sbjct  414  RESMLKDGTLMPMPDIRDKMPKRSFLPRSILTKLPFSSSKVHELKRLFKVSDNSSMEKMI  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L ECER PS GETKRCV S+EDMIDF+TSVLGRNV V TTEN  GS K++M+G +KG
Sbjct  474  MDSLGECERVPSMGETKRCVGSIEDMIDFSTSVLGRNVAVWTTENVNGSNKNVMVGRVKG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVT+SVSCHQSLFPY++YYCHSVPKVRVY+ADLLDP+SK+KINHGVAICH+DT++W
Sbjct  534  MNGGKVTQSVSCHQSLFPYMLYYCHSVPKVRVYQADLLDPESKAKINHGVAICHLDTTAW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFEND+TW +AD
Sbjct  594  SPTHGAFMALGSGPGRIEVCHWIFENDLTWTIAD  627



>ref|XP_004514684.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X1 [Cicer arietinum]
 ref|XP_004514685.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X2 [Cicer arietinum]
Length=630

 Score =   370 bits (951),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK GT+MPMPDI+D+MP+RSFLPR I +KLPFSTSKI  +K+LF A+D+ +M KM+
Sbjct  417  REKMLKEGTVMPMPDIRDKMPERSFLPRSILAKLPFSTSKIYEMKRLFKASDNGSMEKMM  476

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L ECER PSRGETKRCV S+EDMIDFATSVLGRNVVVRTT+N  GS  ++M+G + G
Sbjct  477  RDSLGECERVPSRGETKRCVGSIEDMIDFATSVLGRNVVVRTTKNLNGSKGNVMVGRVNG  536

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+T+SVSCHQSLFPYL+YYCHSVP VRVY+ DLLDPK+KSKIN GVA+CH+DTS W
Sbjct  537  INGGKITRSVSCHQSLFPYLLYYCHSVPMVRVYQVDLLDPKTKSKINQGVAVCHLDTSDW  596

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF++LGSGPG+IEVCHWIFENDM+W VAD
Sbjct  597  SPSHGAFLSLGSGPGRIEVCHWIFENDMSWTVAD  630



>ref|XP_004173618.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like, 
partial [Cucumis sativus]
Length=612

 Score =   370 bits (949),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+ G++M MPDI+D+MPKRSFLPR I SKLPFS+SK+G +KQ+FHA D+S+M  M+
Sbjct  399  RESMLRKGSVMAMPDIRDKMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGDNSSMETMM  458

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + + ECER PS GETKRCV SVEDMIDFATSVLGRNVVV+TTENT+GS  +IMIG +KG
Sbjct  459  TETVRECERLPSAGETKRCVGSVEDMIDFATSVLGRNVVVQTTENTKGSKGNIMIGKVKG  518

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYE DLLDP +K+ +NHGVAICH+DTS+W
Sbjct  519  MNGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEVDLLDPATKATVNHGVAICHLDTSAW  578

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFIALGS PG++EVCHWIFENDMTW VAD
Sbjct  579  SPAHGAFIALGSAPGRVEVCHWIFENDMTWTVAD  612



>ref|XP_004142981.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN62285.1| hypothetical protein Csa_2G348230 [Cucumis sativus]
Length=623

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+ G++M MPDI+D+MPKRSFLPR I SKLPFS+SK+G +KQ+FHA D+S+M  M+
Sbjct  410  RESMLRKGSVMAMPDIRDKMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGDNSSMETMM  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + + ECER PS GETKRCV SVEDMIDFATSVLGRNVVV+TTENT+GS  +IMIG +KG
Sbjct  470  TETVRECERLPSAGETKRCVGSVEDMIDFATSVLGRNVVVQTTENTKGSKGNIMIGKVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYE DLLDP +K+ +NHGVAICH+DTS+W
Sbjct  530  MNGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEVDLLDPATKATVNHGVAICHLDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFIALGS PG++EVCHWIFENDMTW VAD
Sbjct  590  SPAHGAFIALGSAPGRVEVCHWIFENDMTWTVAD  623



>gb|EYU22487.1| hypothetical protein MIMGU_mgv1a002927mg [Erythranthe guttata]
Length=624

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPDI+D++PKRSFLPR I SKLPFSTSKI  ++++FHA  DS+MA +L
Sbjct  411  RESMLKSGIVMPMPDIRDKLPKRSFLPRAIISKLPFSTSKIREMEKIFHAGQDSSMANIL  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + L+ECER PS  ETKRCV S+EDMIDF+TSVLGRNVVV TTENT GS  +I IG +KG
Sbjct  471  TNTLNECERKPSPHETKRCVASIEDMIDFSTSVLGRNVVVHTTENTRGSNGNITIGKVKG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVTKSVSCHQSLFPY++YYCHSVPKVRVYEA +LDPKS++KIN+GVAICH+DTSSW
Sbjct  531  VNGGKVTKSVSCHQSLFPYMLYYCHSVPKVRVYEAVILDPKSRAKINNGVAICHLDTSSW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFIALGSGPGKIEVCHWIFENDMTW +AD
Sbjct  591  SPGHGAFIALGSGPGKIEVCHWIFENDMTWTIAD  624



>ref|XP_003517743.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=629

 Score =   369 bits (946),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK GT+MPMPDIKD++P+RSFLPR I SKLPFS SKI  LKQ+F A+D+ +M KM+
Sbjct  416  REKMLKEGTVMPMPDIKDKLPERSFLPRSILSKLPFSVSKIDELKQVFKASDNGSMEKMM  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L+ECERAPSRGETKRCV S+EDMIDFATSVLGRNV VRTT+N  GS K +++G ++G
Sbjct  476  RDSLAECERAPSRGETKRCVGSLEDMIDFATSVLGRNVAVRTTQNVNGSKKSVVVGPVRG  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCH+VPKVRVYEADLLDPK+K KIN GVAICH+DTS W
Sbjct  536  INGGKVTQSVSCHQSLFPYLLYYCHAVPKVRVYEADLLDPKTKVKINRGVAICHLDTSDW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAV  133
            S THGAFI+LGSGPG+IEVCHWIFEND+ W +
Sbjct  596  SPTHGAFISLGSGPGRIEVCHWIFENDVAWTI  627



>ref|XP_003519820.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=628

 Score =   368 bits (945),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKM+K GT+MPMPDIKD+MP+RSFLPR I SKLPFS SKI  LKQ+F A+D+ +M KM+
Sbjct  415  REKMMKEGTVMPMPDIKDKMPERSFLPRSILSKLPFSVSKIDELKQVFKASDNGSMEKMM  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L ECERAPS GETKRCV S+EDMIDFATSVLGRNV VRTT+N  GS K +++G ++G
Sbjct  475  KDSLEECERAPSSGETKRCVGSLEDMIDFATSVLGRNVAVRTTQNVNGSKKSVVVGPVRG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCH+VPKVRVYEADLLDPK+K+KIN GVAICH+DTS W
Sbjct  535  INGGKVTQSVSCHQSLFPYLLYYCHAVPKVRVYEADLLDPKTKAKINRGVAICHLDTSDW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF++LGS PG+IEVCHWIFENDM W +AD
Sbjct  595  SPTHGAFLSLGSVPGRIEVCHWIFENDMAWTIAD  628



>ref|XP_006484316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630-like 
[Citrus sinensis]
Length=632

 Score =   368 bits (944),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK+GT+MPMPDI+DRMP+RSFLP  I S LPF+ SK+  LK++FHA+D+STM  ++
Sbjct  416  RESMLKNGTLMPMPDIRDRMPRRSFLPLSIVSNLPFTGSKLNQLKEIFHASDNSTMESII  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALS+CERAPS+GETKRCV S EDMIDFATSVLG NV + TTEN +GS +DIMIG++KG
Sbjct  476  KDALSDCERAPSKGETKRCVASAEDMIDFATSVLGNNVALHTTENAKGSKQDIMIGTVKG  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+L+PK+ +KINHGVAICH+DTS+W
Sbjct  536  INGGEVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILEPKTMAKINHGVAICHLDTSAW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+THGAF+ LGS PG+IEVCHWIFEND+TW +AD
Sbjct  596  SATHGAFLTLGSSPGRIEVCHWIFENDLTWTIAD  629



>gb|KJB15113.1| hypothetical protein B456_002G161400 [Gossypium raimondii]
Length=616

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK G ++PMPDIKD+MP RSFLPR I SK+PFS+S+I  LK +FHA D+ST+  ++
Sbjct  402  REKMLKRGKVIPMPDIKDKMPARSFLPRTILSKIPFSSSEIDQLKWIFHAGDNSTLGTIM  461

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECER PS GETKRCV S EDM+DFATSVLGRNV VRTT+N  GS K+IMIGS+  
Sbjct  462  LDALKECERPPSPGETKRCVGSAEDMVDFATSVLGRNVEVRTTQNVNGSKKNIMIGSVGK  521

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LDP S  KINHGVAICH+DTSSW
Sbjct  522  INGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNSMEKINHGVAICHLDTSSW  581

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SS HGAF+ALGSGPG+IEVCHWIFENDMTW +AD
Sbjct  582  SSGHGAFLALGSGPGRIEVCHWIFENDMTWTIAD  615



>ref|XP_010682558.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+MLK GTIMPMPD+KD+MP RSFLPR I SK+PF +SKI  L+++FHA D+STM  ML
Sbjct  437  RERMLKEGTIMPMPDVKDKMPPRSFLPRSILSKIPFESSKITQLREIFHAFDNSTMEGML  496

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
              AL ECERAPS GETK+CV SVEDMIDFA SVLGR+V  RT +N  GS  DI+IG ++G
Sbjct  497  NAALRECERAPSMGETKKCVGSVEDMIDFAVSVLGRSVEARTIDNVNGSKTDILIGKVRG  556

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+TKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LDP +K+KINHGVAICHIDTS+W
Sbjct  557  INGGKITKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPSTKAKINHGVAICHIDTSAW  616

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAFIALG GPGKIEVCHWIFEND+TWAVAD
Sbjct  617  SPTHGAFIALGPGPGKIEVCHWIFENDLTWAVAD  650



>gb|KEH20006.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=644

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK GT+MPMPDI+D++P RSFLPR I +KLPF++SK+  +KQ+F  +++S+M KM+
Sbjct  431  REKMLKEGTVMPMPDIRDKLPPRSFLPRSILTKLPFASSKLNEMKQVFKVSENSSMNKMM  490

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECERAPS GETKRCV S+EDMIDFATSVLG +V VR+TEN  G+ KD+M+G +KG
Sbjct  491  VDALSECERAPSVGETKRCVGSLEDMIDFATSVLGHSVTVRSTENVNGAGKDVMVGKVKG  550

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVP V VYEADLLDP SK+KINHGVAICH+DT++W
Sbjct  551  INGGKVTESVSCHQSLFPYLLYYCHSVPNVHVYEADLLDPVSKAKINHGVAICHLDTTAW  610

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SSTHGAF+ALGS PG+IEVCHWIFENDMTW+ AD
Sbjct  611  SSTHGAFMALGSAPGQIEVCHWIFENDMTWSSAD  644



>emb|CDP00165.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 188/214 (88%), Gaps = 12/214 (6%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKML++GT+MPMPDIKD+MPKRSFLPRVI SKLPFSTSKIG LK++FHAADDS MA ++
Sbjct  430  REKMLRTGTVMPMPDIKDKMPKRSFLPRVILSKLPFSTSKIGELKKIFHAADDSKMAGLM  489

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            AD+L ECERAPS GETKRCV S EDMIDFATS            +T+GS  +I+IGS++G
Sbjct  490  ADSLGECERAPSPGETKRCVGSGEDMIDFATS------------STQGSGGNILIGSVEG  537

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVY+AD+LDPK+K KINHGVAICH+DTSSW
Sbjct  538  INGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYQADILDPKTKDKINHGVAICHVDTSSW  597

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFIALGSGPGKIEVCHWIFENDMTW +AD
Sbjct  598  SPGHGAFIALGSGPGKIEVCHWIFENDMTWTIAD  631



>gb|EPS67761.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=608

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 188/218 (86%), Gaps = 4/218 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADD----STM  601
            RE MLK GTIMPMPDI+D+MPKRSFLPR+I SKLPFSTSKI  +K+LF A DD    S +
Sbjct  391  RESMLKPGTIMPMPDIRDKMPKRSFLPRLIVSKLPFSTSKISDIKKLFRAPDDGDDDSAI  450

Query  600  AKMLADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIG  421
            +KM+++AL ECER PS GETKRCV S+EDMIDFATSVLGR+V VRTT  T GS   IM+G
Sbjct  451  SKMVSNALRECERKPSPGETKRCVASIEDMIDFATSVLGRSVAVRTTATTAGSDGQIMLG  510

Query  420  SIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHID  241
             I GINGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LDP +KSKINHGVAICH+D
Sbjct  511  RIAGINGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNTKSKINHGVAICHLD  570

Query  240  TSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            T+SWS  HGAF+ALG GPGKIEVCHWIFENDM WAVAD
Sbjct  571  TTSWSPDHGAFVALGPGPGKIEVCHWIFENDMNWAVAD  608



>ref|XP_010477679.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   365 bits (938),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT++ MPDIKD+MPKRSFLPR I SKLPFSTSKI  +K++FHA D+STM  ++
Sbjct  410  RESMLKEGTLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKITEIKRVFHARDNSTMEGII  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A+A++ECER+P+ GETKRCV S EDMIDFATSVLGR+VVVRTTE+  GS + +MIG++KG
Sbjct  470  ANAVTECERSPTVGETKRCVGSAEDMIDFATSVLGRSVVVRTTESVAGSKQKVMIGNVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEADLLDPKSK+KINHG+AICH+DTS+W
Sbjct  530  INGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPKSKAKINHGIAICHMDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             ++HGAF++LGS PG+IEVCHWIFENDM WA+AD
Sbjct  590  GASHGAFVSLGSKPGQIEVCHWIFENDMNWAIAD  623



>gb|KEH20007.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=627

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK G +MPMPDIKD++P RSFLPR I +KLPF++SK+  LKQ+F  +++S+M KM+
Sbjct  414  REKMLKQGVVMPMPDIKDKLPPRSFLPRTILTKLPFASSKLNELKQVFKVSENSSMDKMI  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L ECERAPS GETKRCV S+EDMIDFATSVLG +V VR+TE+  GS K++M+G +KG
Sbjct  474  VDSLGECERAPSMGETKRCVGSLEDMIDFATSVLGHDVTVRSTESVNGSGKNVMVGRVKG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP+SK KINHGVAICH+DT++W
Sbjct  534  INGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKVKINHGVAICHLDTTAW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPGKIEVCHWIFENDMTW   D
Sbjct  594  SPTHGAFMALGSGPGKIEVCHWIFENDMTWTTTD  627



>ref|XP_010551569.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=625

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G  +PMPDI+D+MPKRSFLPR I SKLPFS SKI  +K++F A D+STM +++
Sbjct  412  REAMLKEGNTIPMPDIRDKMPKRSFLPRNIISKLPFSASKIADIKRIFGAGDNSTMERII  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DALSECER+PS GETKRCV S EDMIDFATSVLGR++ +RTTEN  GS + +MIG ++G
Sbjct  472  SDALSECERSPSAGETKRCVGSAEDMIDFATSVLGRSLELRTTENIAGSKQKVMIGKVRG  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYE+DLLDPK+KSKINHGVAICHIDTS+W
Sbjct  532  INGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKTKSKINHGVAICHIDTSAW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             ++HGAF ALGS PG+IEVCHWIFENDMTW +AD
Sbjct  592  GASHGAFAALGSRPGQIEVCHWIFENDMTWTIAD  625



>gb|KHG01313.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=616

 Score =   362 bits (930),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKMLK G ++PMPDIKD+MP RSFLPR I SK+PFS+S+I  LK++FHA D+ST+  ++
Sbjct  402  REKMLKRGMVIPMPDIKDKMPARSFLPRTILSKIPFSSSEIDQLKRIFHAGDNSTLGTIM  461

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECER PS GETKRCV S EDM+DFATSVLGRNV VRTT+N  GS K+IMIGS+  
Sbjct  462  LDALKECERLPSPGETKRCVGSAEDMVDFATSVLGRNVEVRTTQNVNGSKKNIMIGSVGK  521

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I+GGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEA +LDP S  KINHGVAICH+DTSSW
Sbjct  522  IDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAGILDPDSMEKINHGVAICHLDTSSW  581

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SS HGAF+ALGSGPG+IEVCHWIFENDMTW +AD
Sbjct  582  SSGHGAFLALGSGPGRIEVCHWIFENDMTWTIAD  615



>ref|XP_010520580.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=614

 Score =   362 bits (929),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G ++PMPDI+D+MPKRSFLPR I  KLPFSTSKI  +K+ F A D+STM K++
Sbjct  401  REAMLKEGNMIPMPDIRDKMPKRSFLPRNILLKLPFSTSKIADIKRNFRANDNSTMEKII  460

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DALSECER PS GETKRCV S EDMIDFATSVLGRN+++R TE+T GS +++MIG +KG
Sbjct  461  SDALSECERPPSAGETKRCVGSAEDMIDFATSVLGRNIILRNTESTAGSKQEVMIGKVKG  520

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYE+DLLDPK+KSKINHGVAICHIDTS+W
Sbjct  521  INGGEVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKTKSKINHGVAICHIDTSAW  580

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALGS PG+IEVCHWIFEND+TW +AD
Sbjct  581  GPRHGAFMALGSRPGEIEVCHWIFENDLTWTIAD  614



>gb|KFK41456.1| hypothetical protein AALP_AA2G132700 [Arabis alpina]
Length=617

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE +LK GT++PMPDIKD+MPKRSFLPR I +KLPFSTSKIG +K++FHA ++STM  ++
Sbjct  404  RESVLKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKIGEIKKIFHAGENSTMGNII  463

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +A++ECERAPS GETKRCV S EDMIDFATSVLGR VVVRTTEN  GS + +++G + G
Sbjct  464  TEAVTECERAPSVGETKRCVGSAEDMIDFATSVLGRTVVVRTTENVAGSKQQVVVGKVNG  523

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKV+VYEADLL+  SK KINHG+AICH+DTSSW
Sbjct  524  INGGKVTKAVSCHQSLYPYLMYYCHSVPKVKVYEADLLELNSKKKINHGIAICHMDTSSW  583

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  584  GPSHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  617



>ref|XP_009105700.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Brassica rapa]
Length=627

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I SKLPFSTSK+  + ++FHA ++STM K++
Sbjct  414  REASLKEGTVIPMPDIKDKMPKRSFLPRSIISKLPFSTSKLAEINKIFHAGENSTMEKII  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DA++ECER+PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + +MIG + G
Sbjct  474  SDAVTECERSPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKQKVMIGKVNG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYEADLLD KSK+KINHG+AICH+DTSSW
Sbjct  534  INGGKVTKAVSCHQSLYPYLMYYCHSVPKVRVYEADLLDLKSKTKINHGIAICHMDTSSW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALGS PG IEVCHWIFENDM WA+AD
Sbjct  594  GPKHGAFLALGSKPGLIEVCHWIFENDMNWAIAD  627



>ref|XP_007157462.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
 gb|ESW29456.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
Length=626

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKM+K GT+MPMPDI+D+MP+RSFLPR I SKLPFS SK+  LK++F A+D+ +M +M+
Sbjct  413  REKMMKEGTVMPMPDIRDKMPQRSFLPRSILSKLPFSVSKMDDLKRVFRASDNGSMERMM  472

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             ++L ECERAPSRGETKRCV S+EDMIDFATSVLGRNV VR+TE+  GS K +M+G + G
Sbjct  473  RESLEECERAPSRGETKRCVGSLEDMIDFATSVLGRNVAVRSTESVNGSKKSVMVGPVTG  532

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCH+VPKVR+Y+ADLLDPKSK+KIN G+AICH+DTS W
Sbjct  533  INGGKVTQSVSCHQSLFPYLLYYCHAVPKVRLYQADLLDPKSKTKINRGIAICHLDTSDW  592

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF++LGS PG+IEVCHWIF+NDM W +AD
Sbjct  593  SPTHGAFLSLGSAPGRIEVCHWIFQNDMAWTIAD  626



>ref|XP_009775426.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana sylvestris]
Length=638

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDI+D+MP RSFLPR I+SKLPFST ++  LK +FHA ++STM +++
Sbjct  425  RESMLKEGTVMKMPDIRDKMPGRSFLPRTISSKLPFSTKELSDLKTIFHAQENSTMERVI  484

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECERAPS+GETKRCV SVEDMIDFA SVLG NVVVRTT+N  GS + +MIG +KG
Sbjct  485  LNALAECERAPSQGETKRCVGSVEDMIDFAVSVLGHNVVVRTTDNVVGSKEKVMIGKVKG  544

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VT+SVSCHQSL+PYL+YYCHSVPKVRVYEAD+L+ ++K+KINHGVAICHIDTS+W
Sbjct  545  INGGRVTQSVSCHQSLYPYLLYYCHSVPKVRVYEADILNVETKAKINHGVAICHIDTSAW  604

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG+IEVCHWIFENDMTWA AD
Sbjct  605  SPGHGAFVALGSGPGRIEVCHWIFENDMTWATAD  638



>ref|XP_010460151.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT++ MPDIKD+MPKRSFLPR I SKLPFSTSKI  +K++FHA D+STM  ++
Sbjct  410  RESMLKEGTLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHARDNSTMEGII  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER P+ GETKRCV S ED+IDFATSVLGR+VVVRTTE+  GS + +MIG++KG
Sbjct  470  TDAVTECERLPTVGETKRCVGSAEDIIDFATSVLGRSVVVRTTESVAGSKQKVMIGNVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSL+PYL+YYCHSVPKVRVYEADLLDPKSK+KINHG+ ICH+DTS+W
Sbjct  530  INGGNVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPKSKAKINHGIGICHMDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             ++HGAF++LGS PG+IEVCHWIFENDM WA+AD
Sbjct  590  GASHGAFVSLGSRPGQIEVCHWIFENDMNWAIAD  623



>emb|CDY57845.1| BnaA07g38770D [Brassica napus]
Length=627

 Score =   360 bits (923),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I SKLPFSTSK+  + ++FHA ++STM K++
Sbjct  414  REASLKEGTVIPMPDIKDKMPKRSFLPRSIISKLPFSTSKLAEINKIFHAGENSTMEKII  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DA++ECER+PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG + G
Sbjct  474  SDAVTECERSPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYEADLLD KSK+KINHG+AICH+DTSSW
Sbjct  534  INGGKVTKAVSCHQSLYPYLMYYCHSVPKVRVYEADLLDLKSKTKINHGIAICHMDTSSW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALGS PG IEVCHWIFENDM WA+AD
Sbjct  594  GPKHGAFLALGSKPGLIEVCHWIFENDMNWAIAD  627



>ref|XP_007153633.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
 gb|ESW25627.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
Length=624

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G++M MPDI+D+MP+RSFLPR I  KLPFS+SKI  LK +F  +D+S+M KM+
Sbjct  411  RESMLKEGSVMGMPDIRDKMPQRSFLPRSILMKLPFSSSKIEELKSVFKVSDNSSMEKMM  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L ECERAPS GE KRCV SVEDMIDFATSVLG NV V TT+N  G +K++M+G +KG
Sbjct  471  TDSLGECERAPSVGEIKRCVGSVEDMIDFATSVLGHNVGVWTTQNVNGFSKNVMVGRVKG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGKVTKSVSCHQSLFPYL+YYCHSVPKVRVYEADLLDP+SK+KINHGVAICH+DT++W
Sbjct  531  MNGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKAKINHGVAICHLDTTAW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGS PG+IEVCHWIFENDMTW VAD
Sbjct  591  SPTHGAFVALGSSPGRIEVCHWIFENDMTWTVAD  624



>ref|XP_002318036.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
 gb|EEE96256.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
Length=637

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI+D+MP+RSFLPR I SKLPFST+K+  LK LFHA+D+STM ++L
Sbjct  422  RESMLKPGNVMVMPDIRDKMPERSFLPRSIVSKLPFSTTKMAKLKDLFHASDNSTMTRVL  481

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECERAPS GETKRCV SVEDMIDFA SVLG NV VRTTEN  GS K +MIGS++G
Sbjct  482  INALAECERAPSHGETKRCVGSVEDMIDFAVSVLGHNVTVRTTENVNGSKKRVMIGSVEG  541

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD++D +SK KIN GVAICH+DTS+W
Sbjct  542  INGGQVTKSVSCHQSLYPYLLYYCHSVPRVRVYEADIVDVESKEKINVGVAICHVDTSAW  601

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALGS PGKIEVCHWIFENDMTW +AD
Sbjct  602  GPEHGAFVALGSSPGKIEVCHWIFENDMTWTIAD  635



>emb|CDP12374.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GTI+ MPDI+D+MPKRSFLPR+I+SKLPFSTS++ A+K++FHA D+ST+ +++
Sbjct  441  REYMLKDGTIIKMPDIRDKMPKRSFLPRLISSKLPFSTSELSAIKRIFHALDNSTLERVI  500

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECERA SRGE+KRCV SVEDMIDFA SVLGRNVVVRTTEN  GS + +MIG ++G
Sbjct  501  VNALEECERAASRGESKRCVGSVEDMIDFAVSVLGRNVVVRTTENVRGSKQHVMIGKVQG  560

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGG+VT SVSCHQSL+PYL+YYCHSVPKV+VY AD+LD   K+KINHGVAICHIDTS+W
Sbjct  561  VNGGRVTTSVSCHQSLYPYLLYYCHSVPKVKVYLADILDVVGKTKINHGVAICHIDTSAW  620

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG IEVCHWIFENDMTW +AD
Sbjct  621  SPNHGAFVALGSGPGLIEVCHWIFENDMTWTIAD  654



>ref|XP_010498883.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=633

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G ++ MPDIKD+MPKRSFLPR I SKLPFSTSKI  +K+LFHA D+STM  ++
Sbjct  420  RESMLKEGMLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRLFHARDNSTMEGII  479

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER P+ GETKRCV S EDMIDFATSVLGR+VVVRTTE+  GS + +MIG++KG
Sbjct  480  TDAVTECERLPTVGETKRCVGSAEDMIDFATSVLGRSVVVRTTESVAGSKQKVMIGNVKG  539

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSL+PYL+YYCHSVPKVRVYE+DLLDPKSK+KINHG+AICH+DTS+W
Sbjct  540  INGGNVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAW  599

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             ++HGAF++LGS PG IEVCHWIFENDM WA+AD
Sbjct  600  GASHGAFVSLGSKPGLIEVCHWIFENDMNWAIAD  633



>ref|XP_006390895.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
 gb|ESQ28181.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
Length=627

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDI+D+MPKRSFLPR I SKLPFSTSKIG +K++FHA D+STM  ++
Sbjct  414  RESTLKEGTVIPMPDIRDKMPKRSFLPRSIISKLPFSTSKIGEIKRIFHAGDNSTMENII  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DA+ ECER  S GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG + G
Sbjct  474  SDAVKECERPASVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+TK+VSCHQSL+PYL+YYCHSVPKVRVYEADLL+  SK+KINHG+AICH+DTSSW
Sbjct  534  INGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKTKINHGIAICHMDTSSW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              THGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  594  GPTHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  627



>ref|XP_006300881.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
 gb|EOA33779.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
Length=625

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFSTSK+G +K++FHA ++STM  ++
Sbjct  412  REASLKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAGENSTMGGII  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG + G
Sbjct  472  TDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNG  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYEADLL+  SK KINHG+AICH+DTSSW
Sbjct  532  INGGKVTKAVSCHQSLYPYLMYYCHSVPKVRVYEADLLELDSKKKINHGIAICHMDTSSW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             ++HGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  592  GASHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  625



>ref|XP_002890594.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66853.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE +LK  +++ MPDIKD+MPKRSFLPR I SKLPFSTSKI  +K++FHA D+STMA ++
Sbjct  410  RESLLKESSLIWMPDIKDKMPKRSFLPRNIVSKLPFSTSKIAEIKRVFHAKDNSTMAGII  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER+P+ GETKRCV S EDMIDFATSVLGRNVV+RTTE+  GS + +MIG +KG
Sbjct  470  TDAVTECERSPTIGETKRCVGSAEDMIDFATSVLGRNVVLRTTESVAGSKQKVMIGKVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVR+YE+DLLDPKSK+KINHG+AICH+DTS+W
Sbjct  530  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVRIYESDLLDPKSKAKINHGIAICHMDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAF++LGS PG+IEVCHWIFENDM WA+AD
Sbjct  590  GANHGAFMSLGSRPGQIEVCHWIFENDMNWAIAD  623



>ref|XP_002888771.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65030.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   357 bits (917),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFSTSK+G +K++FHA ++STM  ++
Sbjct  413  RESSLKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAGENSTMEGII  472

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG + G
Sbjct  473  TDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNG  532

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+TK+VSCHQSL+PYL+YYCHSVPKVRVYEADLL+  SK KINHG+AICH+DTSSW
Sbjct  533  INGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKKKINHGIAICHMDTSSW  592

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  593  GPSHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  626



>gb|AAB39546.1| polygalacturonase isoenzyme 1 beta subunit homolog [Arabidopsis 
thaliana]
Length=626

 Score =   357 bits (916),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFSTSK+G +K++FHA ++STM  ++
Sbjct  413  RESSLKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGII  472

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG + G
Sbjct  473  TDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKEKVVIGKVNG  532

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+TK+VSCHQSL+PYL+YYCHSVPKVRVYEADLL+  SK KINHG+AICH+DTSSW
Sbjct  533  INGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKKKINHGIAICHMDTSSW  592

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  593  GPSHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  626



>ref|XP_004509826.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=636

 Score =   357 bits (917),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+MPMPDI D++PKRSFLPR I +KLPF++SK+  +K +F  A+ S++ KM+
Sbjct  423  REGMLKEGTVMPMPDIVDKLPKRSFLPRSILTKLPFASSKLNEMKHVFRVAEKSSIEKMI  482

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DALSECER+PS+GETKRCV S+EDMIDFAT VLGRN+ VR+ EN  GS K++M+G +KG
Sbjct  483  VDALSECERSPSQGETKRCVGSIEDMIDFATFVLGRNLTVRSIENVNGSGKNVMVGRVKG  542

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCHSVP VRVYEADLL+PKSK KINHGV ICH+DTS+W
Sbjct  543  INGGKVTQSVSCHQSLFPYLLYYCHSVPDVRVYEADLLEPKSKVKINHGVVICHLDTSAW  602

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            SSTH AF+ALG GPG+IEVCHWIFENDMTW   D
Sbjct  603  SSTHDAFVALGFGPGQIEVCHWIFENDMTWTTVD  636



>ref|XP_010471032.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=624

 Score =   357 bits (916),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFS SK+G +K++FHA ++STM  ++
Sbjct  411  RESSLKEGTVIPMPDIKDKMPKRSFLPRTIITKLPFSVSKLGEIKRIFHAGENSTMGGLI  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTT+N  GS + ++IG + G
Sbjct  471  TDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTDNVAGSKQKVVIGKVNG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYEAD+L+  SK KINHG+AICH+DTSSW
Sbjct  531  INGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYEADILEIDSKKKINHGIAICHMDTSSW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             +THGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  591  GATHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  624



>ref|NP_177194.1| polygalacturonase 2 [Arabidopsis thaliana]
 ref|NP_001185361.1| polygalacturonase 2 [Arabidopsis thaliana]
 sp|P92990.2|JP650_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP650; AltName: Full=Aromatic-rich glycoprotein JP650; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC18803.1| Identical to polygalacuronase isoenzyme 1 beta subunit homolog 
mRNA gb|U63373. EST gb|AA404878 comes from this gene [Arabidopsis 
thaliana]
 dbj|BAE98965.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35050.1| polygalacturonase 2 [Arabidopsis thaliana]
 gb|AEE35051.1| polygalacturonase 2 [Arabidopsis thaliana]
Length=626

 Score =   357 bits (916),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFSTSK+G +K++FHA ++STM  ++
Sbjct  413  RESSLKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGII  472

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG + G
Sbjct  473  TDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKEKVVIGKVNG  532

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+TK+VSCHQSL+PYL+YYCHSVPKVRVYEADLL+  SK KINHG+AICH+DTSSW
Sbjct  533  INGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKKKINHGIAICHMDTSSW  592

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  593  GPSHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  626



>emb|CDY23501.1| BnaC06g24700D [Brassica napus]
Length=625

 Score =   357 bits (916),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++ MPDIKD+MPKRSFLPR I SKLPFSTSK+  +K +FHA D+S+M K++
Sbjct  412  RESTLKEGTVIAMPDIKDKMPKRSFLPRSIVSKLPFSTSKLAEVKMIFHAGDNSSMEKII  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG + G
Sbjct  472  SDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNG  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+TK+VSCHQSL+PYL+YYCHSVPKVRVYEADLL+  SK+KINHG+AICHIDTSSW
Sbjct  532  INGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKTKINHGIAICHIDTSSW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  592  SPGHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  625



>ref|XP_010471031.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
Length=624

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFS SK+G +K++FHA ++STM  ++
Sbjct  411  RESSLKEGTVIPMPDIKDKMPKRSFLPRTIITKLPFSVSKLGEIKRIFHAGENSTMGGLI  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTT+N  GS + ++IG + G
Sbjct  471  TDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTDNVAGSKQKVVIGKVNG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYEAD+L+  SK KINHG+AICH+DTSSW
Sbjct  531  INGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYEADILEIDSKKKINHGIAICHMDTSSW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             +THGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  591  GATHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  624



>ref|XP_010427809.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
 ref|XP_010427810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=625

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAA-DDSTMAKM  592
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFS SK+G +K++FHAA ++STM  +
Sbjct  411  RESSLKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSVSKLGEIKRIFHAAGENSTMGGL  470

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            + DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG +K
Sbjct  471  ITDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVK  530

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            GINGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYEAD+L+  SK KINHG+AICH+DTSS
Sbjct  531  GINGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYEADILEIDSKKKINHGIAICHMDTSS  590

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            W +THGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  591  WGATHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  625



>ref|XP_006439797.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
 gb|ESR53037.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
Length=608

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI+D+MP+RSFLPR I+SKLPF+TS++  LK++F   D+S+M +++
Sbjct  395  RESMLKQGNVMVMPDIRDKMPRRSFLPRSISSKLPFATSQLTQLKEIFRVRDNSSMERVI  454

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECERAPS GETKRCV SVEDMIDFATSVLGRNVV RTT+N  GS + + I S+ G
Sbjct  455  LNALAECERAPSPGETKRCVGSVEDMIDFATSVLGRNVVARTTQNANGSKRRVTISSVSG  514

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LD  S +KINHGVAICHIDTSSW
Sbjct  515  INGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADVLDVVSNAKINHGVAICHIDTSSW  574

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG+IEVCHWIFENDMTW  AD
Sbjct  575  SPGHGAFVALGSGPGQIEVCHWIFENDMTWTSAD  608



>emb|CBI15046.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI+DRMP+RSFLPRVIASKLPFS+S++  LK +FHA D+STM  ++
Sbjct  389  RESMLKEGNVMVMPDIRDRMPERSFLPRVIASKLPFSSSRLQELKDIFHARDNSTMEHVI  448

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A+AL ECERAPSRGETKRCV SVEDMIDFA SVLG +VVVRTTE T GS + +M+G ++G
Sbjct  449  ANALEECERAPSRGETKRCVGSVEDMIDFAVSVLGHDVVVRTTETTRGSKQRVMVGEVRG  508

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSL+PYL+YYCHSVPKVRVYE D+LD + K K+N GVAICHIDTS+W
Sbjct  509  INGGKVTRSVSCHQSLYPYLLYYCHSVPKVRVYEVDILDVERKEKMNKGVAICHIDTSAW  568

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGS PG IEVCHWIFENDMTW  +D
Sbjct  569  SQSHGAFVALGSSPGLIEVCHWIFENDMTWTTSD  602



>ref|XP_010415713.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Camelina sativa]
Length=624

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFS SK+G +K++FHA ++STM  ++
Sbjct  411  RESSLKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSVSKLGEIKRIFHAGENSTMGGLI  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTT+N  GS + ++IG + G
Sbjct  471  TDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTDNVAGSKQKVVIGKVNG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYEAD+L+  SK KINHG+AICH+DTSSW
Sbjct  531  INGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYEADILEIDSKKKINHGIAICHMDTSSW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             +THGAF+ALGS PG+IEVCHWIFENDM WA+AD
Sbjct  591  GATHGAFLALGSKPGRIEVCHWIFENDMNWAIAD  624



>ref|XP_002279813.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=633

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI+DRMP+RSFLPRVIASKLPFS+S++  LK +FHA D+STM  ++
Sbjct  420  RESMLKEGNVMVMPDIRDRMPERSFLPRVIASKLPFSSSRLQELKDIFHARDNSTMEHVI  479

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A+AL ECERAPSRGETKRCV SVEDMIDFA SVLG +VVVRTTE T GS + +M+G ++G
Sbjct  480  ANALEECERAPSRGETKRCVGSVEDMIDFAVSVLGHDVVVRTTETTRGSKQRVMVGEVRG  539

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSL+PYL+YYCHSVPKVRVYE D+LD + K K+N GVAICHIDTS+W
Sbjct  540  INGGKVTRSVSCHQSLYPYLLYYCHSVPKVRVYEVDILDVERKEKMNKGVAICHIDTSAW  599

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGS PG IEVCHWIFENDMTW  +D
Sbjct  600  SQSHGAFVALGSSPGLIEVCHWIFENDMTWTTSD  633



>ref|XP_006303930.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
 gb|EOA36828.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
Length=623

 Score =   355 bits (911),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT++ MPD+KD+MPKRSFLPR I SKLPFSTSKI  +K++FHA D+STM  ++
Sbjct  410  RESMLKEGTLIWMPDVKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHARDNSTMEGII  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER+P+ GETKRCV S EDMIDFATSVLGR+VVVRTTE+  GS + +MIG +KG
Sbjct  470  TNALTECERSPTIGETKRCVGSAEDMIDFATSVLGRSVVVRTTESVAGSKEKVMIGKVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYE+D+LD KSK+KINHG+AICHIDTS+W
Sbjct  530  INGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYESDILDLKSKAKINHGIAICHIDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAF++L S PG+IEVCHWIFENDM WA+AD
Sbjct  590  GANHGAFVSLRSSPGQIEVCHWIFENDMNWAIAD  623



>ref|XP_007036187.1| Polygalacturonase 2, putative [Theobroma cacao]
 gb|EOY20688.1| Polygalacturonase 2, putative [Theobroma cacao]
Length=628

 Score =   355 bits (911),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI+D+MPKRSFLPR + SKLPFSTS++ +L+++F A D+STM  +L
Sbjct  415  RESMLKQGNVMVMPDIRDKMPKRSFLPRGVLSKLPFSTSELPSLREIFGAPDNSTMELVL  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER PS+GETKRCV SVEDMIDFAT VLG NV VRTT+N EGS ++IM+G IKG
Sbjct  475  INALAECERPPSQGETKRCVGSVEDMIDFATLVLGHNVAVRTTKNVEGSKQEIMLGKIKG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVP+VRVYEA++LD KSK KINHGVAICH+DTS+W
Sbjct  535  INGGKVTKSVSCHQSLYPYLLYYCHSVPEVRVYEAEILDVKSKDKINHGVAICHLDTSTW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGS PG+IEVCHWIF+NDMTW +A+
Sbjct  595  SPSHGAFVALGSSPGRIEVCHWIFQNDMTWTIAN  628



>ref|XP_011044316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=637

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G ++ MPDI+D+MP+RSFLPR I SKLPFST+ +  LK LFHA+  STM ++L
Sbjct  422  RESMLKQGNVIVMPDIRDKMPERSFLPRSIVSKLPFSTTNMAKLKDLFHASAKSTMTRVL  481

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER PS GETKRCV SVEDMIDFA SVLGRNV VRTTEN  GS K +MIGS++G
Sbjct  482  VNALTECERVPSPGETKRCVGSVEDMIDFAVSVLGRNVTVRTTENINGSKKRVMIGSVEG  541

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD++D  SK KIN GVAICH+DTS+W
Sbjct  542  INGGKVTKSVSCHQSLYPYLLYYCHSVPRVRVYEADIVDVASKEKINVGVAICHLDTSAW  601

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             S HGAF+ALGS PGKIEVCHWIFENDMTW +AD
Sbjct  602  GSEHGAFVALGSSPGKIEVCHWIFENDMTWTIAD  635



>ref|NP_173788.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
 sp|P92982.2|JP630_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP630; AltName: Full=Aromatic-rich glycoprotein JP630; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC98031.1| Identical to gb|ATU59467 aromatic rich glycoprotein which is 
strongly similar to gb|U63373 polygalacturonase isozyme 1 from 
Arabidopsis thaliana. EST gb|AA395212 comes from this gene 
[Arabidopsis thaliana]
 gb|AEE30429.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
Length=622

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT++ MPDIKD+MPKRSFLPR I SKLPFSTSKI  +K++FHA D+STM  ++
Sbjct  409  RESMLKEGTLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHANDNSTMEGII  468

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA+ ECER P+  ETKRCV S EDMIDFATSVLGR+VV+RTTE+  GS + +MIG + G
Sbjct  469  TDAVRECERPPTVSETKRCVGSAEDMIDFATSVLGRSVVLRTTESVAGSKEKVMIGKVNG  528

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYE+DLLDPKSK+KINHG+AICH+DTS+W
Sbjct  529  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAW  588

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAF+ LGS PG+IEVCHWIFENDM WA+AD
Sbjct  589  GANHGAFMLLGSRPGQIEVCHWIFENDMNWAIAD  622



>ref|XP_009593470.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana tomentosiformis]
Length=636

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE +LK GT+M MPDI+D+MP+RSFLPR I+SKLPFST ++  +K +FHA ++STM +++
Sbjct  423  REAILKEGTVMKMPDIRDKMPRRSFLPRTISSKLPFSTQELSNMKTIFHAQENSTMERVI  482

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECERA S+GETKRCV SVEDMIDFA SVLG NVVVRT +N  GS + +MIG ++G
Sbjct  483  INALAECERASSQGETKRCVGSVEDMIDFAISVLGHNVVVRTADNVVGSKEKVMIGKVEG  542

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VT+SVSCHQSL+PYL+YYCHSVPKVRVYEAD+L+ ++K+KINHGVAICHIDTS+W
Sbjct  543  INGGRVTQSVSCHQSLYPYLLYYCHSVPKVRVYEADILNVETKAKINHGVAICHIDTSAW  602

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG+IEVCHWIFENDMTWA+AD
Sbjct  603  SPGHGAFVALGSGPGRIEVCHWIFENDMTWAMAD  636



>ref|XP_006300871.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
 gb|EOA33769.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
Length=628

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT M MPDIKD+MPKR+FLPR I SKLPFS+S+IG ++++F A ++S+MA ++
Sbjct  415  RESMLKEGTFMQMPDIKDKMPKRTFLPRSIVSKLPFSSSEIGEIRKVFGAGENSSMANII  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
              A+SECER  S GETKRCV S EDMIDFATSVLGR VVVRTTEN  GS K I+IG + G
Sbjct  475  LSAVSECERPASHGETKRCVGSAEDMIDFATSVLGRGVVVRTTENVVGSKKKILIGKVNG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VT++VSCHQSL+PYL+YYCHSVP+VRVYE D+LDP+S  KINHGVAICHIDTS+W
Sbjct  535  INGGNVTRAVSCHQSLYPYLLYYCHSVPRVRVYETDILDPESLEKINHGVAICHIDTSAW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGSGPG+IEVCHWIFENDMTW + D
Sbjct  595  SPTHGAFLALGSGPGRIEVCHWIFENDMTWNIVD  628



>dbj|BAE99852.1| putative polygalacuronase isoenzyme 1 beta subunit [Arabidopsis 
thaliana]
Length=622

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT++ MPDIKD+MPKRSFLPR I SKLPFSTSKI  +K++FHA D+STM  ++
Sbjct  409  RESMLKEGTLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHANDNSTMEGII  468

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA+ ECER P+  ETKRCV S EDMIDFATSVLGR+VV+RTTE+  GS + +MIG + G
Sbjct  469  TDAVRECERPPTVSETKRCVGSAEDMIDFATSVLGRSVVLRTTESVAGSKEKVMIGKVNG  528

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYE+DLLDPKSK+KINHG+AICH+DTS+W
Sbjct  529  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAW  588

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAF+ LGS PG+IEVCHWIFENDM WA+AD
Sbjct  589  GANHGAFMLLGSRPGQIEVCHWIFENDMNWAIAD  622



>ref|XP_006476763.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390-like 
[Citrus sinensis]
Length=624

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI+D+MP+RSFLPR I+SKLPF+TS++  LK++F   D+S+M +++
Sbjct  411  RESMLKQGNVMVMPDIRDKMPRRSFLPRPISSKLPFATSQLTQLKEIFRVRDNSSMERVI  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER PS GE KRCV SVEDMIDFATSVLGRNVV RTT+N  GS + + I S+ G
Sbjct  471  VNALAECERPPSPGEAKRCVGSVEDMIDFATSVLGRNVVARTTQNVNGSKQRVTISSVSG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LD +S +KINHGVAICHIDTSSW
Sbjct  531  INGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDVESNAKINHGVAICHIDTSSW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG+IEVCHWIFENDMTW  AD
Sbjct  591  SPGHGAFVALGSGPGQIEVCHWIFENDMTWTSAD  624



>ref|XP_007210277.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
 gb|EMJ11476.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
Length=613

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G ++ MPDI+D+MP+RSFLPR I SKLPFST  +  L+++FHA D+S M  +L
Sbjct  400  RESMLKQGNVVVMPDIRDKMPERSFLPRGILSKLPFSTPGMSELREIFHARDNSAMEHVL  459

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECERAPS GETKRCV S+EDMIDFATSVLG NVVVRTTEN  GS + +MIG I G
Sbjct  460  TNALGECERAPSPGETKRCVGSIEDMIDFATSVLGHNVVVRTTENVWGSKQKVMIGMISG  519

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQ+L+PYL+YYCHSVPKVRVYEAD++D +SKSKINHGVAICHIDTSSW
Sbjct  520  INGGNVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADIVDVESKSKINHGVAICHIDTSSW  579

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ LGS PGKIEVCHWIFENDM WA+AD
Sbjct  580  SPEHGAFVVLGSSPGKIEVCHWIFENDMAWAIAD  613



>ref|XP_010555103.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=602

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++ MPDI+D+MPKRSFLPR I SKLPFS  KI  +K++F  +D+STM  ++
Sbjct  389  REAKLKEGTVITMPDIRDKMPKRSFLPRSIISKLPFSILKIADIKRIFRVSDNSTMEGII  448

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DALS+CER P+ GETKRCV S EDMIDFATSVLGRN+V+RTTEN  GS + +MIG ++ 
Sbjct  449  SDALSDCERPPTAGETKRCVGSAEDMIDFATSVLGRNIVLRTTENVAGSKQKMMIGKVRA  508

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYE+DLLDP+SK+KINHGVAICHIDTS+W
Sbjct  509  INGGEVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPESKAKINHGVAICHIDTSAW  568

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              +HGAF+ALGS PG+IEVCHWIFENDMTW +AD
Sbjct  569  GPSHGAFVALGSRPGQIEVCHWIFENDMTWTIAD  602



>gb|KEH20005.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=374

 Score =   344 bits (883),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+MLK GT+MPMPD +D++P RSFLPR I  KLPF++SK+  +KQ+F  +++S M KM+
Sbjct  161  RERMLKEGTVMPMPDTRDKLPPRSFLPRSILIKLPFASSKLNNMKQVFKVSENSFMEKMI  220

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+LSECERAPS+GE KRCV S+EDMIDFATS+LG NV VR+TEN  GS  ++M+G +K 
Sbjct  221  VDSLSECERAPSKGEIKRCVGSLEDMIDFATSILGSNVTVRSTENVNGSNNNVMVGQVKE  280

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG V +SVSCHQSLFPYL+YYCHSVP +R+YEA+LLDPKSK KINHGVAICH+DT++W
Sbjct  281  INGGNVMESVSCHQSLFPYLLYYCHSVPNIRIYEANLLDPKSKVKINHGVAICHLDTTAW  340

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ LG GPG+IEVCHWIFENDMTW  A+
Sbjct  341  SPTHGAFMTLGFGPGQIEVCHWIFENDMTWTTAN  374



>gb|KHN00353.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=437

 Score =   346 bits (887),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 181/214 (85%), Gaps = 12/214 (6%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REKM+K GT+MPMPDIKD+MP+RSFLPR I SKLPFS            A+D+ +M KM+
Sbjct  236  REKMMKEGTVMPMPDIKDKMPERSFLPRSILSKLPFS------------ASDNGSMEKMM  283

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D+L ECERAPS GETKRCV S+EDMIDFATSVLGRNV VRTT+N  GS K +++G ++G
Sbjct  284  KDSLEECERAPSSGETKRCVGSLEDMIDFATSVLGRNVAVRTTQNVNGSKKSVVVGPVRG  343

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQSLFPYL+YYCH+VPKVRVYEADLLDPK+K+KIN GVAICH+DTS W
Sbjct  344  INGGKVTQSVSCHQSLFPYLLYYCHAVPKVRVYEADLLDPKTKAKINRGVAICHLDTSDW  403

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF++LGS PG+IEVCHWIFENDM W +AD
Sbjct  404  SPTHGAFLSLGSVPGRIEVCHWIFENDMAWTIAD  437



>gb|KDP31113.1| hypothetical protein JCGZ_11489 [Jatropha curcas]
Length=627

 Score =   352 bits (903),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI D+MPKRSFLPR I SKLPFS+S +  LKQ+FHA ++STM +++
Sbjct  414  RESMLKQGNVMVMPDITDKMPKRSFLPRSIVSKLPFSSSNLSELKQIFHAPENSTMERVI  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER PSRGETKRC+ S+EDM+DFA SVL  NVVVRTTEN  GS K++ IG++KG
Sbjct  474  NNALAECERTPSRGETKRCLGSIEDMVDFAVSVLSHNVVVRTTENVHGSKKNVTIGTVKG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSL+PYL+YYCHSVPKVRVYEA++L+ +SK+KIN GVAICHIDTS+W
Sbjct  534  INGGAVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILEVESKAKINVGVAICHIDTSAW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGS PG+IEVCHWIFENDMTW +AD
Sbjct  594  SPDHGAFVALGSSPGQIEVCHWIFENDMTWTIAD  627



>emb|CCD74525.1| polygalacturonase 1 [Arabidopsis halleri subsp. halleri]
Length=626

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDIKD+MPKR+FLPR I S LPFS+S+IG + ++F A ++S+MA ++
Sbjct  413  RESMLKEGTLMQMPDIKDKMPKRTFLPRSIVSNLPFSSSEIGEIWRVFGAGENSSMAGII  472

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER  S+GETKRCV S EDMIDFATSVLGR VVVRTTEN  GS K I+IG + G
Sbjct  473  SSAVSECERPASKGETKRCVGSAEDMIDFATSVLGRGVVVRTTENVVGSKKKIVIGKVNG  532

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VT++VSCHQSL+PYL+YYCHSVP+VRVYEADLLDPKS  KINHGVAICHIDTS+W
Sbjct  533  INGGNVTRAVSCHQSLYPYLLYYCHSVPRVRVYEADLLDPKSLEKINHGVAICHIDTSAW  592

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGSGPG+IEVCHWIFENDMTW   D
Sbjct  593  SPSHGAFLALGSGPGRIEVCHWIFENDMTWNFVD  626



>ref|XP_008374449.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=629

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+ G +M MPDI+DRMP+RSFLPR I SKLPFST ++  +K++FHA ++S M ++L
Sbjct  416  RESMLRQGNVMVMPDIRDRMPERSFLPRGILSKLPFSTLRMSEIKEIFHAPENSAMERVL  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER PS GETKRCV SVEDMIDFA  VL RNVVVRTTEN  GS + +MIG++ G
Sbjct  476  TNALAECERDPSPGETKRCVASVEDMIDFAVLVLDRNVVVRTTENVSGSKRKVMIGAVSG  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG +TKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+LD +SKSKINHGVAICH DTSSW
Sbjct  536  INGGNITKSVSCHQSLYPYLLYYCHSVPRVRVYEADILDVESKSKINHGVAICHXDTSSW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGS PGKIEVCHWIFENDMTW +AD
Sbjct  596  SPGHGAFVALGSSPGKIEVCHWIFENDMTWTIAD  629



>ref|XP_010101197.1| hypothetical protein L484_015001 [Morus notabilis]
 gb|EXB87871.1| hypothetical protein L484_015001 [Morus notabilis]
Length=637

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK G +M MPDI+D+M KRSFLPR + +KLPFS  ++  LK +FHA D S M +++
Sbjct  423  RESALKKGNVMAMPDIRDKMRKRSFLPRYLLTKLPFSKMRLDELKVIFHAQDGSAMERVI  482

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DAL ECERAPS GETKRCV S EDMIDFA SVLGR+V VRTTEN  GS  ++MIG ++G
Sbjct  483  IDALDECERAPSPGETKRCVGSAEDMIDFAISVLGRDVAVRTTENVSGSKGEVMIGKVRG  542

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQS FPYL+YYCHSVPKVRVYEAD+LD KSK+KINHG+AICH+DTSSW
Sbjct  543  INGGNVTKSVSCHQSFFPYLLYYCHSVPKVRVYEADILDVKSKAKINHGIAICHLDTSSW  602

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            + +HGAF+ALGSGPGKIEVCHWIFENDMTW VAD
Sbjct  603  APSHGAFVALGSGPGKIEVCHWIFENDMTWTVAD  636



>ref|XP_008239752.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=627

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G ++ MPDI+D+MP+RSFLPR I SKLPFST  +  L+++FHA D+S M  +L
Sbjct  414  RESMLKQGNVVVMPDIRDKMPERSFLPRGILSKLPFSTPGLSELREIFHARDNSAMEHVL  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECERAPS GETK CV S+EDMIDFATSVLG NVVVRTTEN  GS + +MIG + G
Sbjct  474  TNALGECERAPSPGETKLCVGSIEDMIDFATSVLGHNVVVRTTENVSGSKQKVMIGMVSG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQ+L+PYL+YYCHSVPKVRVYEAD++D +SKSKIN GVAICHIDTSSW
Sbjct  534  INGGNVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADIVDVESKSKINQGVAICHIDTSSW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGS PGKIEVCHWIFENDMTWA+AD
Sbjct  594  SPGHGAFMALGSSPGKIEVCHWIFENDMTWAIAD  627



>ref|XP_010678748.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=628

 Score =   350 bits (897),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MP+I+D+MPKRSFLPRV++SKLPFSTS++  L+  F A ++ST+ +++
Sbjct  415  RESMLKPGTVMKMPNIEDKMPKRSFLPRVLSSKLPFSTSELVELRGTFKAKENSTLERVI  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECER PS+GETK+CV SVEDMIDFA SVLG NVVVRTTEN  GS K ++IG ++G
Sbjct  475  VNALGECERPPSQGETKKCVASVEDMIDFAISVLGDNVVVRTTENVHGSGKQVVIGLVRG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTKSVSCHQSL PYL+YYCHSVPKVRVYEAD+LD ++KSKIN GVAICH+DTS+W
Sbjct  535  INGGKVTKSVSCHQSLLPYLLYYCHSVPKVRVYEADILDMENKSKINQGVAICHLDTSAW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+ HGAF+ LGSGPG IEVCHWIFENDMTWAVAD
Sbjct  595  SAGHGAFLTLGSGPGLIEVCHWIFENDMTWAVAD  628



>ref|XP_008346742.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=630

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+ G +M MPDI+DRMP+RSFLPR I SKLPFST ++  +K++FHA ++S M ++L
Sbjct  417  RESMLRQGNVMVMPDIRDRMPERSFLPRGILSKLPFSTLRMSEIKEIFHAPENSAMERVL  476

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER PS GETKRCV SVEDMIDFA SVL RNVVVRTT+N  GS + +MIG++ G
Sbjct  477  TNALAECERDPSPGETKRCVGSVEDMIDFAVSVLDRNVVVRTTKNVSGSKQKVMIGAVSG  536

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            IN G +TKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+LD +SKSKINHGVAICH+DTSSW
Sbjct  537  INSGNITKSVSCHQSLYPYLLYYCHSVPRVRVYEADILDVESKSKINHGVAICHMDTSSW  596

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGS PGKIEVCHWIFENDMTW +AD
Sbjct  597  SPGHGAFVALGSSPGKIEVCHWIFENDMTWTIAD  630



>ref|XP_011071835.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Sesamum indicum]
Length=635

 Score =   350 bits (897),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MP+I+D MPKRSFLPR I SKLPFSTS++  LK+ FH  D+STM  ++
Sbjct  422  RESMLKEGTVMKMPNIRDWMPKRSFLPRPITSKLPFSTSELVELKRTFHIEDNSTMEHVV  481

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECERAPS GE KRCV SVEDMIDFA SVLG +VVVRTTE  +GS++D+MIG +KG
Sbjct  482  MNALAECERAPSTGENKRCVGSVEDMIDFAVSVLGHDVVVRTTEGVKGSSQDVMIGKVKG  541

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+L+ ++K+KINHGVAICH+DTS W
Sbjct  542  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILEVETKTKINHGVAICHLDTSMW  601

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG IEVCHWIFENDM W  AD
Sbjct  602  SPRHGAFLALGSGPGLIEVCHWIFENDMNWTTAD  635



>gb|AAB39538.1| aromatic rich glycoprotein JP630 [Arabidopsis thaliana]
Length=622

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT++ MPDIKD+MPKRSFLP  I SKLPFSTSKI  +K++FHA D+STM  ++
Sbjct  409  RESMLKEGTLIWMPDIKDKMPKRSFLPCSIVSKLPFSTSKIAEIKRVFHANDNSTMEGII  468

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             DA+ ECER P+  ETKRCV S EDMIDFATSVLGR+VV+RTTE+  GS + +MIG + G
Sbjct  469  TDAVRECERPPTVSETKRCVGSAEDMIDFATSVLGRSVVLRTTESVAGSKEKVMIGKVNG  528

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYE+DLLDPKSK+KINHG+AICH+DTS+W
Sbjct  529  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAW  588

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAF+ LGS PG+IEVCHWIFENDM WA+AD
Sbjct  589  GANHGAFMLLGSRPGQIEVCHWIFENDMNWAIAD  622



>ref|XP_006345047.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Solanum tuberosum]
Length=642

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDI+D+MP RSFLPR I+SKLPFST ++  LK +FHA ++STM  ++
Sbjct  429  RESMLKEGTVMKMPDIRDKMPGRSFLPRSISSKLPFSTKELTELKSIFHAQENSTMEHVI  488

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + L+ECERAPS GE K+CV S+EDMIDFA S+LG NVVVRTT+N  GS  ++MIG +KG
Sbjct  489  GNTLAECERAPSLGEKKQCVASMEDMIDFAVSILGHNVVVRTTDNVAGSKGEVMIGKVKG  548

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKV+VY+AD+L+  +K+KINHGVAICH+DTSSW
Sbjct  549  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVKVYQADILNVDTKAKINHGVAICHVDTSSW  608

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG IEVCHWIFENDMTWA+AD
Sbjct  609  SPGHGAFVALGSGPGLIEVCHWIFENDMTWAMAD  642



>ref|XP_004300895.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDIKD+MP+RSFLPR I SKLPFSTS++  LK+LFH  D+S   +++
Sbjct  420  RESMLKQGNVMVMPDIKDKMPERSFLPRTILSKLPFSTSRMSELKELFHVGDNSATERVI  479

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + L+ECERAPS GETK CV SVEDMIDF+ SVLG NVVVRTTEN  GS K++MIG + G
Sbjct  480  TNTLTECERAPSPGETKYCVGSVEDMIDFSVSVLGHNVVVRTTENVRGSKKNVMIGKVIG  539

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VT+SVSCHQSL+PYL+YYCHSVPKVRVYEAD++D +S++KINH VAICH+DTS+W
Sbjct  540  INGGRVTESVSCHQSLYPYLLYYCHSVPKVRVYEADIVDVESRNKINHAVAICHLDTSAW  599

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGS PG  EVCHWIFENDMTW VAD
Sbjct  600  SPGHGAFVALGSSPGNTEVCHWIFENDMTWTVAD  633



>ref|XP_004236111.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Solanum lycopersicum]
Length=636

 Score =   348 bits (892),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDI+D+MP RSFLPR I+SKLPFST ++  L+ +F A ++STM  ++
Sbjct  423  RESMLKEGTVMKMPDIRDKMPGRSFLPRTISSKLPFSTKELNELQSIFRARENSTMEHVI  482

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             + L+ECERAPS GE K+CV S+EDMIDFA S+LG NVVVRTT+N  GS  +IMIG +KG
Sbjct  483  GNTLAECERAPSPGENKQCVASIEDMIDFAVSILGHNVVVRTTDNVAGSMGEIMIGKVKG  542

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVY+AD+L+  +K KINHGVAICH+DTSSW
Sbjct  543  INGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYQADILNVDTKVKINHGVAICHVDTSSW  602

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG IEVCHWIFENDMTWA+AD
Sbjct  603  SPGHGAFVALGSGPGLIEVCHWIFENDMTWAMAD  636



>ref|NP_176242.1| polygalacturonase 1 [Arabidopsis thaliana]
 sp|O80760.1|Y639_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
At1g60390; AltName: Full=Aromatic-rich glycoprotein At1g60390; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24065.1| Strong similarity to AR0GP2 gene gb|1762634 from Lycopersicon 
esculentum [Arabidopsis thaliana]
 dbj|BAE99558.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33681.1| polygalacturonase 1 [Arabidopsis thaliana]
Length=624

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDIKD+MPKR+FLPR I   LPFS+S IG + ++F A ++S+MA ++
Sbjct  411  REAMLKEGTLMQMPDIKDKMPKRTFLPRNIVKNLPFSSSTIGEIWRVFGAGENSSMAGII  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER  S GETKRCV S EDMIDFATSVLGR VVVRTTEN  GS K ++IG + G
Sbjct  471  SSAVSECERPASHGETKRCVGSAEDMIDFATSVLGRGVVVRTTENVVGSKKKVVIGKVNG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VT++VSCHQSL+PYL+YYCHSVP+VRVYE DLLDPKS  KINHGVAICHIDTS+W
Sbjct  531  INGGDVTRAVSCHQSLYPYLLYYCHSVPRVRVYETDLLDPKSLEKINHGVAICHIDTSAW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGSGPG+IEVCHWIFENDMTW + D
Sbjct  591  SPSHGAFLALGSGPGQIEVCHWIFENDMTWNIID  624



>ref|XP_002511417.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF52019.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=637

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G ++ MPDI D+MPKRSFLPR I SKLPFS+ ++  LK++FHA ++STM  +L
Sbjct  424  RESMLKQGNVVVMPDITDKMPKRSFLPRSIVSKLPFSSPRLSELKEVFHALENSTMECVL  483

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER PS+GETKRCV SVEDMI+FA SVLG NVVVRTTEN  GS+K++MIG +KG
Sbjct  484  VNALAECEREPSQGETKRCVGSVEDMIEFAVSVLGHNVVVRTTENVHGSSKNVMIGRVKG  543

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVP+VRVYEA++LD +SK +IN GVAICHIDTS+W
Sbjct  544  INGGEVTKSVSCHQSLYPYLLYYCHSVPRVRVYEAEILDVESKERINLGVAICHIDTSAW  603

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+AL S PG+IEVCHWIFENDM+W VAD
Sbjct  604  SPNHGAFVALESSPGQIEVCHWIFENDMSWTVAD  637



>gb|EPS60630.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=595

 Score =   344 bits (882),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 183/212 (86%), Gaps = 1/212 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAAD-DSTMAKM  592
            RE MLKSGTIMPMPDI+D+MPKRSFLPR IASKLPFSTSKI  +  +F A D +S +++ 
Sbjct  384  RESMLKSGTIMPMPDIRDKMPKRSFLPRSIASKLPFSTSKIAEIAAIFRAGDGESKLSET  443

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            +A++L ECERAPS GETKRCV+S+EDMIDFATSVLGRN   RTT  T GS  +I IG +K
Sbjct  444  IANSLRECERAPSPGETKRCVSSIEDMIDFATSVLGRNSAARTTATTAGSGGEIKIGEVK  503

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            GI GG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYEADLL PK+ SKINHGVAICHIDT+S
Sbjct  504  GIAGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLHPKTDSKINHGVAICHIDTTS  563

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWA  136
            WS  HGAFIALG GPGKIEVCHWIF+NDMTWA
Sbjct  564  WSPDHGAFIALGPGPGKIEVCHWIFQNDMTWA  595



>ref|XP_007141610.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
 gb|ESW13604.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
Length=611

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 184/214 (86%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDI+D+MP+RSFLPRVI SKLPF+ S    + ++F     S++ K++
Sbjct  401  REFMLKEGTVMAMPDIRDKMPERSFLPRVILSKLPFTVS---GVNRVFEVGAGSSLDKIV  457

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D++SECER PS+GE+KRCV S+EDM+DFAT VLG NVVVRTTEN +GS  ++M+G + G
Sbjct  458  KDSVSECERVPSQGESKRCVGSMEDMVDFATGVLGSNVVVRTTENVKGSKGNVMVGWVNG  517

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VT+SVSCHQSLFPYL+YYCHSVPKVRVYEADLLDPKSK+KIN GVAICH+DTS+W
Sbjct  518  INGGRVTESVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKSKAKINRGVAICHLDTSAW  577

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGSGPG+IEVCHWIFENDMTW + D
Sbjct  578  SPSHGAFLALGSGPGQIEVCHWIFENDMTWTIGD  611



>ref|XP_010473218.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=629

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDIKD+MP+R+FLPR I S +PFS+S+IG ++++F A ++S+MA ++
Sbjct  416  RESMLKEGTLMQMPDIKDKMPERTFLPRSIVSSIPFSSSEIGEIRRVFGAGENSSMAGII  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER  S GETKRCV S EDMIDFATSVLGR VVVRTTE+  GS K I+IG + G
Sbjct  476  SSAVSECERPASHGETKRCVGSAEDMIDFATSVLGRGVVVRTTESVVGSKKKILIGKVNG  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VT++VSCHQSL+PYL+YYCHSVP+VRVYEAD+L+P+S  KINHGVAICH+DTS+W
Sbjct  536  INGGDVTRAVSCHQSLYPYLLYYCHSVPRVRVYEADILEPESLEKINHGVAICHVDTSAW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGS PG+IEVCHWIFENDMTW + D
Sbjct  596  SPSHGAFLALGSSPGRIEVCHWIFENDMTWNIVD  629



>emb|CDP00166.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   338 bits (867),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 186/215 (87%), Gaps = 4/215 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REK+LKSGT+MPMPDI+D+MPK SFLPRVIA+KLPFSTSKIG L ++FH  ++S + +M+
Sbjct  361  REKILKSGTVMPMPDIRDKMPKMSFLPRVIAAKLPFSTSKIGELNKIFHVRENSGIGRMI  420

Query  588  ADALSECERAPSRGE-TKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            +DAL+E  R  ++   TKRCV S EDMIDFATSVLGRNVVVRTTENT GS  +I+IGS+K
Sbjct  421  SDALNEFTRKNTKASITKRCVGSGEDMIDFATSVLGRNVVVRTTENTRGSRGNILIGSVK  480

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            GINGGKVTKSVSCH+SL P L+YYCHSVPKVRVYEAD+LDPK+K K+N GVAICH+DTSS
Sbjct  481  GINGGKVTKSVSCHRSLLPCLLYYCHSVPKVRVYEADILDPKTKDKVNRGVAICHVDTSS  540

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            WS  HGAFIALGSGPGKIEVC    +NDMTWAVAD
Sbjct  541  WSPGHGAFIALGSGPGKIEVC---LKNDMTWAVAD  572



>ref|XP_010510953.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=626

 Score =   339 bits (870),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDIKD+MPKR+FLPR I S +PFS+S+IG ++++F A  +S+M +++
Sbjct  413  RESMLKEGTLMQMPDIKDKMPKRTFLPRSIVSSIPFSSSEIGEIRRVFGAGVNSSMERII  472

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER  S GETKRCV S EDMIDFATSVLGR VVVRTTE+  GS + I+IG + G
Sbjct  473  SSAVSECERPASHGETKRCVGSAEDMIDFATSVLGRGVVVRTTESVIGSKQKIVIGKVNG  532

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VT++VSCHQSL+PYL+YYCHSVP+VRVYEADLL+P+S  KINHGVAICHIDTS+W
Sbjct  533  INGGDVTRAVSCHQSLYPYLLYYCHSVPRVRVYEADLLEPESLEKINHGVAICHIDTSAW  592

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGS PG+IEVCHWIFENDMTW + D
Sbjct  593  SPSHGAFLALGSSPGRIEVCHWIFENDMTWNIVD  626



>ref|XP_004138283.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN63588.1| Polygalacturonase-1 non-catalytic subunit beta [Cucumis sativus]
Length=645

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK G +M MPDIKD+MP RSFLPR I   LPFS+S+I   K++FHA D STM  ++
Sbjct  432  RESELKQGNVMVMPDIKDKMPPRSFLPRSILVNLPFSSSRISEAKEMFHARDGSTMESVI  491

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECERAPSRGETKRCV S EDMIDFAT+VLG+ VVVRTT N  GS + I IG +KG
Sbjct  492  TNALAECERAPSRGETKRCVGSAEDMIDFATTVLGQRVVVRTTANVNGSKEKIEIGRVKG  551

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG +T+SVSCHQSL+PYL+YYCHSVPKVR+YEAD+L  ++K KIN GVAICHIDTSSW
Sbjct  552  INGGDLTRSVSCHQSLYPYLLYYCHSVPKVRIYEADILKMETKEKINRGVAICHIDTSSW  611

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALGSGPG+IEVCHWIFENDM+W VAD
Sbjct  612  GPEHGAFVALGSGPGQIEVCHWIFENDMSWNVAD  645



>gb|KHG12475.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=649

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 181/214 (85%), Gaps = 4/214 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE +LK G +M MPDI+D+MP+RSFLPR I SKLPFSTS +  L+ +F A    +M  ML
Sbjct  440  RESVLKQGNVMVMPDIRDKMPRRSFLPRGILSKLPFSTSHLSELRNIFGA----SMEGML  495

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER  SRGETKRCV SVEDMIDFATSVLG +V VRTTEN +GS ++IMIG +KG
Sbjct  496  ENALTECERPASRGETKRCVGSVEDMIDFATSVLGLSVTVRTTENVKGSKQEIMIGEVKG  555

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVR YEA++LD  SKSKINHGVAICH+DTS+W
Sbjct  556  INGGEVTKSVSCHQSLYPYLLYYCHSVPKVRGYEAEILDVTSKSKINHGVAICHLDTSAW  615

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGS PG++EVCHWIFENDMTW + D
Sbjct  616  SPTHGAFLALGSSPGQVEVCHWIFENDMTWTIVD  649



>ref|XP_008453099.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=648

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK G +M MPDI+D+MP RSFLPR I   LPFS+S+I   K++FHA D STM  ++
Sbjct  435  RESELKQGNVMVMPDIRDKMPPRSFLPRAILVNLPFSSSRISEAKEMFHARDGSTMESVI  494

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECERAPSRGETKRCV S EDMIDFAT+VLGR VVVRTT N  GS + + IG +KG
Sbjct  495  TNALAECERAPSRGETKRCVGSAEDMIDFATTVLGRRVVVRTTANVNGSKEKVEIGRVKG  554

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG +T+SVSCHQSL+PYL+YYCHSVPKVR+YEAD+L  ++K KIN GVAICHIDTSSW
Sbjct  555  INGGNLTRSVSCHQSLYPYLLYYCHSVPKVRIYEADILRVETKEKINRGVAICHIDTSSW  614

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALGS PG+IEVCHWIFENDM+W+VAD
Sbjct  615  GPEHGAFVALGSSPGQIEVCHWIFENDMSWSVAD  648



>ref|XP_010417970.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=628

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDIKD+MP+R+FLPR I S +PFS+S+IG ++++F A ++S+M+ ++
Sbjct  415  RESMLKEGTLMQMPDIKDKMPERTFLPRSIVSSIPFSSSEIGEIRRVFGAGENSSMSGII  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER  S GETKRCV S EDMIDFATSVLGR +VVRTTE+  GS K I+IG + G
Sbjct  475  SSAVSECERPASHGETKRCVGSAEDMIDFATSVLGRGIVVRTTESVVGSKKKIVIGKVNG  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VT++VSCHQSL+PYL+YYCHSVP+VRVYEAD+L+P+S  KINHGVAICH+DTS+W
Sbjct  535  INGGDVTRAVSCHQSLYPYLLYYCHSVPRVRVYEADILEPESLEKINHGVAICHVDTSAW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGS PG+IEVCHWIFENDMTW + D
Sbjct  595  SPSHGAFLALGSSPGRIEVCHWIFENDMTWNIVD  628



>ref|XP_002886622.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62881.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M +PDIKD+MPKR+FLPR I S LPFS+S+IG +  +F A ++S+MA ++
Sbjct  412  RESMLKEGTLMQLPDIKDKMPKRTFLPRNIVSNLPFSSSEIGEIWGVFGAGENSSMAGII  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER  S+GETKRCV S EDMIDFATSVLG  VVVRTTEN  GS K ++IG +  
Sbjct  472  SSAVSECERPASKGETKRCVGSAEDMIDFATSVLGSGVVVRTTENVVGSKKKVVIGKVNR  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG  T++VSCHQSL+PYL+YYCHSVP+VRVYE DLLDPKS  KINHGVAICHIDTS+W
Sbjct  532  INGGDETRAVSCHQSLYPYLLYYCHSVPRVRVYETDLLDPKSLEKINHGVAICHIDTSAW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGSGPG+IEVCHWIFENDMTW + D
Sbjct  592  SPSHGAFLALGSGPGRIEVCHWIFENDMTWNIID  625



>ref|XP_004166494.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
Length=688

 Score =   340 bits (872),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK G +M MPDIKD+MP RSFLPR I   LPFS+S+I   K++FHA D STM  ++
Sbjct  475  RESELKQGNVMVMPDIKDKMPPRSFLPRSILVNLPFSSSRISEAKEMFHARDGSTMESVI  534

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECERAPSRGETKRCV S EDMIDFAT+VLG+ VVVRTT N  GS + I IG +KG
Sbjct  535  TNALAECERAPSRGETKRCVGSAEDMIDFATTVLGQRVVVRTTANVNGSKEKIEIGRVKG  594

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG +T+SVSCHQSL+PYL+YYCHSVPKVR+YEAD+L  ++K KIN GVAICHIDTSSW
Sbjct  595  INGGDLTRSVSCHQSLYPYLLYYCHSVPKVRIYEADILKMETKEKINRGVAICHIDTSSW  654

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALGSGPG+IEVCHWIFENDM+W VAD
Sbjct  655  GPEHGAFVALGSGPGQIEVCHWIFENDMSWNVAD  688



>gb|KJB30299.1| hypothetical protein B456_005G136300 [Gossypium raimondii]
Length=649

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 181/214 (85%), Gaps = 4/214 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE +LK G +M MPDI+D+MP+RSFLPR I SKLPFSTS +  L+ +F A    +M  ML
Sbjct  440  RESVLKQGNVMVMPDIRDKMPRRSFLPRGILSKLPFSTSHLSELRNIFGA----SMEGML  495

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL+ECER  SRGETKRCV SVEDMIDFATSVLG +V VRTTEN +GS ++IMIG +KG
Sbjct  496  ENALTECERPASRGETKRCVGSVEDMIDFATSVLGHSVTVRTTENVKGSKQEIMIGEVKG  555

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG+VTKSVSCHQSL+PYL+YYCHSVPKVRVYEA++LD  SKSKIN+GVAICH+DTS+W
Sbjct  556  INGGEVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILDVTSKSKINYGVAICHLDTSAW  615

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+AL S PG+IEVCHWIFENDMTW + D
Sbjct  616  SPTHGAFLALRSSPGQIEVCHWIFENDMTWTIVD  649



>ref|XP_008800877.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=637

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 175/214 (82%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT+MPMPDI DRMP RSFLPR IA ++PFS +++   +++F+   D+ + K  
Sbjct  427  RESELKKGTVMPMPDISDRMPARSFLPRSIAGRIPFSAAEV---QRVFNMPADTALGKAA  483

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            AD ++ECER PSRGETKRC TS ED+IDFA SVLG NVVVR+TENT GS   I+IG +KG
Sbjct  484  ADTVAECERPPSRGETKRCATSAEDVIDFAVSVLGNNVVVRSTENTNGSKGSILIGEVKG  543

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGG VTKSVSCHQSLFPYLVYYCHSVPKVRVY+A++L  K+K KINHGVAICH+DTS W
Sbjct  544  VNGGSVTKSVSCHQSLFPYLVYYCHSVPKVRVYQAEILAVKTKEKINHGVAICHVDTSDW  603

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALG GPGKIEVCHWIF+ DMTW VAD
Sbjct  604  SPAHGAFVALGPGPGKIEVCHWIFQGDMTWTVAD  637



>emb|CDY53059.1| BnaA09g14240D [Brassica napus]
Length=623

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+M MPDIKD+MPKR+FLPR I SKL FS+SK G ++++F A ++S+MA ++
Sbjct  410  RESMLKEGTLMQMPDIKDKMPKRTFLPRTIVSKLSFSSSKTGEVRRIFGAGENSSMAGII  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER PS GETKRCV S EDMIDFATSVLG  VVVRTTEN  GS K I+IG +KG
Sbjct  470  SSAISECERPPSYGETKRCVGSAEDMIDFATSVLGHGVVVRTTENVVGSKKKIVIGKVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG +T++VSCHQSL+PYL+YYCHSVPKVRVYEADLLDP+S  KINHG+AICHIDTS+W
Sbjct  530  INGGDLTRAVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPESSEKINHGIAICHIDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S++HGAF+ALGSGPG+IEVCHWIFENDMTW   D
Sbjct  590  SASHGAFLALGSGPGRIEVCHWIFENDMTWTTVD  623



>ref|XP_010936822.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=615

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 179/215 (83%), Gaps = 4/215 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK+GT MPMPDI+D+MPKRSFLPR IA KLPFS +   AL  LF  + DS M + +
Sbjct  404  RESSLKNGTAMPMPDIRDKMPKRSFLPRSIAEKLPFSAT---ALAPLFGVSMDSAMGRAM  460

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGR-NVVVRTTENTEGSTKDIMIGSIK  412
            A+ ++ECERAPSRGETKRCV S+EDM+DFA S+LG  NVVVR+TEN  GS  +I++G++ 
Sbjct  461  AETVAECERAPSRGETKRCVASMEDMVDFAASMLGDDNVVVRSTENVRGSGGNILVGNVT  520

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            GINGGKVT+SVSCHQSLFPYLVYYCHSVPKVR YEAD+LD ++  +INHGVAICH+DTS 
Sbjct  521  GINGGKVTRSVSCHQSLFPYLVYYCHSVPKVRAYEADILDVETGERINHGVAICHLDTSD  580

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            WS  HGAF+ALGSGPGKIEVCHWIFE DMTW VAD
Sbjct  581  WSPGHGAFVALGSGPGKIEVCHWIFEGDMTWTVAD  615



>ref|XP_010924225.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   334 bits (857),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 178/214 (83%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L+ GT+MPMPDI DRMP RSFLPR IA ++PFS +++   +++F+   D+ + K +
Sbjct  426  RESELQKGTVMPMPDIGDRMPARSFLPRSIAGRIPFSATEV---QRVFNIPADTALGKAV  482

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            AD ++ECER PSRGETKRC TS ED+IDFA SVLG NVVVR+TENT GS  +I+IG ++G
Sbjct  483  ADTVAECERPPSRGETKRCATSAEDVIDFAVSVLGSNVVVRSTENTGGSKGNILIGKVEG  542

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGG +TKSVSCHQSLFPYLVYYCHSVPKVRV+EAD+L  K+K KINHGVAICH+DTS W
Sbjct  543  VNGGNITKSVSCHQSLFPYLVYYCHSVPKVRVHEADILAVKTKEKINHGVAICHLDTSDW  602

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGSGPG+IEVCHWIF+ DMTW VAD
Sbjct  603  SPAHGAFVALGSGPGQIEVCHWIFQGDMTWTVAD  636



>ref|XP_008776735.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=641

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT+MPMPDI+D+MP RSFLPR IA ++PFS +++   +Q+F+   D+ + K +
Sbjct  431  RESELKKGTVMPMPDIRDKMPARSFLPRSIAGRIPFSAAEV---QQVFNIPADTALGKAV  487

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D ++ECER PSRGETKRC TS ED+IDFA SVLG NVVVR+TE+T+GS  +I++G  +G
Sbjct  488  EDTVAECERPPSRGETKRCATSAEDVIDFAVSVLGNNVVVRSTESTDGSKGNILVGDTRG  547

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGK+TKSVSCHQSLFPYLVYYCHSVPKVRVY+A++L  ++K KINHGVAICH+DTS W
Sbjct  548  VNGGKITKSVSCHQSLFPYLVYYCHSVPKVRVYDAEILSVQTKKKINHGVAICHLDTSDW  607

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+ HGAF+ALGSGPGKIEVCHWIF+ DMTW VAD
Sbjct  608  SAGHGAFVALGSGPGKIEVCHWIFQGDMTWTVAD  641



>ref|XP_010553600.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Tarenaya hassleriana]
Length=626

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+ GT+M MPDI+D+MP+R+FLPR I +KLPFS+S    + ++F AA++S++++++
Sbjct  412  REAMLREGTLMQMPDIRDKMPRRTFLPRAITAKLPFSSSTTREILRIFSAAENSSISRII  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A++ECER PSRGE KRCV S EDMIDFATS+LGR+V VRTTE+  GS   I IG + G
Sbjct  472  SYAVAECERPPSRGEVKRCVGSAEDMIDFATSMLGRHVAVRTTESVAGSKGTIEIGKVNG  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVT+SVSCHQ+L+PYL+YYCHSVP+VRVYE DLLDPKS+ KINHGVAICH+DTS+W
Sbjct  532  INGGKVTRSVSCHQTLYPYLLYYCHSVPRVRVYEVDLLDPKSRVKINHGVAICHVDTSAW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAV  133
            S  HGAF+ALG GPG+IEVCHWIFENDMTW +
Sbjct  592  SPGHGAFLALGPGPGRIEVCHWIFENDMTWII  623



>emb|CDX68345.1| BnaA07g23850D [Brassica napus]
Length=618

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 182/214 (85%), Gaps = 7/214 (3%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I SKLPFSTSK+  +K +FHA D+S+M K++
Sbjct  412  RESTLKEGTVIPMPDIKDKMPKRSFLPRSIVSKLPFSTSKLAEVKTIFHAGDNSSMEKII  471

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RTTE+  GS + ++IG + G
Sbjct  472  SDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTESVAGSKQKVVIGKVNG  531

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGK+T++VSCHQSL+PYL+YYCHSVPKVRVYEADLL+  SK+KINHG+AICHIDTSSW
Sbjct  532  INGGKLTEAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKTKINHGIAICHIDTSSW  591

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGS PG+I       ENDM WA+AD
Sbjct  592  SPTHGAFLALGSKPGRI-------ENDMNWAIAD  618



>gb|KFK44451.1| hypothetical protein AALP_AA1G258600 [Arabis alpina]
Length=621

 Score =   332 bits (850),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT++ MPDIKDRMPKRSFLPR I SK+PFSTSKI  +K +FHA D+STM  ++
Sbjct  408  RESMLKEGTLVSMPDIKDRMPKRSFLPRSIISKIPFSTSKIAEIKGVFHARDNSTMEGII  467

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            ++A++ECER  + GETKRCV S EDMIDFATSVLGR VV+RTT++  GS K ++IG +KG
Sbjct  468  SNAITECERPSTVGETKRCVGSAEDMIDFATSVLGRRVVLRTTKSVAGSKKKVVIGKVKG  527

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG VTKSVSCHQSL+PYL+YYCHSVPKVRVYE+DLLDPKSK KINHG+AICH+DTS+W
Sbjct  528  INGGNVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKVKINHGIAICHMDTSAW  587

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             + HGAF++LGS PG+IE+CHWIFENDM W++AD
Sbjct  588  GANHGAFVSLGSRPGQIEICHWIFENDMNWSIAD  621



>ref|XP_009113216.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Brassica rapa]
Length=623

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT+  MPDIKD+MPKR+FLPR I SKL FS+SK G + ++F A ++S+MA ++
Sbjct  410  RESMLKEGTLTQMPDIKDKMPKRTFLPRTIVSKLSFSSSKTGEVWRIFGAGENSSMAGII  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER PS GETKRCV S EDMIDFATSVLG  VVVRTTEN  GS K I+IG +KG
Sbjct  470  SSAISECERPPSYGETKRCVGSAEDMIDFATSVLGHGVVVRTTENVVGSKKKIVIGKVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG +T++VSCHQSL+PYL+YYCHSVPKVRVYEADLLDP+S  KINHG+AICHIDTS+W
Sbjct  530  INGGDLTRAVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPESSEKINHGIAICHIDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S++HGAF+ALGSGPG+IEVCHWIFENDMTW   D
Sbjct  590  SASHGAFVALGSGPGRIEVCHWIFENDMTWTTVD  623



>ref|XP_010925453.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   330 bits (846),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 179/214 (84%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT+MPMPDI+D+MP RSFLPR I+ ++PFS +++   +++F+   D+ + K +
Sbjct  426  RESQLKKGTVMPMPDIRDKMPARSFLPRSISGRIPFSAAEV---QRVFNIPADTALGKAV  482

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            AD ++ECER PSRGETKRC TS ED+IDFA SVLG NV+VR+TE+T GS  +I++G + G
Sbjct  483  ADTVAECERPPSRGETKRCATSAEDVIDFAVSVLGNNVIVRSTESTSGSKGNILLGDVTG  542

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGK+TKSVSCHQSLFPYLVYYCHSVPKVRVY+A++L  ++K KINHGVAICH+DTS W
Sbjct  543  VNGGKITKSVSCHQSLFPYLVYYCHSVPKVRVYQAEILSVQTKKKINHGVAICHLDTSDW  602

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S+ HGAF+ALG GPGKIEVCHWIF+ DMTW VAD
Sbjct  603  SAGHGAFVALGYGPGKIEVCHWIFQGDMTWTVAD  636



>gb|KHN30893.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=541

 Score =   327 bits (838),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE M+K G ++PMPDIKD+MP RSFLP  IASKLPFS+S+I  ++++FH  + S+  +++
Sbjct  328  RESMVKEGNVIPMPDIKDKMPARSFLPLAIASKLPFSSSRINEMREVFHTREGSSTERVM  387

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
              AL ECERAPS+GETKRCV+S E+MI FA SVLG NV VR+TEN  GS   +MIG +  
Sbjct  388  VKALKECERAPSKGETKRCVSSAEEMIGFAVSVLGPNVAVRSTENLNGSGSSVMIGKVHS  447

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I+GGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEA++LD  +  KINHGVAICH+DTS+W
Sbjct  448  IDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILDVDTLEKINHGVAICHLDTSAW  507

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
               HGAF+ALG GPGKIEVCHWIFEND+TW  A
Sbjct  508  GPQHGAFLALGFGPGKIEVCHWIFENDLTWTTA  540



>ref|XP_003601289.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES71540.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=628

 Score =   329 bits (844),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI D+MP RSFLP  I+SKLPFS+S++  +K+ FHA D S   +++
Sbjct  415  RESMLKEGNVMVMPDIGDKMPARSFLPLSISSKLPFSSSRLSEIKEAFHARDGSATERVI  474

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECER PS GETKRCV S E MIDF+ S+LG NVVV+TTEN  GS + +MIG +  
Sbjct  475  FNALKECEREPSVGETKRCVGSAEGMIDFSVSILGPNVVVKTTENVNGSKRTVMIGKVDA  534

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
             +GGKV KSVSCH SL+PYL+YYCHSVPKVRVYEAD+LD  +KSKINHGVAICHIDTSSW
Sbjct  535  TDGGKVIKSVSCHPSLYPYLLYYCHSVPKVRVYEADILDVDTKSKINHGVAICHIDTSSW  594

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
             S HGAF+ALGSGPGKIEVCHWIFENDMTW  +
Sbjct  595  GSKHGAFLALGSGPGKIEVCHWIFENDMTWTTS  627



>ref|XP_004501939.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=627

 Score =   329 bits (844),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDIKD+MP R FLP  I+SKLPFS+S++G +K+ FHA + S   +++
Sbjct  414  RESMLKEGNVMMMPDIKDKMPARMFLPLTISSKLPFSSSRLGEVKEAFHAREGSATERVI  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECERAPS  ETKRCV S E MI+FA SVLG NVVVRTTE+ +GS   +MIG + G
Sbjct  474  INALGECERAPSMDETKRCVGSAEGMIEFAVSVLGPNVVVRTTESVKGSKTSVMIGKVYG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I+GGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LD  +K KIN GVAICHIDTS+W
Sbjct  534  IDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDVDTKKKINQGVAICHIDTSAW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
               HGAF ALGSGPGKIEVCHWIFENDMTW  A
Sbjct  594  GPEHGAFSALGSGPGKIEVCHWIFENDMTWTTA  626



>gb|KCW86729.1| hypothetical protein EUGRSUZ_B03340 [Eucalyptus grandis]
Length=256

 Score =   317 bits (811),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPD++D +PKRSFLPR I+S+LPFSTSK+  LKQ+F A ++S M K++
Sbjct  42   RESMLKSGNVMPMPDMRDNLPKRSFLPRCISSELPFSTSKLAELKQIFRAIENSAMGKIM  101

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  L ECE A  + E+KRCV S+EDMIDF TSVLG +V+VR+TE+  GS ++++IG +K 
Sbjct  102  AQTLGECEGAGVQDESKRCVASIEDMIDFTTSVLGHDVMVRSTESARGSKQEVLIGVVKR  161

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G +V+K V+CHQSLFPY+VYYCH+ P VRVYEAD+LDPKSK+KINHGVAICH++TS+W
Sbjct  162  IEGSEVSKPVACHQSLFPYIVYYCHTFPNVRVYEADILDPKSKAKINHGVAICHMNTSTW  221

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            S TH +F+ LGSGPG+IEVCHWI+EN + W +A
Sbjct  222  SPTHESFLLLGSGPGQIEVCHWIYENSLIWTIA  254



>ref|XP_006392169.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
 gb|ESQ29455.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
Length=622

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK GT M MPDIKD+MPKR+FLPR I S LPFS+ + G ++++F A ++S+MA+++
Sbjct  409  RESMLKEGTSMQMPDIKDKMPKRTFLPRAIVSNLPFSSPETGKIRRIFGAGENSSMAEII  468

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER PS GETKRCV S EDMIDFATSVLGR VVVRTTEN  GS K I+IG +KG
Sbjct  469  SSAISECERLPSHGETKRCVGSAEDMIDFATSVLGRGVVVRTTENVVGSKKKIVIGKVKG  528

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG +T++VSCHQSL+PYL+YYCHSVP+VRVYE D+LDP++  KINHGVAICHIDTS+W
Sbjct  529  INGGNLTRAVSCHQSLYPYLLYYCHSVPRVRVYETDILDPENLEKINHGVAICHIDTSAW  588

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALGS PG+IEVCHWIFENDMTW + D
Sbjct  589  SPSHGAFLALGSSPGRIEVCHWIFENDMTWTIVD  622



>ref|XP_009393062.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 175/214 (82%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L+ G++MPMPDI+D+MP RSFLPR IA ++PFS +++   +++F    D+ + K +
Sbjct  441  REHDLRRGSVMPMPDIRDKMPPRSFLPRSIAGRIPFSPAEV---RRIFGIPADTALGKAV  497

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             D ++ECERAPSRGETKRC TS ED+IDFA SVLG +VVVR+T  T GS  D++IG + G
Sbjct  498  GDTVAECERAPSRGETKRCATSAEDVIDFAVSVLGSDVVVRSTATTAGSNADVLIGRVSG  557

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
             NGGKVT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD+L   SK KINHGVAICH+DTS+W
Sbjct  558  ANGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAVHSKQKINHGVAICHLDTSAW  617

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAF+ALGS PGKIEVCHWIFE DMTW VAD
Sbjct  618  SPTHGAFVALGSAPGKIEVCHWIFEGDMTWTVAD  651



>emb|CDY47228.1| BnaC09g14770D [Brassica napus]
Length=623

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+ GT+M MPDIKD+MPKR+FLPR I SKL FS+SK G + ++F A ++S+MA ++
Sbjct  410  RESMLREGTLMQMPDIKDKMPKRTFLPRTIVSKLSFSSSKTGEVWRIFGAGENSSMAGII  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            + A+SECER PS GETKRCV S EDMIDFATSVLG  VVVRTTEN  GS K I+IG +KG
Sbjct  470  SSAISECERPPSYGETKRCVGSAEDMIDFATSVLGHGVVVRTTENVVGSKKKIVIGKVKG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGG +T++VSCHQSL+PYL+YYCHSVPKVRVYEADLLDP+S  KINHG+AICHIDTS+W
Sbjct  530  INGGDLTRAVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPESSEKINHGIAICHIDTSAW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S++H AF+ALGSGPG+IEVCHWIFENDMTW   D
Sbjct  590  SASHVAFLALGSGPGRIEVCHWIFENDMTWTTVD  623



>ref|XP_010044627.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010044628.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X2 [Eucalyptus grandis]
Length=372

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPD++D  PK SFLPR I+SKLPFSTSK+  LKQ+FHA ++STM K++
Sbjct  159  RESMLKSGNVMPMPDLRDNFPKTSFLPRRISSKLPFSTSKLAELKQIFHAIENSTMEKIM  218

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  L  CE A  + ETKRCV S+EDMIDFATSVLG +V+VR+TE+  GS ++++IG ++ 
Sbjct  219  AQTLGLCEGAALQDETKRCVASIEDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVRR  278

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G + +K V+CHQSLFPY+VYYCH+ P VRVYEAD+LDPKSK+KINHGVAICH+DTS+W
Sbjct  279  IEGSEGSKPVACHQSLFPYIVYYCHAFPNVRVYEADILDPKSKAKINHGVAICHMDTSTW  338

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            S  HG+F+ LGSGPG+IEVCHWI EN+M W +A
Sbjct  339  SPAHGSFLLLGSGPGQIEVCHWINENNMMWTIA  371



>ref|XP_006578624.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=631

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE M+K G ++PMPDIKD+MP RSFLP  IASKLPFS+S+I  ++++FH  + S+  +++
Sbjct  418  RESMVKEGNVIPMPDIKDKMPARSFLPLAIASKLPFSSSRINEMREVFHTREGSSTERVM  477

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
              AL ECERAPS+GETKRCV+S E+MI FA SVLG NV VR+TEN  GS   +MIG +  
Sbjct  478  VKALKECERAPSKGETKRCVSSAEEMIGFAVSVLGPNVAVRSTENLNGSGSSVMIGKVHS  537

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I+GGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEA++LD  +  KINHGVAICH+DTS+W
Sbjct  538  IDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILDVDTLEKINHGVAICHLDTSAW  597

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
               HGAF+ALG GPGKIEVCHWIFEND+TW  A
Sbjct  598  GPQHGAFLALGFGPGKIEVCHWIFENDLTWTTA  630



>ref|XP_003610589.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES92786.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=190

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 169/205 (82%), Gaps = 16/205 (8%)
 Frame = -3

Query  738  MPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLADALSECERA  559
            MPMPDI+D++PKRSFLP+ I +KLPFSTSKI  +K                D+L ECER 
Sbjct  1    MPMPDIRDKLPKRSFLPQSILAKLPFSTSKIDEMK---------------GDSLGECERV  45

Query  558  PSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGIN-GGKVTKS  382
            P+RGETK+CV S+EDMIDFA SVLGRNVVVRTTEN  GS KD+M+G + GIN GGK+T++
Sbjct  46   PARGETKKCVGSIEDMIDFAASVLGRNVVVRTTENVNGSKKDLMVGHVSGINNGGKMTRT  105

Query  381  VSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAFIA  202
            VSCHQSLF YL+YYCHSVPKVRVY+A+LLDPK K KIN GVA+CH+DTS WS THGAF++
Sbjct  106  VSCHQSLFQYLLYYCHSVPKVRVYQAELLDPKIKDKINQGVAVCHLDTSDWSPTHGAFVS  165

Query  201  LGSGPGKIEVCHWIFENDMTWAVAD  127
            LGSGPG+IEVCHWIFENDM+WAVAD
Sbjct  166  LGSGPGQIEVCHWIFENDMSWAVAD  190



>gb|KCW86723.1| hypothetical protein EUGRSUZ_B03334 [Eucalyptus grandis]
Length=260

 Score =   314 bits (804),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPDI+D +PKRSFLPR I+++LPFSTSK+  LKQ+FHA ++S M K++
Sbjct  46   RESMLKSGNVMPMPDIRDNLPKRSFLPRCISAELPFSTSKLAELKQIFHAIENSAMGKIM  105

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  L ECE A  + ETKRCV S+EDMIDFATSVLG +V+VR+TE+  GS ++++IG +K 
Sbjct  106  AQTLGECEGAALQDETKRCVASIEDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVKR  165

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G +V+K V+CH+ LFPY+VYYCHS P VR YEAD+LDPKSK+KINHGVAICH++TS+W
Sbjct  166  IEGSEVSKPVACHRRLFPYIVYYCHSFPNVRSYEADILDPKSKAKINHGVAICHMNTSTW  225

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            S  H +F+ LGSGPG+IEVCHWI+EN+  W +A
Sbjct  226  SPIHESFLLLGSGPGQIEVCHWIYENNPIWTIA  258



>gb|KCW86730.1| hypothetical protein EUGRSUZ_B03341 [Eucalyptus grandis]
Length=272

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPD++D +PKRSFLPR I+S+LPFSTSK+  LKQ+F A ++S + K++
Sbjct  58   RESMLKSGNVMPMPDMRDNLPKRSFLPRCISSELPFSTSKLAELKQIFRAIENSAVGKIM  117

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  L ECE A  + ETKRCV S+EDMIDFATSVLG +V+VR+TE+  GS ++++IG +K 
Sbjct  118  AQTLGECEGAGVQDETKRCVASIEDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVKR  177

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G +V+K V+CH+ LFPY+VYYCH+ P VRVYEAD+LDPKSK+KINHGVAICH+DTS+W
Sbjct  178  IEGSEVSKPVACHEILFPYIVYYCHTFPNVRVYEADILDPKSKAKINHGVAICHMDTSTW  237

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            S  HG+F  LGSGPG+IEVCHWI++N++ W +A
Sbjct  238  SPAHGSFQLLGSGPGQIEVCHWIYDNNLIWTIA  270



>gb|KCW86720.1| hypothetical protein EUGRSUZ_B03328 [Eucalyptus grandis]
Length=212

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  759  MLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLADA  580
            MLKSG +MPMPDI+D +P+RSFLPR I+S++PFSTSK+  LKQ+FHA ++S M K++A  
Sbjct  1    MLKSGNVMPMPDIRDNLPRRSFLPRGISSEMPFSTSKLAELKQIFHATENSAMEKIMAQI  60

Query  579  LSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGING  400
            L +CE A  + ETKRCV S+EDMID ATSVLG +V+VR+TE+  GS ++++IG +K I+G
Sbjct  61   LGQCEVAALQDETKRCVASIEDMIDLATSVLGHDVMVRSTESAGGSKQEVLIGVVKRIDG  120

Query  399  GKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSST  220
             +V+K V+CHQ LFPY VYYCH+ P VR+YEAD+LDPKSK+KINHGVAICH+DTS+W  T
Sbjct  121  SEVSKPVACHQILFPYAVYYCHAFPNVRIYEADILDPKSKAKINHGVAICHMDTSAWGPT  180

Query  219  HGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            + AF+ LGSGPG+IEVCHWI+EN+M W +A
Sbjct  181  YEAFLLLGSGPGQIEVCHWIYENNMIWTIA  210



>ref|XP_010046642.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=367

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPDI+D +P+RSFLPR I+S++PFSTSK+  LKQ+FHA ++S M K++
Sbjct  153  RESMLKSGNVMPMPDIRDNLPRRSFLPRGISSEMPFSTSKLAELKQIFHATENSAMEKIM  212

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  L +CE A  + ETKRCV S+EDMID ATSVLG +V+VR+TE+  GS ++++IG +K 
Sbjct  213  AQILGQCEVAALQDETKRCVASIEDMIDLATSVLGHDVMVRSTESAGGSKQEVLIGVVKR  272

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I+G +V+K V+CHQ LFPY VYYCH+ P VR+YEAD+LDPKSK+KINHGVAICH+DTS+W
Sbjct  273  IDGSEVSKPVACHQILFPYAVYYCHAFPNVRIYEADILDPKSKAKINHGVAICHMDTSAW  332

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
              T+ AF+ LGSGPG+IEVCHWI+EN+M W +A
Sbjct  333  GPTYEAFLLLGSGPGQIEVCHWIYENNMIWTIA  365



>ref|XP_003528153.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=629

 Score =   324 bits (830),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 174/214 (81%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  ++ G ++PMPDIKD+MP RSFLP  IASKLPFS+S+I  ++++FHA + S+  +++
Sbjct  416  RESTVREGNVIPMPDIKDKMPARSFLPLAIASKLPFSSSRIDEMREIFHAREGSSTERVM  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECER PS+ ETKRCV+S E+MI FA SVLG NV VR+TEN  GS   +MIG +  
Sbjct  476  VNALKECEREPSKDETKRCVSSGEEMIGFAVSVLGPNVAVRSTENVNGSGSSVMIGKVYA  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I+GGKVTKSVSCHQSL+PYL+YYCHSVPKVRVYEA++LD  +K  INHGVAICH+DTS+W
Sbjct  536  IDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILDVDTKEMINHGVAICHLDTSAW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
               HGAF+ALG GPGKIEVCHWIFENDMTW  A+
Sbjct  596  GPQHGAFLALGFGPGKIEVCHWIFENDMTWTTAN  629



>ref|XP_010028282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
 gb|KCW83445.1| hypothetical protein EUGRSUZ_B00367 [Eucalyptus grandis]
Length=643

 Score =   324 bits (831),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L+ GT+M MPDI D+MP+RSFLPR IASKLPFST ++  +K+LF   + S    ++
Sbjct  430  RESELRPGTVMQMPDIVDKMPRRSFLPRAIASKLPFSTQRLQEVKELFAVQEGSATEHVI  489

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECER PSRGE KRCV S EDM+DFA+S+LGR++ VRTTEN  GS + ++IGS++G
Sbjct  490  LNALRECERPPSRGEMKRCVGSAEDMVDFASSILGRSITVRTTENVNGSKQKVVIGSVRG  549

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I GG+ TKSVSCHQSL+PYL+YYCH+VPKV+VYEAD+L+   +S+INHGVAICH+DTSSW
Sbjct  550  IKGGEPTKSVSCHQSLYPYLLYYCHAVPKVKVYEADILNFVGRSRINHGVAICHLDTSSW  609

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALGS PG+IEVCHWIFENDMTW V D
Sbjct  610  SPDHGAFVALGSRPGQIEVCHWIFENDMTWTVVD  643



>ref|XP_010046648.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=383

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPD++D +PKRSFLPR I+S+LPFSTSK+  LKQ+F A ++S + K++
Sbjct  169  RESMLKSGNVMPMPDMRDNLPKRSFLPRCISSELPFSTSKLAELKQIFRAIENSAVGKIM  228

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  L ECE A  + ETKRCV S+EDMIDFATSVLG +V+VR+TE+  GS ++++IG +K 
Sbjct  229  AQTLGECEGAGVQDETKRCVASIEDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVKR  288

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G +V+K V+CH+ LFPY+VYYCH+ P VRVYEAD+LDPKSK+KINHGVAICH+DTS+W
Sbjct  289  IEGSEVSKPVACHEILFPYIVYYCHTFPNVRVYEADILDPKSKAKINHGVAICHMDTSTW  348

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            S  HG+F  LGSGPG+IEVCHWI++N++ W +A
Sbjct  349  SPAHGSFQLLGSGPGQIEVCHWIYDNNLIWTIA  381



>ref|XP_007138090.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
 gb|ESW10084.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
Length=627

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ++K G ++ MPDI+D+MP RSFLP  IASKLPFS+S+I  +++LF A + S   +++
Sbjct  416  RESIMKEGNVIVMPDIRDKMPARSFLPLAIASKLPFSSSRIDEMRELFEAREGSGTERVI  475

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
             +AL ECERAPSRGETKRCV S E+MI+FA SVLG +VVVR+TEN  GS   +MIG +  
Sbjct  476  VNALRECERAPSRGETKRCVASAEEMIEFAASVLGPSVVVRSTENVNGSGSSVMIGKVYP  535

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++GGKVTKSVSCHQSL+PYL+YYCHSVP+VRVYEAD+L+ ++K  +NHGVAICH+DTSSW
Sbjct  536  VDGGKVTKSVSCHQSLYPYLLYYCHSVPQVRVYEADILNVETKENMNHGVAICHLDTSSW  595

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
               HGAF+ALGSGPGKIEVCHWIFENDMTW
Sbjct  596  GPEHGAFLALGSGPGKIEVCHWIFENDMTW  625



>emb|CDY59986.1| BnaC06g43610D [Brassica napus]
Length=611

 Score =   321 bits (823),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 175/214 (82%), Gaps = 16/214 (7%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I SKLPFSTSK+  + ++FHA ++STM K++
Sbjct  414  REASLKEGTVIPMPDIKDKMPKRSFLPRSIISKLPFSTSKLAEINKIFHAGENSTMEKII  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +DA++ECER+PS GETKRCV S EDMIDFATSVLGR+VV+RTTEN  GS + ++IG + G
Sbjct  474  SDAVTECERSPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            INGGKVTK+VSCHQSL+PYL+YYCHSVPKVRVYEADLLD KSK+KINHG+A         
Sbjct  534  INGGKVTKAVSCHQSLYPYLMYYCHSVPKVRVYEADLLDLKSKTKINHGIA---------  584

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
                   I+LGS PG IEVCHWIFENDM WA+AD
Sbjct  585  -------ISLGSKPGLIEVCHWIFENDMNWAIAD  611



>gb|KCW86722.1| hypothetical protein EUGRSUZ_B03333 [Eucalyptus grandis]
Length=249

 Score =   309 bits (791),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPD++D +PKRSFLPR I+S+LPFSTSK+  LKQ+FHA ++STM K++
Sbjct  38   RESMLKSGNVMPMPDLRDNLPKRSFLPRRISSELPFSTSKLAELKQIFHAIENSTMEKIM  97

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  LS+ E A  + E KRCV S+EDMIDFATSVLG +V+VR+T +  GS ++++IG +K 
Sbjct  98   AQTLSQWEGAALQDEIKRCVASIEDMIDFATSVLGHDVLVRSTGSARGSKQEVLIGVVKR  157

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G +V+K V+CHQSLFPY+VYYCH+   VRVYEAD+LDPKSK+KINHGVAICH+DTS+W
Sbjct  158  IEGSEVSKPVACHQSLFPYVVYYCHTFSNVRVYEADILDPKSKAKINHGVAICHMDTSTW  217

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDM  145
            S TH +F+ LGSGPG+IEVCHWI+EN++
Sbjct  218  SPTHESFLLLGSGPGQIEVCHWIYENEI  245



>ref|XP_010046646.1| PREDICTED: BURP domain-containing protein 16-like [Eucalyptus 
grandis]
Length=538

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLKSG +MPMPDI+D +PKRSFLPR I+++LPFSTSK+  LKQ+FHA ++S M K++
Sbjct  150  RESMLKSGNVMPMPDIRDNLPKRSFLPRCISAELPFSTSKLAELKQIFHAIENSAMGKIM  209

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  L ECE A  + ETKRCV S+EDMIDFATSVLG +V+VR+TE+  GS ++++IG +K 
Sbjct  210  AQTLGECEGAALQDETKRCVASIEDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVKR  269

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G +V+K V+CH+ LFPY+VYYCHS P VR YEAD+LDPKSK+KINHGVAICH++TS+W
Sbjct  270  IEGSEVSKPVACHRRLFPYIVYYCHSFPNVRSYEADILDPKSKAKINHGVAICHMNTSTW  329

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            S  H +F+ LGSGPG+IEVCHWI+EN+  W +A
Sbjct  330  SPIHESFLLLGSGPGQIEVCHWIYENNPIWTIA  362


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALK  634
            RE ML+SG ++ MPD++ + P+RSFLPR I+S LPFSTSK+  LK
Sbjct  494  RESMLRSGNMIRMPDLRVKAPQRSFLPRSISSGLPFSTSKLAELK  538



>ref|XP_006659367.1| PREDICTED: BURP domain-containing protein 12-like, partial [Oryza 
brachyantha]
Length=495

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDIKD+MP R+FLPR IA K+PF   K  A+ ++F    D+ M K +
Sbjct  285  REQELVTGNRMPMPDIKDKMPPRAFLPRDIAKKIPF---KPDAVSEVFGVPLDTAMGKAV  341

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++ECERAPSRGETKRC TS ED++DFA  +LG ++VVR+T +T GS ++I +G++ G
Sbjct  342  ASTVTECERAPSRGETKRCATSAEDIVDFAVEMLGNDIVVRSTASTAGSGEEIRLGNVTG  401

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++GGKVT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD++   S  +INHGVAICH+DTS W
Sbjct  402  VDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAADSDQQINHGVAICHLDTSDW  461

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAFIALG  PG++EVCHWIFE DMTW VAD
Sbjct  462  SPTHGAFIALGGKPGEVEVCHWIFEGDMTWTVAD  495



>ref|XP_009394250.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=646

 Score =   314 bits (805),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 174/214 (81%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L+SG +MPMPDI+D+MP RSFLPR IA ++ FS +++   ++ F    D+ + K +
Sbjct  436  REHELRSGNLMPMPDIRDKMPARSFLPRSIAGRIAFSAAEV---QRFFGIPADTALGKAV  492

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            AD ++ECERAPSRGETKRC TS ED+IDFA ++LG NVV R+TE+T GS   ++IG ++G
Sbjct  493  ADTVAECERAPSRGETKRCTTSAEDVIDFAVAMLGSNVVGRSTESTAGSKGTVLIGKVRG  552

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGG VT+SVSCHQSLFPYLVYYCHSVP+VRVY AD+L  ++K +IN GVAICH+DTS W
Sbjct  553  VNGGGVTRSVSCHQSLFPYLVYYCHSVPRVRVYVADILAVQTKERINRGVAICHLDTSDW  612

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S++HGAF++LGS PG+IEVCHWIFE DMTW VAD
Sbjct  613  SASHGAFLSLGSAPGRIEVCHWIFERDMTWTVAD  646



>ref|NP_001061692.1| Os08g0380100 [Oryza sativa Japonica Group]
 sp|Q6ZA27.1|BURPC_ORYSJ RecName: Full=BURP domain-containing protein 12; Short=OsBURP12; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05416.1| putative polygalacturonase isoenzyme 1 beta subunit homolog [Oryza 
sativa Japonica Group]
 dbj|BAF23606.1| Os08g0380100 [Oryza sativa Japonica Group]
 dbj|BAG95253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96203.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 167/214 (78%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L SG  MPMPDIKD+MP R+FLPR IA K+PF   K  A+ ++F    D+ M K +
Sbjct  417  RETELVSGNTMPMPDIKDKMPPRAFLPRDIAKKIPF---KPNAVSEVFGVPLDTAMGKAV  473

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               ++ECERAPSRGETKRC TS ED++DFA  +LG ++VVR+T +T GS   I +G++ G
Sbjct  474  TSTVAECERAPSRGETKRCATSAEDIVDFAVEMLGNDIVVRSTASTAGSGGQIRLGNVTG  533

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++GGKVT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD++   S  KINHGVAICH+DTS W
Sbjct  534  VDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAADSDQKINHGVAICHLDTSDW  593

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S THGAFIALG  PG++EVCHWIFE DMTW VAD
Sbjct  594  SPTHGAFIALGGKPGEVEVCHWIFEGDMTWTVAD  627



>ref|XP_004973305.1| PREDICTED: BURP domain-containing protein 12-like [Setaria italica]
Length=647

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 172/218 (79%), Gaps = 7/218 (3%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI+D+MP R+FLPR IA+K+PF  +   A+ ++F    D+ M K +
Sbjct  433  RERELVAGNRMPMPDIRDKMPPRAFLPRDIAAKIPFDPN---AVSEVFGVPLDTAMGKAV  489

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++EC+RAPS+GETKRC TS ED++DFA  +LG +VVVR+T +T GS  DI +G++ G
Sbjct  490  ASTVAECQRAPSKGETKRCATSAEDIVDFAVEMLGNDVVVRSTASTAGSGGDIRLGAVTG  549

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLL----DPKSKSKINHGVAICHID  241
            ++GGKVT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD++    D  S  KINHGVAICH+D
Sbjct  550  VDGGKVTQSVSCHQSLFPYLVYYCHSVPKVRVYEADIMSAAADGGSGEKINHGVAICHLD  609

Query  240  TSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            TS WS THGAF+ALG  PG++EVCHWIFE DMTW VAD
Sbjct  610  TSDWSPTHGAFVALGGKPGEVEVCHWIFEGDMTWTVAD  647



>ref|XP_009415276.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 178/214 (83%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L+ G++MPMPDI+D+MP RSFLPR IA ++P S +++   +++F    D+ + + +
Sbjct  437  RERDLRRGSVMPMPDIRDKMPPRSFLPRSIAGRIPLSATEV---RRIFGIPADTALGRAV  493

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            AD ++ECERAP+R ETKRC TS ED+IDFA SVLG +VVVR+T NT GS  +I+IG + G
Sbjct  494  ADTVAECERAPNRDETKRCATSAEDVIDFAVSVLGSDVVVRSTANTTGSKGNILIGKVGG  553

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            +NGGK+TKSVSCHQSLFPYLVYYCHSVPKVRVYEA++L  +SK KINHG+AICH+DTS W
Sbjct  554  VNGGKITKSVSCHQSLFPYLVYYCHSVPKVRVYEAEILAVESKEKINHGIAICHLDTSDW  613

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S++HGAF+ALGS PGKIEVCHWIFE DMTW VAD
Sbjct  614  SASHGAFVALGSAPGKIEVCHWIFEGDMTWTVAD  647



>gb|EPS68955.1| hypothetical protein M569_05812, partial [Genlisea aurea]
Length=592

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 168/215 (78%), Gaps = 1/215 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L+ G  + M +I+D MP+RSFLPR I SKLPFS  K+  LK+LF A D+ST+  +L
Sbjct  378  RETTLREGNTIRMANIRDWMPERSFLPRTITSKLPFSKGKLVQLKRLFRAKDNSTLDHIL  437

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A AL+EC RAPS GETKRCV SVEDMIDFA S LG ++ VRTT NT GS + + + +++ 
Sbjct  438  AAALAECGRAPSPGETKRCVASVEDMIDFAVSTLGPSIAVRTTANTNGSGRTVQLKNVEP  497

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKS-KSKINHGVAICHIDTSS  232
            I+GGK TKSVSCHQ+L+PYL+YYCHSVP VRVYEAD+ +    + KIN GVAICH+DT+S
Sbjct  498  IDGGKSTKSVSCHQTLYPYLLYYCHSVPDVRVYEADIHETAGRREKINRGVAICHLDTAS  557

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            WS  HGAFIALGS PG IEVCHWIFENDMTW VAD
Sbjct  558  WSPNHGAFIALGSRPGLIEVCHWIFENDMTWTVAD  592



>ref|XP_010044626.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
 gb|KCW86719.1| hypothetical protein EUGRSUZ_B03326 [Eucalyptus grandis]
Length=364

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 169/214 (79%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            +E ML+SG ++ MPD++ + P+RSFLPR I+S LPFSTSK+  LKQ+FHA DDSTM K++
Sbjct  151  QESMLRSGNVIRMPDLRSKTPERSFLPRSISSGLPFSTSKLAELKQIFHAGDDSTMEKIM  210

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               LS CE+AP RGETKRCV+SVEDMIDFATS+LG ++ + +T++ EGS  DI+IG +K 
Sbjct  211  VRTLSLCEKAPIRGETKRCVSSVEDMIDFATSILGHDIKLHSTKSDEGSKHDILIGRVKR  270

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G K++  V+CH SLFPY+VY CH+VP + VYE D+LDP SK+KIN+GVA+CH+DTS+W
Sbjct  271  IGGSKLSVPVACHDSLFPYMVYNCHAVPTLHVYEVDILDPVSKAKINNGVAVCHMDTSAW  330

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            +  H AFIALGSGPG+IE CHWI+     W  A+
Sbjct  331  NPNHEAFIALGSGPGRIEACHWIYGEYAVWTRAN  364



>dbj|BAJ92348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 164/214 (77%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI+D+MP R+FLPR IA K+PF  +   A+ ++F    D+ M K +
Sbjct  414  RERELVAGNRMPMPDIRDKMPPRAFLPRDIARKIPFEPN---AVSEVFRVPLDTAMGKAV  470

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++ECER PSRGETKRC TS ED++DFA  +LG ++VV +T +T GS  DI +G++ G
Sbjct  471  ASTVAECERVPSRGETKRCATSAEDIVDFAVEMLGSDIVVHSTASTAGSGADIRLGNVTG  530

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++GGKVT+ VSCHQSLFPYLVYYCHSVPK RVYEA++    S  KINHGVAICH+DTS W
Sbjct  531  VHGGKVTRPVSCHQSLFPYLVYYCHSVPKARVYEAEITAADSGQKINHGVAICHLDTSDW  590

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALG  PGKIEVCHWIFE DMTW VAD
Sbjct  591  SPAHGAFVALGGKPGKIEVCHWIFEGDMTWTVAD  624



>ref|XP_004956601.1| PREDICTED: BURP domain-containing protein 14-like [Setaria italica]
Length=683

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 167/215 (78%), Gaps = 4/215 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI D++P R+FLPR IA+K+PF   + GA+  LF A   + M +++
Sbjct  472  RERDLMTGNRMPMPDIADKLPHRAFLPRDIAAKIPF---EEGAVSALFGAPPGTAMRQVV  528

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGR-NVVVRTTENTEGSTKDIMIGSIK  412
            A  ++EC RAPSRGETKRC TS EDM+DFA  +LG  N+ VR+TE+T GS +D+ +G I 
Sbjct  529  ASTVAECARAPSRGETKRCATSAEDMVDFAVEMLGSSNIAVRSTESTAGSGRDVRLGKIT  588

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            G+ GG VT+SVSCHQSLFPYLVYYCHSVP+VR+YEAD+LD  S  +INHGVAICH+DTS 
Sbjct  589  GVAGGGVTRSVSCHQSLFPYLVYYCHSVPRVRLYEADILDVDSNRRINHGVAICHLDTSD  648

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            WS  HGAF+ALG  PG+IEVCHWIFE DMTW + D
Sbjct  649  WSPNHGAFVALGGKPGEIEVCHWIFEGDMTWTLVD  683



>gb|EMS58973.1| hypothetical protein TRIUR3_16136 [Triticum urartu]
Length=514

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 163/214 (76%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI+D+ P  + LPR IA K+PF   ++ A+ ++F    D+ M K +
Sbjct  304  RERELVAGNRMPMPDIRDKRPPGASLPRDIARKIPF---ELNAVSEVFRVPLDTAMGKAV  360

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++ECERAPS+GETKRC TS ED++DFA  +LG ++VV +T +T GS  DI +G++ G
Sbjct  361  ASTVAECERAPSQGETKRCATSAEDIVDFAVEMLGSDIVVHSTASTAGSGADIRLGNVTG  420

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++GGKVT+ VSCHQSLFPYLVYYCHSVPK RVYEAD+    S  KINHGVAICH+DTS W
Sbjct  421  VHGGKVTRPVSCHQSLFPYLVYYCHSVPKARVYEADITAADSGQKINHGVAICHLDTSDW  480

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAFIALG  PGKIEVCHWIFE DMTW VAD
Sbjct  481  SPAHGAFIALGGKPGKIEVCHWIFEGDMTWTVAD  514



>ref|XP_010046641.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=364

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 169/214 (79%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            +E  L+SG ++ MPD++ + P+RSFLPR I+S LPFSTSK+  LKQ+FHA DDSTM K++
Sbjct  151  QESTLRSGNVIHMPDLRSKTPERSFLPRSISSGLPFSTSKLAELKQIFHAGDDSTMEKIM  210

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               LS CE+AP RGETKRCV+SVEDMIDFATS+LG ++ + + ++ EGS +DI+IG +K 
Sbjct  211  VRTLSLCEKAPIRGETKRCVSSVEDMIDFATSILGHDIKLHSPKSDEGSKRDILIGRVKR  270

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G K++  V+CH SLFPY+VY CH+VP + VYE D+LDP SK+KIN+GVA+CH+DTS+W
Sbjct  271  IGGSKLSAPVACHDSLFPYMVYNCHAVPTLHVYEVDILDPVSKAKINNGVAVCHMDTSAW  330

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            +  H AF+ALGSGPG+IE CHWI+ +   W  A+
Sbjct  331  NPNHEAFLALGSGPGRIEACHWIYGDYAVWTRAN  364



>ref|XP_010044635.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Eucalyptus grandis]
Length=358

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 170/214 (79%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+SG ++ MPD++ + PKRSFLPR I+S L FSTSK+  LKQ+FHA DDS M K++
Sbjct  145  RESMLRSGNMIRMPDLRVKAPKRSFLPRSISSGLLFSTSKLAELKQIFHAGDDSNMEKIM  204

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               L++CE+AP +GETKRCV+SVE MIDFATS+LG ++ + +TE+ EGS ++I+IG +K 
Sbjct  205  VRTLNQCEQAPIQGETKRCVSSVEGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKR  264

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++G K +  V+CH+++FPY+VYYCH+ P +R+YEAD+LDP SK+KINHG+A+CH+DTS W
Sbjct  265  LDGSKSSAPVACHETIFPYMVYYCHTFPTLRIYEADILDPVSKAKINHGIALCHMDTSIW  324

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  H AF+ALGS PG+IE CHW+F +   W  A+
Sbjct  325  SPNHEAFLALGSSPGRIEACHWVFGDYGVWTGAN  358



>ref|XP_003574428.1| PREDICTED: BURP domain-containing protein 12 [Brachypodium distachyon]
Length=623

 Score =   295 bits (756),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 165/214 (77%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            REK L +G  MPMPDI+D+MP R+FLPR I+ K+PF  +   A+ ++F    DS M K +
Sbjct  413  REKELVAGNRMPMPDIRDKMPPRAFLPRDISRKIPFEPN---AVSEVFGVPLDSAMGKAV  469

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++EC+RAPS+GETKRC TS ED++DFA  +LG ++VV +T +  GS  DI +GS+ G
Sbjct  470  ASTVAECDRAPSQGETKRCATSAEDIVDFAVEMLGNDIVVHSTASPAGSGGDIRLGSVTG  529

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++GGKVT+SVSCHQSLFPYLVYYCHSVPKVRVY A+++   S  KINHGVAICH+DTS W
Sbjct  530  VDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYAAEIMAVDSDQKINHGVAICHLDTSDW  589

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALG  PG+ EVCHWIFE DMTW VAD
Sbjct  590  SPAHGAFVALGGKPGETEVCHWIFEGDMTWTVAD  623



>ref|XP_008652571.1| PREDICTED: BURP domain-containing protein 14-like [Zea mays]
 tpg|DAA61067.1| TPA: hypothetical protein ZEAMMB73_635092 [Zea mays]
Length=679

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 163/214 (76%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L  G  MPMPDI D+MP+R+FLPR IA+K+PF  + + AL   F A   + M +++
Sbjct  469  RERDLMMGNRMPMPDIADKMPRRAFLPRDIATKIPFEENAVSAL---FGAPPGTAMRQVV  525

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++EC R PS GETKRC TS EDM+DFA  +LG N+ VR+TE+T GS +D+ +G I G
Sbjct  526  ASTVAECARPPSPGETKRCTTSAEDMLDFAVEMLGSNIAVRSTESTAGSGRDVRLGKITG  585

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I GG VT+SVSCHQSLFPYLVYYCHSVP+VR+YEAD+LD  S  KINHGVAICH++TS W
Sbjct  586  IAGGSVTRSVSCHQSLFPYLVYYCHSVPRVRLYEADILDVDSNRKINHGVAICHLETSDW  645

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALG  PG+IEVCHWIFE DM W + D
Sbjct  646  SPNHGAFVALGGKPGQIEVCHWIFEGDMAWTLVD  679



>ref|NP_001146063.1| uncharacterized protein LOC100279594 precursor [Zea mays]
 gb|ACL53138.1| unknown [Zea mays]
 gb|ACN33667.1| unknown [Zea mays]
 gb|AFW62083.1| polygalacturonase-1 non-catalytic beta subunit [Zea mays]
Length=643

 Score =   293 bits (751),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 166/217 (76%), Gaps = 6/217 (3%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI+D+MP R+FLPR IA+++PF  +   A+ + F    D+ + K +
Sbjct  430  RERELVAGNRMPMPDIRDKMPPRAFLPRAIAARIPFEPN---AVSEAFGLPLDTALGKAV  486

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++ECERAPS+GETKRC TS ED++DFA  VLG ++VVR+T +T G    + +G++ G
Sbjct  487  ASTVAECERAPSKGETKRCATSAEDVVDFAVEVLGDDIVVRSTASTAGGGGRVQLGAVAG  546

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLL---DPKSKSKINHGVAICHIDT  238
            ++GG+VT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD+L      S  KIN GVAICH+DT
Sbjct  547  VDGGRVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAADGSGSGEKINRGVAICHLDT  606

Query  237  SSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S WS  HGAF+ALG  PG++EVCHWIFE DMTW VAD
Sbjct  607  SDWSPAHGAFVALGGKPGEVEVCHWIFEGDMTWTVAD  643



>gb|ACN34141.1| unknown [Zea mays]
Length=643

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 166/217 (76%), Gaps = 6/217 (3%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI+D+MP R+FLPR IA+++PF  +   A+ + F    D+ + K +
Sbjct  430  RERELVAGNRMPMPDIRDKMPPRAFLPRAIAARIPFEPN---AVSEAFGLPLDTALGKAV  486

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++ECERAPS+GETKRC TS ED++DFA  VLG ++VVR+T +T G    + +G++ G
Sbjct  487  ASTVAECERAPSKGETKRCATSAEDVVDFAVEVLGDDIVVRSTASTAGGGGRVQLGAVAG  546

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLL---DPKSKSKINHGVAICHIDT  238
            ++GG+VT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD+L      S  KIN GVAICH+DT
Sbjct  547  VDGGRVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAADGSGSGEKINRGVAICHLDT  606

Query  237  SSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S WS  HGAF+ALG  PG++EVCHWIFE DMTW VAD
Sbjct  607  SDWSPAHGAFVALGGKPGEVEVCHWIFEGDMTWTVAD  643



>gb|ACG28762.1| polygalacturonase-1 non-catalytic beta subunit precursor [Zea 
mays]
Length=642

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 166/215 (77%), Gaps = 4/215 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI+D+MP R+FLPR IA+++PF  +   A+ + F    D+ + K +
Sbjct  431  RERELVAGNRMPMPDIRDKMPPRAFLPRAIAARIPFEPN---AVSEAFGLPLDTALGKAV  487

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++ECERAPS+GETKRC TS ED++DFA  VLG ++VVR+T +T G    + +G++ G
Sbjct  488  ASTVAECERAPSKGETKRCATSAEDVVDFAVEVLGDDIVVRSTASTAGGGGRVQLGAVAG  547

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPK-SKSKINHGVAICHIDTSS  232
            ++GG+VT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD+L    S  KIN GVAICH+DTS 
Sbjct  548  MDGGRVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAADGSGEKINRGVAICHLDTSD  607

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            WS  HGAF+ALG  PG++EVCHWIFE DMTW VAD
Sbjct  608  WSPAHGAFVALGGKPGEVEVCHWIFEGDMTWTVAD  642



>ref|XP_002460065.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
 gb|EER96586.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
Length=691

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L  G  MPMPDI D+MP R+FLPR IA+K+PF  + + AL   F A   + M +++
Sbjct  481  RERDLMMGNRMPMPDIADKMPHRAFLPRDIAAKIPFEENAVSAL---FGAPPGTAMRQVV  537

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++EC R PS GETKRC TS EDM+DFA  +LG N+ VR+TE+T G   D+ +G I G
Sbjct  538  ASTVAECARPPSLGETKRCTTSAEDMLDFAVEMLGSNIAVRSTESTAGGGGDVRLGKITG  597

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I GG VT+SVSCHQSLFPYLVYYCHSVP+VR+YEAD+LD  S  KINHGVAICH++TS W
Sbjct  598  IAGGSVTRSVSCHQSLFPYLVYYCHSVPRVRLYEADILDVDSNRKINHGVAICHLETSDW  657

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S +HGAF+ALG  PG+IEVCHWIFE DM W + D
Sbjct  658  SPSHGAFVALGGKPGQIEVCHWIFEGDMAWTLVD  691



>ref|NP_001062896.2| Os09g0329000 [Oryza sativa Japonica Group]
 sp|Q6K2M1.2|BURPE_ORYSJ RecName: Full=BURP domain-containing protein 14; Short=OsBURP14; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF24810.2| Os09g0329000 [Oryza sativa Japonica Group]
Length=690

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 161/215 (75%), Gaps = 4/215 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI DR P R+FLPR IA+K+PF  + + AL   F AA  + M +++
Sbjct  479  RERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQVV  535

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +  ++EC R PSRGETKRC TS ED++DFA  +LG NVV R TE+T G   D+ +G + G
Sbjct  536  SSTVAECARPPSRGETKRCATSAEDVVDFAVEMLGDNVVARATESTAGGGGDVRLGRVAG  595

Query  408  I-NGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            +  GG VT+SVSCHQSLFPYLVYYCHSVP VRVYEAD+L   S  KINHGVAICH+DTS 
Sbjct  596  VPAGGNVTRSVSCHQSLFPYLVYYCHSVPTVRVYEADILAVDSNQKINHGVAICHLDTSD  655

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            WS  HGAFIALG  PG++EVCHWIF+ DMTW VA+
Sbjct  656  WSPNHGAFIALGGKPGEMEVCHWIFQGDMTWTVAN  690



>gb|EEC84370.1| hypothetical protein OsI_30914 [Oryza sativa Indica Group]
Length=658

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 161/215 (75%), Gaps = 4/215 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI DR P R+FLPR IA+K+PF  + + AL   F AA  + M +++
Sbjct  447  RERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQVV  503

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +  ++EC R PSRGETKRC TS ED++DFA  +LG NVV R TE+T G   D+ +G + G
Sbjct  504  SSTVAECARPPSRGETKRCATSAEDVVDFAVEMLGDNVVARATESTAGGGGDVRLGRVAG  563

Query  408  I-NGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            +  GG VT+SVSCHQSLFPYLVYYCHSVP VRVYEAD+L   S  +INHGVAICH+DTS 
Sbjct  564  VPAGGNVTRSVSCHQSLFPYLVYYCHSVPTVRVYEADILAVDSNQRINHGVAICHLDTSD  623

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            WS  HGAFIALG  PG++EVCHWIF+ DMTW VA+
Sbjct  624  WSPNHGAFIALGGKPGEMEVCHWIFQGDMTWTVAN  658



>gb|EMT30231.1| hypothetical protein F775_20363 [Aegilops tauschii]
Length=444

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 154/203 (76%), Gaps = 3/203 (1%)
 Frame = -3

Query  735  PMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLADALSECERAP  556
            P+ DI D++P  + LPR IA K+PF  +   A+ ++F    D+ M K +A  ++ECERAP
Sbjct  245  PVRDIGDKIPPGASLPRDIAGKIPFEPN---AVSEVFRVPLDTAMGKAVASTVAECERAP  301

Query  555  SRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVTKSVS  376
            S+GETKRC TS ED++DFA  +LG ++VV +T +T GS  DI +G++ G++GGKVT+ VS
Sbjct  302  SQGETKRCATSAEDIVDFAVEMLGSDIVVHSTASTAGSGADIRLGNVTGVHGGKVTRPVS  361

Query  375  CHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAFIALG  196
            CHQSLFPYLVYYCHSVPK RVYEAD+    S  KINHGVAICH+DTS WS  HGAFIALG
Sbjct  362  CHQSLFPYLVYYCHSVPKARVYEADITAADSGQKINHGVAICHLDTSDWSPAHGAFIALG  421

Query  195  SGPGKIEVCHWIFENDMTWAVAD  127
              PGKIEVCHWIFE DMTW VAD
Sbjct  422  GKPGKIEVCHWIFEGDMTWTVAD  444



>dbj|BAJ97940.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI D+MP R+FLPR IA+K+PF   + GA+  LF A   + M +++
Sbjct  542  RERDLITGNRMPMPDITDKMPPRAFLPRDIATKIPF---EAGAVSALFGAPPGNAMRQVV  598

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  + EC R PSRGETKRC TS EDM+DFA  +LG NV VR+TE+  GS  DI +G + G
Sbjct  599  ASTVDECARPPSRGETKRCATSAEDMLDFAVEMLGDNVAVRSTESAAGSGGDIRVGRVAG  658

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            + GG  T+SVSCHQS+FPYLVYYCHSVP VRVYEA++L   S  +IN GVAICH+DTS W
Sbjct  659  VAGGHATRSVSCHQSMFPYLVYYCHSVPSVRVYEAEILAVDSGRRINRGVAICHLDTSEW  718

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF ALG  PG++EVCHWIF+ DM W VAD
Sbjct  719  SPGHGAFAALGGKPGEMEVCHWIFQGDMVWTVAD  752



>ref|XP_002444270.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
 gb|EES13765.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
Length=658

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 163/226 (72%), Gaps = 15/226 (7%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L SG  MPMPDI+D+MP R+FLPR IA+++PF      A+ + F    D+ + K +
Sbjct  436  REQELVSGNRMPMPDIRDKMPPRAFLPRAIAARIPFDPQ---AVSEAFGLPLDTALGKAV  492

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +  ++EC RAPS+GETKRC TS ED++DFA   LG ++VVR+T +T GS  D+ +G++ G
Sbjct  493  SSTVAECLRAPSKGETKRCATSAEDVVDFAVETLGDDIVVRSTASTAGSGGDVRLGTVTG  552

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYE------------ADLLDPKSKSKINH  265
            ++GGKVT+SVSCHQSLFPYLVYYCHSVPKVRVYE                D   K  INH
Sbjct  553  VDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAAAAAADDDGGSDAGEKEIINH  612

Query  264  GVAICHIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            GVAICH+DTS WS THGAF+ALG  PG++EVCHWIFE DMTW VAD
Sbjct  613  GVAICHLDTSDWSPTHGAFVALGGKPGEVEVCHWIFEGDMTWTVAD  658



>dbj|BAK05386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 157/216 (73%), Gaps = 8/216 (4%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI+D+MP R+FLPR IA K+PF  S   A+ + F A  D+ M K +
Sbjct  416  RERELVTGNRMPMPDIRDKMPPRAFLPRDIARKIPFEAS---AVSEAFGAPPDTAMGKAV  472

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               ++ECERAPSRGETKRC TS ED++DFA  +LG ++VVR+T +T GS   + +G + G
Sbjct  473  VSTVAECERAPSRGETKRCATSAEDVVDFAVEMLGDDIVVRSTASTAGSGAGVRLGDVTG  532

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLL--DPKSKSKINHGVAICHIDTS  235
               GK  ++VSCHQSLFPYLVYYCHSVPK RVYEAD++  D     KIN GVAICH+DTS
Sbjct  533  ---GKAARAVSCHQSLFPYLVYYCHSVPKARVYEADIMAADAGGGRKINRGVAICHLDTS  589

Query  234  SWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             WS +HGAF+ LG  PGK EVCHWIFE DMTW  AD
Sbjct  590  DWSPSHGAFVLLGGEPGKTEVCHWIFEGDMTWTAAD  625



>gb|KDO69699.1| hypothetical protein CISIN_1g0378481mg, partial [Citrus sinensis]
Length=148

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  570  CERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKV  391
            CERAPS GETKRCV SVEDMIDFATSVLGRNVV RTT+N  GS + + I S+ GINGGKV
Sbjct  1    CERAPSPGETKRCVGSVEDMIDFATSVLGRNVVARTTQNANGSKRRVTISSVSGINGGKV  60

Query  390  TKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGA  211
            TKSVSCHQSL+PYL+YYCHSVPKVRVYEAD+LD  S +KINHGVAICHIDTSSWS  HGA
Sbjct  61   TKSVSCHQSLYPYLLYYCHSVPKVRVYEADVLDVVSNAKINHGVAICHIDTSSWSPGHGA  120

Query  210  FIALGSGPGKIEVCHWIFENDMTWAVAD  127
            F+ALGSGPG+IEVCHWIFENDMTW  AD
Sbjct  121  FVALGSGPGQIEVCHWIFENDMTWTSAD  148



>ref|XP_010046643.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=211

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  759  MLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLADA  580
            ML+SG ++ + +++ + PKR FLPR I+S LPFS SK   LKQ+FHA DDS M K++   
Sbjct  1    MLRSGNMIRILNLRVKAPKRLFLPRSISSGLPFSISKFAELKQIFHAGDDSNMEKIMVRT  60

Query  579  LSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGING  400
            LS+CE+AP +GETKRCV+SVE MIDFATS+LG ++ + +TE+ EGS ++I+IG +K + G
Sbjct  61   LSQCEQAPIQGETKRCVSSVEGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKRLEG  120

Query  399  GKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSST  220
             K +  V+CH+++FPY+VYYCH+   +RVYEAD+LDP SK+KINHG+A+ H+DTS WS  
Sbjct  121  SKSSAPVACHETIFPYMVYYCHTFLTLRVYEADILDPVSKAKINHGIALYHMDTSIWSPN  180

Query  219  HGAFIALGSGPGKIEVCHWIFENDMTW  139
            H AF+AL S PG+IE CHW+F +   W
Sbjct  181  HEAFLALRSSPGQIETCHWVFGDYGVW  207



>ref|NP_001064572.1| Os10g0409400 [Oryza sativa Japonica Group]
 sp|Q7XES5.1|BURPG_ORYSJ RecName: Full=BURP domain-containing protein 16; Short=OsBURP16; 
AltName: Full=Protein WGP1; Short=OsWGP1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAP53713.1| BURP domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26486.1| Os10g0409400 [Oryza sativa Japonica Group]
 gb|EAZ16044.1| hypothetical protein OsJ_31485 [Oryza sativa Japonica Group]
 gb|ABR23532.1| cell wall protein WGP1 [Oryza sativa Japonica Group]
 dbj|BAG99870.1| unnamed protein product [Oryza sativa Japonica Group]
Length=344

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 164/216 (76%), Gaps = 5/216 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRM--PKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAK  595
            RE+ LK G ++ MPDI + +   + SFLPR IA ++PF   K  A+K LF    ++T+AK
Sbjct  130  REQELKEGNVVRMPDIANELTTARSSFLPRSIADRIPF---KAEAVKSLFGLEPNTTLAK  186

Query  594  MLADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSI  415
             + + +++C+ +PS+GETKRCVTS EDMIDFA ++LG ++VVR+T    G  + IMIG +
Sbjct  187  AVDETVAQCQSSPSKGETKRCVTSAEDMIDFAVAMLGDDIVVRSTVLPNGPGESIMIGKV  246

Query  414  KGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTS  235
            KGINGGK+T SVSCH+ LFPY+VYYCHSVPK+RVYEA++L  ++K KIN GVAICHIDTS
Sbjct  247  KGINGGKITSSVSCHEYLFPYMVYYCHSVPKIRVYEAEILSVQTKEKINSGVAICHIDTS  306

Query  234  SWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            +W++ H AF+ALG  PG+ +VCHWIF   MTW +AD
Sbjct  307  AWNAGHPAFVALGGKPGQNKVCHWIFNGSMTWVIAD  342



>gb|EEE68602.1| hypothetical protein OsJ_27135 [Oryza sativa Japonica Group]
Length=703

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 154/199 (77%), Gaps = 3/199 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L SG  MPMPDIKD+MP R+FLPR IA K+PF   K  A+ ++F    D+ M K +
Sbjct  393  RETELVSGNTMPMPDIKDKMPPRAFLPRDIAKKIPF---KPNAVSEVFGVPLDTAMGKAV  449

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               ++ECERAPSRGETKRC TS ED++DFA  +LG ++VVR+T +T GS   I +G++ G
Sbjct  450  TSTVAECERAPSRGETKRCATSAEDIVDFAVEMLGNDIVVRSTASTAGSGGQIRLGNVTG  509

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++GGKVT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD++   S  KINHGVAICH+DTS W
Sbjct  510  VDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAADSDQKINHGVAICHLDTSDW  569

Query  228  SSTHGAFIALGSGPGKIEV  172
            S THGAFIALG  PG++EV
Sbjct  570  SPTHGAFIALGGKPGEVEV  588



>gb|EEC83505.1| hypothetical protein OsI_29064 [Oryza sativa Indica Group]
Length=623

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L SG  MPMPDIKD+MP R+FLPR IA K+PF   K  A+ ++F    D+ M K +
Sbjct  386  RETELVSGNTMPMPDIKDKMPPRAFLPRDIAKKIPF---KPNAVSEVFGVPLDTAMGKAV  442

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               ++ECER PSRGETKRC TS ED++DFA  +LG ++VVR+T +T GS   I +G++ G
Sbjct  443  TSTVAECEREPSRGETKRCATSAEDIVDFAVEMLGNDIVVRSTASTAGSGGQIRLGNVTG  502

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            ++GGKVT+SVSCHQSLFPYLVYYCHSVPKVRVYEAD++   S  KINHGVAICH+DTS W
Sbjct  503  VDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAADSDQKINHGVAICHLDTSDW  562

Query  228  SSTHGAFIALGSGPGKIEV  172
            S THGAFIALG  PG++EV
Sbjct  563  SPTHGAFIALGGKPGEVEV  581



>gb|EEC77314.1| hypothetical protein OsI_15976 [Oryza sativa Indica Group]
Length=202

 Score =   253 bits (647),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 153/203 (75%), Gaps = 4/203 (2%)
 Frame = -3

Query  732  MPDIKDR-MPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLADALSECERAP  556
            MPDI +     RSFLPR IA ++PF      A+K LF    ++T+AK + + +++C+ +P
Sbjct  1    MPDITNESTTARSFLPRSIADRIPFEAE---AVKPLFGLEPNTTLAKAVDETVAQCQSSP  57

Query  555  SRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVTKSVS  376
            S+GETKRCVTS EDMIDFA ++LG ++VVR+T    GS + IMIG +KGIN GK+T SVS
Sbjct  58   SKGETKRCVTSAEDMIDFAVAMLGDDIVVRSTVLPNGSGESIMIGKVKGINSGKITSSVS  117

Query  375  CHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAFIALG  196
            CH+ LFPY+VY CHSVPK+RVYEA++L  ++K KIN GVA+CHIDTS+WS+ H AF+ALG
Sbjct  118  CHEYLFPYMVYSCHSVPKIRVYEAEILSVQTKEKINSGVAVCHIDTSAWSAGHPAFVALG  177

Query  195  SGPGKIEVCHWIFENDMTWAVAD  127
              PG+ EVCHWI+   MTW +AD
Sbjct  178  GKPGQNEVCHWIYNGSMTWVIAD  200



>ref|XP_003576424.1| PREDICTED: BURP domain-containing protein 14-like [Brachypodium 
distachyon]
Length=775

 Score =   267 bits (682),  Expect = 8e-80, Method: Composition-based stats.
 Identities = 129/214 (60%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L +G  MPMPDI D+MP R+FLPR IA+K+PF     GA+  LF A   + M +++
Sbjct  563  REWDLMTGNRMPMPDISDKMPPRAFLPRDIAAKIPFEA---GAVSALFGAPPGTAMRQVV  619

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            A  ++ECERAPSRGETKRC TS ED++DFA  +LG N+ VR+TE+  G   D+ +G + G
Sbjct  620  ASTVAECERAPSRGETKRCATSAEDVLDFAVEMLGDNIAVRSTESPAGGGGDVRLGRVGG  679

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            + GG VT+SVSCHQSLFPYLVYYCHSVP VRVYEA+++   S  +IN GVAICH+DTS W
Sbjct  680  VAGGGVTRSVSCHQSLFPYLVYYCHSVPSVRVYEAEIMAVDSGQRINRGVAICHLDTSDW  739

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            S  HGAF+ALG  PG++EVCHWIF+ DMTW VAD
Sbjct  740  SPDHGAFVALGGKPGEMEVCHWIFQGDMTWTVAD  773



>gb|ABR16440.1| unknown [Picea sitchensis]
Length=666

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 160/221 (72%), Gaps = 11/221 (5%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKM  592
            RE +L  G+ +P+P+++D MP+RSFLPR +A KLP FS+  +  L ++F   ++S+M  M
Sbjct  442  RENLLVQGSSLPLPNLRDFMPRRSFLPRSLADKLPSFSSQSLAELVRMFRIPENSSMEGM  501

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            +A  L ECER   +GE K+CVTSVE M +FA  +LG+ V V TT +T GS + + +G + 
Sbjct  502  MAKTLKECERPAVKGEIKKCVTSVEGMAEFAVGILGKKVEVLTTASTAGSGERVQVGEVN  561

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLL---------DPKSK-SKINHG  262
            G +GG+VT+SVSCHQS+FPYLVYYCHSVPKV+VYEA LL         + K K  KIN G
Sbjct  562  GKDGGRVTRSVSCHQSMFPYLVYYCHSVPKVKVYEAALLRNSNSNPSSNQKEKIEKINDG  621

Query  261  VAICHIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            VAICH+DT+ WS+ H AF+ALG  PG+IEVCHWIFEND+ W
Sbjct  622  VAICHLDTTQWSAGHAAFVALGHKPGQIEVCHWIFENDLIW  662



>ref|XP_002525381.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
 gb|EEF37019.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
Length=531

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  567  ERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVT  388
            ERAPSRGETKRCV S ED+IDFATSVLGRN VVRTT++  G+ KDI+IG +KGINGG+VT
Sbjct  382  ERAPSRGETKRCVVSAEDLIDFATSVLGRNAVVRTTQSINGAKKDILIGRVKGINGGRVT  441

Query  387  KSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAF  208
            KSVSCHQSL+P+L+YYCHSVPKVRVYEA++LD  SK+ IN G AICH+DTS+WSS HGAF
Sbjct  442  KSVSCHQSLYPHLLYYCHSVPKVRVYEAEILDANSKANINWGTAICHLDTSAWSSNHGAF  501

Query  207  IALGSGPGKIEVCHWIFENDMTWAVAD  127
            +ALGS PG+IEVCHWIFENDMTW + D
Sbjct  502  LALGSSPGRIEVCHWIFENDMTWTITD  528



>gb|KCW86721.1| hypothetical protein EUGRSUZ_B03330 [Eucalyptus grandis]
Length=227

 Score =   249 bits (636),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L+SG ++ MPD++ + P+RSFLPR I+S LP  TSKI  LKQ+FHA DDSTM K++
Sbjct  14   RESTLRSGNVIQMPDLRSKTPERSFLPRSISSGLPSLTSKIAELKQIFHARDDSTMEKIM  73

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               L  CE+AP++GETKRCV+SVED+ DFAT +L  N+ +   ++ EGS +DI+IG +K 
Sbjct  74   VRTLGLCEKAPTQGETKRCVSSVEDITDFATLILSHNIKLHAMKSDEGSKRDILIGRVKR  133

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G +++  V+CH SLFP +VY CH+VP  + ++  +LDP  KSKIN+GVA+ H+DTS  
Sbjct  134  IGGSQLSAPVACHDSLFPCMVYNCHAVPTPQFHKVGILDPVCKSKINNGVAVYHMDTSIG  193

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            +  H AF+ALGSGPG+IE CHWI+ +   W  A+
Sbjct  194  NPNHEAFLALGSGPGRIEACHWIYGDYAVWTRAN  227



>gb|KCW86724.1| hypothetical protein EUGRSUZ_B03335 [Eucalyptus grandis]
Length=207

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 152/210 (72%), Gaps = 20/210 (10%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE ML+SG ++ MPD++ + P+RSFLPR I+S LPFSTSK+  L Q              
Sbjct  14   RESMLRSGNMIRMPDLRVKAPQRSFLPRSISSGLPFSTSKLAELNQ--------------  59

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
                  CE+AP +GETKRCV+SVE MIDFATS+LG ++ + +TE+ EGS ++I+IG +K 
Sbjct  60   ------CEQAPIQGETKRCVSSVEGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKR  113

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            + G K +  V+CH+++FPY+VYYCH+ P +R+YEAD+LDP SK+KINHG+A+CH+DTS W
Sbjct  114  LEGSKSSAPVACHETIFPYMVYYCHTFPTLRIYEADILDPMSKAKINHGIALCHMDTSIW  173

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            S  H AF+ALGS PG+IE CH +F +   W
Sbjct  174  SPNHVAFLALGSSPGQIEACHCVFGDYGVW  203



>ref|XP_010046644.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=283

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  L+SG ++ MPD++ + P+RSFLPR I+S LP  TSKI  LKQ+FHA DDSTM K++
Sbjct  70   RESTLRSGNVIQMPDLRSKTPERSFLPRSISSGLPSLTSKIAELKQIFHARDDSTMEKIM  129

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               L  CE+AP++GETKRCV+SVED+ DFAT +L  N+ +   ++ EGS +DI+IG +K 
Sbjct  130  VRTLGLCEKAPTQGETKRCVSSVEDITDFATLILSHNIKLHAMKSDEGSKRDILIGRVKR  189

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G +++  V+CH SLFP +VY CH+VP  + ++  +LDP  KSKIN+GVA+ H+DTS  
Sbjct  190  IGGSQLSAPVACHDSLFPCMVYNCHAVPTPQFHKVGILDPVCKSKINNGVAVYHMDTSIG  249

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            +  H AF+ALGSGPG+IE CHWI+ +   W  A+
Sbjct  250  NPNHEAFLALGSGPGRIEACHWIYGDYAVWTRAN  283



>dbj|BAD23622.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
 dbj|BAD29397.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
Length=690

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 145/197 (74%), Gaps = 4/197 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI DR P R+FLPR IA+K+PF  + + AL   F AA  + M +++
Sbjct  479  RERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQVV  535

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +  ++EC R PSRGETKRC TS ED++DFA  +LG NVV R TE+T G   D+ +G + G
Sbjct  536  SSTVAECARPPSRGETKRCATSAEDVVDFAVEMLGDNVVARATESTAGGGGDVRLGRVAG  595

Query  408  I-NGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            +  GG VT+SVSCHQSLFPYLVYYCHSVP VRVYEAD+L   S  KINHGVAICH+DTS 
Sbjct  596  VPAGGNVTRSVSCHQSLFPYLVYYCHSVPTVRVYEADILAVDSNQKINHGVAICHLDTSD  655

Query  231  WSSTHGAFIALGSGPGK  181
            WS  HGAFIALG  PGK
Sbjct  656  WSPNHGAFIALGGKPGK  672



>gb|AES96108.2| BURP domain protein [Medicago truncatula]
Length=382

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 150/211 (71%), Gaps = 2/211 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKM  592
            REKML  G +M M DI+D++ KR FL   I +KLP  +T  +  LKQ F  +D+    K 
Sbjct  168  REKMLNEGVVMQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKR  227

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            + + L  CERAP+RGET +CV S+++M  FA+S+LG  VV+R T N +GS K++M+G + 
Sbjct  228  MKETLENCERAPARGETIKCVRSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVS  287

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             I GG VT+SV+CHQ +FP ++Y+CH +P VRVY  ++L  + + KIN  V +CHIDTSS
Sbjct  288  RIQGGNVTESVTCHQEVFPVMLYFCHYIPMVRVYNVEILTLQ-RIKINQAVDVCHIDTSS  346

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            WS +H AF+ LGS PG+IEVCHWIF+ND++W
Sbjct  347  WSRSHPAFLELGSAPGEIEVCHWIFQNDISW  377


 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 110/162 (68%), Gaps = 1/162 (1%)
 Frame = -3

Query  648  IGALKQLFHAADDSTMAKMLADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVV  469
            +  LKQ F  +D+    K + + L  CERAP+RGET +CV S+++M  FA+S+LG  VV+
Sbjct  1    MNLLKQFFRISDNGATEKRMKETLENCERAPARGETIKCVRSMDEMEIFASSMLGPKVVL  60

Query  468  RTTENTEGSTKDIMIGSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDP  289
            R T N +GS K++M+G +  I GG VT+SV+CHQ +FP ++Y+CH +P VRVY  ++L  
Sbjct  61   RKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYFCHYIPMVRVYNVEILTL  120

Query  288  KSKSKINHGVAICHIDTSSWSSTHGAFIALGSGPGKIEVCHW  163
            + K KIN  V +CHIDTSSWS +H AF+ LGS P   +   W
Sbjct  121  Q-KIKINQVVGVCHIDTSSWSRSHPAFLELGSAPDGRKWAKW  161



>ref|XP_003613150.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
Length=413

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 150/211 (71%), Gaps = 2/211 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKM  592
            REKML  G +M M DI+D++ KR FL   I +KLP  +T  +  LKQ F  +D+    K 
Sbjct  199  REKMLNEGVVMQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKR  258

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            + + L  CERAP+RGET +CV S+++M  FA+S+LG  VV+R T N +GS K++M+G + 
Sbjct  259  MKETLENCERAPARGETIKCVRSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVS  318

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             I GG VT+SV+CHQ +FP ++Y+CH +P VRVY  ++L  + + KIN  V +CHIDTSS
Sbjct  319  RIQGGNVTESVTCHQEVFPVMLYFCHYIPMVRVYNVEILTLQ-RIKINQAVDVCHIDTSS  377

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            WS +H AF+ LGS PG+IEVCHWIF+ND++W
Sbjct  378  WSRSHPAFLELGSAPGEIEVCHWIFQNDISW  408


 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 129/193 (67%), Gaps = 2/193 (1%)
 Frame = -3

Query  738  MPMPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKMLADALSECER  562
            M M DI+D++ KR FL   I +KLP  +T  +  LKQ F  +D+    K + + L  CER
Sbjct  1    MQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKRMKETLENCER  60

Query  561  APSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVTKS  382
            AP+RGET +CV S+++M  FA+S+LG  VV+R T N +GS K++M+G +  I GG VT+S
Sbjct  61   APARGETIKCVRSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTES  120

Query  381  VSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAFIA  202
            V+CHQ +FP ++Y+CH +P VRVY  ++L  + K KIN  V +CHIDTSSWS +H AF+ 
Sbjct  121  VTCHQEVFPVMLYFCHYIPMVRVYNVEILTLQ-KIKINQVVGVCHIDTSSWSRSHPAFLE  179

Query  201  LGSGPGKIEVCHW  163
            LGS P   +   W
Sbjct  180  LGSAPDGRKWAKW  192



>gb|KCW86727.1| hypothetical protein EUGRSUZ_B03337 [Eucalyptus grandis]
Length=212

 Score =   231 bits (589),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 147/211 (70%), Gaps = 13/211 (6%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            R   L+SG ++ MPD++ + P+RSFLPR I+S LPFSTSKI  LKQ+FHA DDSTM +++
Sbjct  14   RHSTLRSGNVIRMPDLRSKTPERSFLPRSISSGLPFSTSKIAELKQIFHAMDDSTMEEIM  73

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               L  CE+AP++GETKR +             LG N+ +  T++ EGS +DI+IG +K 
Sbjct  74   VRTLGLCEKAPTQGETKRFI-------------LGHNIKLHATKSDEGSKRDILIGRVKR  120

Query  408  INGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSW  229
            I G K +  V+ H SLFP +VY CH+VPK  V+E  +LDP  KSKIN+GVA+CH+DTS+ 
Sbjct  121  IGGSKSSAPVADHDSLFPCMVYNCHAVPKPHVHEVGILDPVCKSKINNGVAVCHMDTSAG  180

Query  228  SSTHGAFIALGSGPGKIEVCHWIFENDMTWA  136
            +  H AF+ALGSGPG+IE CHWI+ +   WA
Sbjct  181  NPNHEAFLALGSGPGRIEACHWIYGDYAVWA  211



>ref|XP_003613151.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96109.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=203

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = -3

Query  732  MPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKMLADALSECERAP  556
            M DIKD++ KR FL   I +KLP  +T  +  LKQ F  +D+    K + + L  CERAP
Sbjct  1    MTDIKDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKRMKETLENCERAP  60

Query  555  SRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVTKSVS  376
            +RGET +CV S+++M  FA+S+LG  VV+R T N +GS K++M+G +  I GG VT+SV+
Sbjct  61   ARGETIKCVRSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVT  120

Query  375  CHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAFIALG  196
            CHQ +FP ++Y+CH +P VRVY  ++L  + + KIN  V +CHIDTSSWS +H AF+ LG
Sbjct  121  CHQEVFPVMLYFCHYIPMVRVYNVEILTLQ-RIKINQAVDVCHIDTSSWSRSHPAFLELG  179

Query  195  SGPGKIEVCHWIFENDMTW  139
            S PG+IEVCHWIF+ND++W
Sbjct  180  SAPGEIEVCHWIFQNDISW  198



>gb|EEE69479.1| hypothetical protein OsJ_28904 [Oryza sativa Japonica Group]
Length=837

 Score =   241 bits (616),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 119/197 (60%), Positives = 144/197 (73%), Gaps = 7/197 (4%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI DR P R+FLPR IA+K+PF  + + AL   F AA  + M +++
Sbjct  435  RERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQVV  491

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +  ++EC R PSRGETKRC TS ED++DFA  +LG NVV R TE+T G   D+ +G + G
Sbjct  492  SSTVAECARPPSRGETKRCATSAEDVVDFAVEMLGDNVVARATESTAGGGGDVRLGRVAG  551

Query  408  I-NGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            +  GG VT+SVSCHQSLFPYLVYYCHSVP VRVYEAD+L   S  KINHGVAICH+DTS 
Sbjct  552  VPAGGNVTRSVSCHQSLFPYLVYYCHSVPTVRVYEADILAVDSNQKINHGVAICHLDTSD  611

Query  231  WSSTHGAFIALGSGPGK  181
            WS  HGAFIAL   PGK
Sbjct  612  WSPNHGAFIAL---PGK  625


 Score =   139 bits (349),  Expect(3) = 2e-33, Method: Composition-based stats.
 Identities = 69/136 (51%), Positives = 93/136 (68%), Gaps = 4/136 (3%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE+ L +G  MPMPDI DR P R+FLPR IA+K+PF  + + AL   F AA  + M +++
Sbjct  628  RERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQVV  684

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
            +  ++EC R PSRGETKRC TS ED++DFA  +LG NVV R TE+T G   D+ +G + G
Sbjct  685  SSTVAECARPPSRGETKRCATSAEDVVDFAVEMLGDNVVARATESTAGCGGDVRLGKVTG  744

Query  408  I-NGGKVTKSVSCHQS  364
            +  GG VT SVSC ++
Sbjct  745  VPAGGNVTPSVSCTRA  760


 Score = 30.0 bits (66),  Expect(3) = 2e-33, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = -2

Query  292  PEIQIQNQPRRRHLSY*HLVLELHPRSLHR  203
            P IQ ++QP R HL   H+ LE   RSL+R
Sbjct  784  PSIQPEDQPWRGHLPSRHVRLEPEFRSLYR  813


 Score = 22.3 bits (46),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 14/26 (54%), Gaps = 0/26 (0%)
 Frame = -1

Query  371  TKACSRT*CITAIRSPKSGSTRRIFW  294
            T+ACSRT C T  R   S  TR   W
Sbjct  758  TRACSRTWCTTGTRFRPSACTRPTSW  783



>ref|XP_003613149.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96107.1| BURP domain protein [Medicago truncatula]
Length=621

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 149/211 (71%), Gaps = 2/211 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKM  592
            REKML  G +M M DI+D++ KR FL   I +KLP  +T  +  LKQ F  +D+    K 
Sbjct  407  REKMLNEGVVMQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKR  466

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            + + L  CERAP+RGET +CV S+++M  FA+S+LG  VV+R T N +GS K++M+G + 
Sbjct  467  MKETLENCERAPARGETIKCVRSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVS  526

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             I GG VT+SV+CHQ +FP ++Y+CH +P VRVY  ++L  + + KIN  V +CHIDTSS
Sbjct  527  RIQGGNVTESVTCHQEVFPVMLYFCHYIPMVRVYNVEILTLQ-RIKINQVVVVCHIDTSS  585

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
             S +H AF+ LGS PG+IEVCHWIF+NDM+W
Sbjct  586  SSRSHPAFLELGSAPGEIEVCHWIFQNDMSW  616


 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 136/203 (67%), Gaps = 2/203 (1%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKM  592
            REKML  G +M M DI+D++ KR FL   I +KLP  +T  +  LKQ F  +D+    K 
Sbjct  199  REKMLNEGVVMQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKR  258

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            + + L  CERAP+RGET +CV S+++M  FA+S+LG  VV+R T N +GS K++M+G + 
Sbjct  259  MKETLENCERAPARGETIKCVRSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVS  318

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             I GG VT+SV+CHQ +FP ++Y+CH +P VRVY  ++L  + K KIN  V +CHIDTSS
Sbjct  319  RIQGGNVTESVTCHQEVFPVMLYFCHYIPMVRVYNVEILTLQ-KIKINQAVGVCHIDTSS  377

Query  231  WSSTHGAFIALGSGPGKIEVCHW  163
            WS +H AF+ LGS P   +   W
Sbjct  378  WSRSHPAFLELGSAPDGRKWAKW  400


 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 128/193 (66%), Gaps = 2/193 (1%)
 Frame = -3

Query  738  MPMPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKMLADALSECER  562
            M M DI+D++ KR FL   I +KLP  +T  +  LKQ F  +D+    K + + L  CER
Sbjct  1    MQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKRMKETLENCER  60

Query  561  APSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVTKS  382
            AP+RGE  +CV S+++M  FA+S+LG  VV+R T N +GS K++M+G +  I GG VT+S
Sbjct  61   APARGEIIKCVRSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTES  120

Query  381  VSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAFIA  202
            V+CHQ +FP ++Y+CH +P VRVY  ++L  + K KIN  V +CHIDTSSWS +H AF+ 
Sbjct  121  VTCHQEVFPVMLYFCHYIPMVRVYNVEILTLQ-KIKINQAVGVCHIDTSSWSRSHPAFLE  179

Query  201  LGSGPGKIEVCHW  163
            LGS P   +   W
Sbjct  180  LGSAPDGRKWAKW  192



>ref|XP_010046647.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=159

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -3

Query  603  MAKMLADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMI  424
            M K++   LS+CE+AP +GETKRCV+SVE MIDFATS+LG ++ + +TE+ EGS ++I+I
Sbjct  1    MEKIMVRTLSQCEQAPIQGETKRCVSSVEGMIDFATSILGHDIQLHSTESVEGSKREILI  60

Query  423  GSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHI  244
            G +K + G K +  V+CH+++FPY+VYYCH+ P +R+YEAD+LDP SK+KINHG+A+CH+
Sbjct  61   GRVKRLEGSKSSAPVACHETIFPYMVYYCHTFPTLRIYEADILDPMSKAKINHGIALCHM  120

Query  243  DTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            DTS WS  H AF+ALGS PG+IE CH +F +   W
Sbjct  121  DTSIWSPNHVAFLALGSSPGQIEACHCVFGDYGVW  155



>ref|XP_003613152.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96110.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=225

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 137/211 (65%), Gaps = 20/211 (9%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLP-FSTSKIGALKQLFHAADDSTMAKM  592
            REKML  G +M M DI+D++ KR FL   I +KLP  +T  +  LKQ F  +D+    K 
Sbjct  29   REKMLNEGVVMQMTDIRDKIHKRQFLFPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKR  88

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIK  412
            + +                  TS+++M  FA+S+LG  VV+R T N +GS K++M+G + 
Sbjct  89   MKE------------------TSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVS  130

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             I GG VT+SV+CHQ +FP ++Y+CH +P VRVY  ++L  + + KIN  V +CHIDTSS
Sbjct  131  RIQGGNVTESVTCHQEVFPVMLYFCHYIPMVRVYNVEILTLQ-RIKINQAVDVCHIDTSS  189

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            WS +H AF+ LGS PG+IEVCHWIF+ND++W
Sbjct  190  WSRSHPAFLELGSAPGEIEVCHWIFQNDISW  220



>ref|XP_010100468.1| hypothetical protein L484_027780 [Morus notabilis]
 gb|EXB82602.1| hypothetical protein L484_027780 [Morus notabilis]
Length=180

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 116/181 (64%), Gaps = 53/181 (29%)
 Frame = -3

Query  513  MIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVTKSVSCHQSLFPYLVYYCH  334
            MIDFATSVLG+NV+VR+TEN  GS K IMIGS+KGINGGK + + SCHQSLFPYLVYYCH
Sbjct  1    MIDFATSVLGQNVIVRSTENVSGSKKYIMIGSVKGINGGK-SHNQSCHQSLFPYLVYYCH  59

Query  333  SVPKVRVYEADLLDPKSKSKINHGVAIC--------------------------------  250
            SVP VRV EAD+LDP SK+KINHGVAIC                                
Sbjct  60   SVPTVRVCEADILDPNSKAKINHGVAICRLFVGVAIRVACRIRIVDPILTRTSFFSTLTR  119

Query  249  --------------------HIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
                                H+DTS+WS THGAF+A GSGPG+IEVCHWIF+ND+TW VA
Sbjct  120  KIRVVFESCCRVVTHIVGPSHLDTSAWSPTHGAFLAFGSGPGQIEVCHWIFKNDLTWTVA  179

Query  129  D  127
            D
Sbjct  180  D  180



>emb|CAN81758.1| hypothetical protein VITISV_043391 [Vitis vinifera]
Length=574

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 129/233 (55%), Gaps = 19/233 (8%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE MLK G +M MPDI+DRMP+RSFLPRVIASKLPFS+S+   LK +FHA D+S M  ++
Sbjct  342  RESMLKEGNVMVMPDIRDRMPERSFLPRVIASKLPFSSSRJQELKDIFHAXDNSAMEHVI  401

Query  588  ADALSEC------------------ERAPSRGETKRCVTSVEDMIDF-ATSVLGRNVVVR  466
            A   +                    + +PSR   +R     E       +S   R+  VR
Sbjct  402  ATRWTSARELRVAARPAVRGFGRGHDSSPSRSWGRRGSEKTETTRGVRESSESRRDQAVR  461

Query  465  TTENTEGSTKDIMIGSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPK  286
                     + +  G+ +G         V                +PKVRVYE D+LD +
Sbjct  462  GFGRGHDRLRRLGPGARRGGENHGDDAWVKAEGDGGGSQRDQRRKIPKVRVYEVDILDVE  521

Query  285  SKSKINHGVAICHIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
             K K+N GVAICHIDTS+WS +HGAF+ALGS PG IEVCHWIFENDMTW  +D
Sbjct  522  RKEKMNKGVAICHIDTSAWSQSHGAFVALGSSPGLIEVCHWIFENDMTWTTSD  574



>gb|AAT08718.1| polygalacturonase [Hyacinthus orientalis]
Length=194

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 112/173 (65%), Gaps = 3/173 (2%)
 Frame = -3

Query  642  ALKQLFHAADDSTMAKMLADALSECERAPSRGETKRCVTSVEDMIDFATSVLG--RNVVV  469
            A+++LF    D+ M K +A A+  C+ AP  G+T+RCVTS EDMID+  S LG   ++  
Sbjct  21   AIRKLFRIPADAPMGKSVATAIELCKEAPVEGQTRRCVTSAEDMIDYVVSSLGAKSSLTA  80

Query  468  RTTENTEGSTKDIMIGSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDP  289
            ++T N+ G   D++IG +K   GG++ + VSCH + FPYL+Y CHSVPK  +Y+ ++LDP
Sbjct  81   KSTSNSNGLGSDVLIGEVKAAGGGELGRVVSCHHTTFPYLMYRCHSVPKTVLYDVEILDP  140

Query  288  KSKSKINHGVAICHIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            ++K +IN   AICH DTS WS  H  F AL    G ++ CHW+F  DM W  A
Sbjct  141  ETKGRINLAAAICHFDTSVWSPRHATFQALVYERG-MDACHWVFPMDMAWTAA  192



>gb|AAT08687.1| polygalacturonase [Hyacinthus orientalis]
Length=171

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (2%)
 Frame = -3

Query  603  MAKMLADALSECERAPSRGETKRCVTSVEDMIDF-ATSVLGR-NVVVRTTENTEGSTKDI  430
            M K +A  +  C  AP++GET RC+TS EDMID+ ATS++ + N+  R+T+N+     ++
Sbjct  11   MGKAVATTIDHCNSAPAKGETMRCITSAEDMIDYLATSLVAKINITARSTDNSIQLGGNV  70

Query  429  MIGSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAIC  250
            +IG +K  NGGK+   VSCHQ+ FPYL+Y CHSVP+ ++YE ++LDP++K+KI+   AIC
Sbjct  71   LIGEVKAANGGKLGHVVSCHQAAFPYLLYRCHSVPETKLYEVEILDPETKAKISAATAIC  130

Query  249  HIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVA  130
            H DTS WS  H AF+ALG   G +E+C W+F   + W  A
Sbjct  131  HFDTSVWSRDHVAFMALGYERG-MEICQWVFPGAIAWTAA  169



>emb|CDP10831.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 133/213 (62%), Gaps = 8/213 (4%)
 Frame = -3

Query  759  MLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAK-MLAD  583
            +LK G++M + ++++++P+ SFLP  IASK  FS  +   L++LF  +  +   K  +  
Sbjct  30   LLKQGSMMHLSNLENQLPQHSFLPSQIASK--FSVVE-NDLQKLFPQSLKNPRTKDAIQS  86

Query  582  ALSECERAPSRGETKRCVTSVEDMIDFATSVLGRN-VVVRTTENTEGSTKDIMIGSIKGI  406
             L  C   P + E + CV S+EDM++FA + +G N VV  TT+NTEGS K+ ++G ++ +
Sbjct  87   TLIYCNTPPLKEEIQSCVKSLEDMVEFAKAAIGTNHVVPLTTKNTEGSGKEFIVGHVEKL  146

Query  405  NGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWS  226
               K  K VSCH+   P+  Y+CH + K   Y  D+L+PK+K  IN  + ICH+DTS+WS
Sbjct  147  ---KFKKIVSCHEFFLPFATYFCHLLSKTEAYAVDVLEPKTKLPINTVMVICHMDTSNWS  203

Query  225  STHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
              H AF  L S PGK+  CHW+F+ND+ +  A+
Sbjct  204  PNHVAFKLLKSSPGKVVACHWVFQNDLLFVSAE  236



>gb|EMT26618.1| hypothetical protein F775_18544 [Aegilops tauschii]
Length=560

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -3

Query  549  GETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVTKSVSCH  370
            GETKRC TS EDM+DFA  +L  NV VR+TE+  GS+ DI IG + G+ GG  T+SVSCH
Sbjct  430  GETKRCATSAEDMLDFAVEMLWDNVAVRSTESAAGSSWDIRIGRVAGVAGGHATRSVSCH  489

Query  369  QSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAFIALGSG  190
            QS+FPYLVYYCHSVP +RVYEA++L   S  KIN GVAICH+DTS WS  HGAF ALG  
Sbjct  490  QSMFPYLVYYCHSVPSMRVYEAEILATDSGWKINRGVAICHLDTSDWSPGHGAFAALGGK  549

Query  189  PGKIE  175
            PG++E
Sbjct  550  PGEME  554


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFS  658
            RE+ L +G  MPMPDI D+MP R+FLPR IA+K+PF+
Sbjct  197  RERDLITGNRMPMPDISDKMPPRAFLPRDIAAKMPFA  233



>gb|AAL65393.1| polygalacturonase isoenzyme 1 beta subunit [Oryza sativa Japonica 
Group]
Length=112

 Score =   166 bits (419),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  450  EGSTKDIMIGSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKI  271
             G  + IMIG +KGINGGK+T SVSCH+ LFPY+VYYCHSVPK+RVYEA++L  ++K KI
Sbjct  3    NGPGESIMIGKVKGINGGKITSSVSCHEYLFPYMVYYCHSVPKIRVYEAEILSVQTKEKI  62

Query  270  NHGVAICHIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            N GVAICHIDTS+W++ H AF+ALG  PG+ +VCHWIF   MTW +AD
Sbjct  63   NSGVAICHIDTSAWNAGHPAFVALGGKPGQNKVCHWIFNGSMTWVIAD  110



>emb|CDP10830.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 131/212 (62%), Gaps = 8/212 (4%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAK-M  592
            R  +LK G+++ +PD+++++P+ SFLP  IASK+  + +    L++LF  +  +   K  
Sbjct  125  RISLLKQGSMVHLPDLENQLPQHSFLPSQIASKISIAEND---LQKLFPQSLKNPQTKDA  181

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRN-VVVRTTENTEGSTKDIMIGSI  415
            +   +  C     + E + CV S+EDM++FA +  G N +V  T++NT+GS KD+++G +
Sbjct  182  IQSTIVYCNTPALKDEIQSCVKSLEDMVEFAKTATGNNHLVALTSKNTKGSGKDLIVGQM  241

Query  414  KGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTS  235
            K +  GK   +VSCH+   P+  Y+CH + K  VY  D+L+PK+K  IN    ICH+DTS
Sbjct  242  KKLKFGK---TVSCHELFLPFSTYFCHLLSKTEVYAVDVLEPKTKIPINTVTVICHMDTS  298

Query  234  SWSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
             WS  H AF  L + PG+ E CHWI +ND+ +
Sbjct  299  DWSPNHVAFKVLKTSPGQSEACHWISQNDLIF  330



>gb|AAL15882.1|AF417294_1 putative polygalacturonase beta subunit [Castanea sativa]
Length=121

 Score =   155 bits (393),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = -3

Query  438  KDIMIGSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGV  259
            ++IMIGS++GINGGKVT+ VSCHQ+LFPYL+Y+CHSVPKVRVYE D+LDP SK+KINHGV
Sbjct  15   QNIMIGSVRGINGGKVTQIVSCHQTLFPYLLYHCHSVPKVRVYEVDILDPNSKAKINHGV  74

Query  258  AICHIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD*LNS  115
            A CH+ TS  S+ + A + + SGPG+I+ CHW+ EN + W +AD L+S
Sbjct  75   ASCHMHTSD-SNPNQAELTIASGPGQIKACHWVVENHLIWTIADLLSS  121



>ref|XP_006844960.1| hypothetical protein AMTR_s00058p00173800 [Amborella trichopoda]
 gb|ERN06635.1| hypothetical protein AMTR_s00058p00173800 [Amborella trichopoda]
Length=583

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 3/143 (2%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            R+K+L  G I+PMPDI+D MP RSFLPR IA KLPFST  +  L  +F   +DS M K+L
Sbjct  417  RQKLLTRGAILPMPDIRDSMPSRSFLPRSIAEKLPFSTESLPRLAAVFSTVEDSGMGKVL  476

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKG  409
               L ECER PS+GE ++CVTS+E M+DFA S+LG+   ++ TE+  G  +++ +G ++ 
Sbjct  477  RKTLKECEREPSKGERRKCVTSIEGMMDFAVSILGKKASLKATESVNGWGREVELGEVRD  536

Query  408  INGGKVTKSVSCHQSLFPYLVYY  340
            +N   VT++VSCHQSLFPYL  Y
Sbjct  537  LN---VTEAVSCHQSLFPYLEKY  556



>gb|EYU36709.1| hypothetical protein MIMGU_mgv1a024306mg [Erythranthe guttata]
Length=267

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 124/217 (57%), Gaps = 10/217 (5%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAK-M  592
            R  +LK+G ++ +P +++ +P R+FLP  +AS++P + +   A+ ++F  +D +   K  
Sbjct  50   RMSVLKNGNLVHLPHLQETLPDRAFLPEKMASRIPLNYT---AISRIFPDSDVTGKTKAT  106

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLG-----RNVVVRTTENTEGSTKDIM  427
            +   L  C  A  RGETK C  S+E+M+ FA   LG     + VV  T+++T GS     
Sbjct  107  IQTTLGYCNAAAIRGETKSCPRSLEEMVGFARVTLGGGGDKKKVVALTSKSTVGSNSIAK  166

Query  426  IGSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSK-INHGVAIC  250
            IG IK   GG   K V+CH++  P+  YYCH +   R+Y  D +D ++ SK +N  + IC
Sbjct  167  IGKIKEYGGGAGEKIVACHEAFLPFAAYYCHLLTSTRLYMVDFVDRETGSKVVNMMLGIC  226

Query  249  HIDTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            H+DTS W   H AF  L  GPG+ E CHW  + D+ W
Sbjct  227  HMDTSHWPKEHVAFKILKFGPGEGEACHWFTQLDLAW  263



>gb|AAL08244.1| At1g70370/F17O7_9 [Arabidopsis thaliana]
 gb|AAN18083.1| At1g70370/F17O7_9 [Arabidopsis thaliana]
Length=517

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            RE  LK GT++PMPDIKD+MPKRSFLPR I +KLPFSTSK+G +K++FHA ++STM  ++
Sbjct  413  RESSLKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGII  472

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRT  463
             DA++ECER PS GETKRCV S EDMIDFATSVLGR+VV+RT
Sbjct  473  TDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRT  514



>gb|EYU36708.1| hypothetical protein MIMGU_mgv1a009279mg [Erythranthe guttata]
Length=347

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 129/218 (59%), Gaps = 10/218 (5%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAK-M  592
            R   LK G ++ +P +K+ +P R+FLP+ +ASK+P +     A+ ++F  +D S   K  
Sbjct  135  RLSALKEGKLIHLPHLKESLPDRAFLPQQMASKIPLN---YDAISRIFPDSDISGKTKET  191

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLG-RNVVVRTTENTEGSTKDIMIGSI  415
            +   L+ C     +GET+ C  S+E+M+ FA S LG + VV  TT+NT GS   + IG I
Sbjct  192  IQTTLAYCNAEAIQGETESCPKSLEEMVGFAKSTLGGKKVVALTTKNTRGSNSAVRIGKI  251

Query  414  KGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLL-DPKSKSKI-NHGVAICHID  241
            K   GGK  K V+CH++  P+  Y+CHS+   R+Y  D++ D ++ S + N  + ICH+D
Sbjct  252  KEYGGGK--KIVACHEAFLPFAAYFCHSLSSTRLYAVDVVVDRETGSNVVNTMLGICHMD  309

Query  240  TSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            TS W   H AF  L  GPG+ E CHW  + D+ W +AD
Sbjct  310  TSQWPKDHVAFQILKFGPGEGEACHWFTKLDLAW-IAD  346



>ref|XP_011091745.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=336

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 125/211 (59%), Gaps = 11/211 (5%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            R  +LK G  + + D+K  +P R+FLP  IASK+  ++  I    ++F  +      + +
Sbjct  129  RLSILKEGNTIHLSDLKASLPYRAFLPPQIASKITLTSKGIA---KIFPESSK----EAV  181

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRN-VVVRTTENTEGSTKDIMIGSIK  412
               LS C  A  +GE K C  S+E+MI+F+ S LG+N ++  T+++T GS +++ I  IK
Sbjct  182  GTTLSYCNAAAIKGELKVCPKSLEEMINFSKSALGKNKLLALTSKSTRGSGEELKIEKIK  241

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
              +   V K V+CH+   P+  Y+CHS+P  R+Y  D ++PKS + +N  +A+CH+DTS 
Sbjct  242  QFD---VEKIVACHEMYLPFATYFCHSLPSSRIYSVDFVEPKSGAPVNTVLAMCHMDTSP  298

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W + H AF  L  GPG+ E CHW  E D+ W
Sbjct  299  WPADHVAFQILKFGPGQGEACHWSNEIDLAW  329



>ref|XP_011091740.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=281

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 122/211 (58%), Gaps = 11/211 (5%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            R   LK G  + +  +K  +P R+FLP  IASK+P ++  I  +       D +T     
Sbjct  76   RLSTLKEGNEIHLSSLKVSLPFRAFLPSQIASKVPLTSEGIAKIFPQSSKEDTAT-----  130

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRN-VVVRTTENTEGSTKDIMIGSIK  412
               L  C  A  +GE K C  S+E+MI F+ S LG+N ++  T+++T+GS  ++ I  IK
Sbjct  131  --TLYYCNAAAIKGELKVCPKSLEEMISFSKSALGKNKLLALTSKSTKGSASELKIKRIK  188

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
              +   V K V+CH+   P+  Y+CHS+P  ++Y  D+++P + + +N  VAICH+DTS+
Sbjct  189  QYD---VEKIVACHEMYLPFATYFCHSLPSSKIYAVDVVEPSTGAPVNTVVAICHMDTSA  245

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W   H AF  +  GPG+ EVCHW+ E D+ W
Sbjct  246  WPEEHVAFKIVKLGPGQGEVCHWLSEIDVAW  276



>ref|XP_011074238.1| PREDICTED: BURP domain-containing protein 16-like [Sesamum indicum]
Length=334

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 120/211 (57%), Gaps = 7/211 (3%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            R   LK+G ++ +P++++ +P R+FLP  I S +P +   I    + F         + +
Sbjct  124  RVSTLKTGNLVHLPNLQETLPDRTFLPPQIVSSIPLTYEGI---TEAFPEWGVGPTKETI  180

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLG-RNVVVRTTENTEGSTKDIMIGSIK  412
               L+ C  A   GETK C  S+E+M+ FAT+ LG   ++  T++N+ GS  +++IG +K
Sbjct  181  QTTLAYCNAAAIEGETKSCPKSLEEMVGFATASLGGTKLLALTSKNSRGSGAEMIIGKMK  240

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
                   TK V+CH++  P+  Y CHS+    +Y  +++DPK  + +N  +AICH+DTS+
Sbjct  241  HYGA---TKIVACHEAFLPFAAYVCHSLSSTGLYAVEVVDPKGGAAVNTLLAICHMDTSA  297

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W   H AF  L  GPG+ E CHW  + D+ W
Sbjct  298  WPKNHVAFEILKFGPGEGEACHWFTQLDLAW  328



>ref|XP_006661124.1| PREDICTED: LOW QUALITY PROTEIN: BURP domain-containing protein 
14-like [Oryza brachyantha]
Length=505

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -3

Query  420  SIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHID  241
            ++ G  G      VSCHQSLFPYLVYYCHSVP V VYEAD+L   S  +INHGVA+CH+D
Sbjct  408  AVGGGAGNATRPVVSCHQSLFPYLVYYCHSVPAVHVYEADILAVDSGHRINHGVAVCHLD  467

Query  240  TSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            TS WS  HGAFIALG  PG+IEVCHWIFE DMTW VA+
Sbjct  468  TSDWSPNHGAFIALGGKPGEIEVCHWIFEGDMTWTVAN  505



>ref|XP_001776362.1| predicted protein [Physcomitrella patens]
 gb|EDQ58861.1| predicted protein, partial [Physcomitrella patens]
Length=220

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 114/215 (53%), Gaps = 8/215 (4%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKL-PFSTSKIGALKQLFHAADDSTMAKM  592
             E ++K   +    ++ D +PKR+FLP+V+A  L P STS +  L+Q F+  +++ MA +
Sbjct  4    EENLVKGAKMNLTENLHDPIPKRAFLPKVVADLLSPLSTSNLPKLRQTFNIGENTKMATI  63

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTE----NTEGSTKDIMI  424
            +  A   CE  P  GE + C TSVE M +F  S LG+NV +  T     N     K + +
Sbjct  64   MGTATYLCENPPLPGEERACPTSVETMAEFVASQLGKNVKLLETRGAPANAPVEKKPVTV  123

Query  423  GSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHI  244
                 ++  +  K V CH  +FP  VYYCH V   +V +A L    +      GVA+CH+
Sbjct  124  EDFTKLSLEEGKKIVICHNLMFPSQVYYCHHVKGTKVVQASLA--AADGSTISGVAVCHL  181

Query  243  DTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            DT+ WSS H AF AL   P   E CHW  +ND  W
Sbjct  182  DTTMWSSEHPAFAALKI-PRGAEACHWTAQNDYIW  215



>gb|AFV47141.1| BURP domain RD22-like protein [Physcomitrella patens]
Length=367

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 115/215 (53%), Gaps = 8/215 (4%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKL-PFSTSKIGALKQLFHAADDSTMAKM  592
             E + K  T+    ++ D +PKRSFLP+ +A  L P +TS +  L+  F+  +++ MA +
Sbjct  151  EENLAKGATMNLAENLHDPIPKRSFLPKAVADTLTPLTTSNLPKLRHTFNIGENTKMATI  210

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGST----KDIMI  424
            +  A   CE  P  GE + C  SVEDM +F +S LGRN  +  T    G+     K +++
Sbjct  211  MGTAAYLCENPPLPGEERACPASVEDMAEFVSSQLGRNATMLKTRGAPGNAPAQKKPVIV  270

Query  423  GSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHI  244
                  +  +  K V CH  +FP  +YYCH V   ++ EA L        I HGVA+CH+
Sbjct  271  KDFTKHSVEEGKKIVVCHNLMFPSQLYYCHHVTGTKLVEASLA--ADDGYIIHGVAVCHL  328

Query  243  DTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            +T+ W+S H AF AL   P   E CHW  +ND+ W
Sbjct  329  NTTMWASEHPAFAALNI-PRGAEACHWTSQNDLIW  362



>gb|EMS64687.1| hypothetical protein TRIUR3_01269 [Triticum urartu]
Length=487

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -3

Query  393  VTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHG  214
             T+SVSCHQS+FPYLVYYCHSVP VRVYEA++L  ++  KIN GVAICH+DTS WS  HG
Sbjct  399  TTRSVSCHQSMFPYLVYYCHSVPSVRVYEAEILAVETGRKINRGVAICHLDTSDWSPGHG  458

Query  213  AFIALGSGPGKIEVCHWIFENDMTWAVAD  127
            AF ALG  PG++EVCHWIF+ DM W VAD
Sbjct  459  AFAALGGKPGEMEVCHWIFQGDMVWTVAD  487



>ref|XP_001783704.1| predicted protein [Physcomitrella patens]
 gb|EDQ51476.1| predicted protein [Physcomitrella patens]
Length=232

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 113/215 (53%), Gaps = 8/215 (4%)
 Frame = -3

Query  768  REKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKL-PFSTSKIGALKQLFHAADDSTMAKM  592
             E + K  ++    ++ D +PKRSFLP+ +A  L P +TS +  L+Q F+  +++ MA +
Sbjct  16   EENLAKGASMNLAENLHDPIPKRSFLPKAVADTLTPVTTSNLPKLRQTFNIGENTKMATI  75

Query  591  LADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGST----KDIMI  424
            +  A   CE  P  GE + C  SVE M  F +S LGRN  +  T    G+     K +++
Sbjct  76   MGTAAYLCENPPLPGEERACPASVESMAKFVSSQLGRNATMLKTRGAPGNAPAQKKPLIV  135

Query  423  GSIKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHI  244
                  +  +  K V CH  +FP  +YYCH V   +V EA L    +   I  GVA+CH+
Sbjct  136  KDFTKHSVEEGKKIVVCHNLMFPSQLYYCHHVTGTKVVEASLA--AADGYIIRGVAVCHL  193

Query  243  DTSSWSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            +T+ W S H AF AL   P   E CHW  +ND+ W
Sbjct  194  NTTMWGSEHPAFAALKI-PRGAEACHWTSQNDLIW  227



>ref|XP_006833278.1| hypothetical protein AMTR_s00109p00021460 [Amborella trichopoda]
 gb|ERM98556.1| hypothetical protein AMTR_s00109p00021460 [Amborella trichopoda]
Length=377

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 107/195 (55%), Gaps = 6/195 (3%)
 Frame = -3

Query  714  RMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLADALSECERAPSRGETKR  535
            + P  +FLPR++A  LPFS+SK+  +   F     S  A+ +   L+ECE     GE K 
Sbjct  182  QEPMPTFLPRLVADALPFSSSKLTNILNRFSVTPGSVEAEAMKQTLAECEEPAITGEAKH  241

Query  534  CVTSVEDMIDFATSVLGRNVVVRTTENT---EGSTKDIMIGSIKGINGGKVTKSVSCHQS  364
            C TS+E M+DFAT  LG+ V V  T  T       K   +GS  G++     KSV+CH  
Sbjct  242  CATSLESMVDFATMRLGKEVRVMATTITAPVNRQPKKYTVGS--GVHQVVAPKSVACHAQ  299

Query  363  LFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWSSTHGAFIALGSGPG  184
             +PY V++CH     RVY   LL     ++++  VA+CH+DTS+W+  H AF  L   PG
Sbjct  300  NYPYAVFFCHEATAARVYRVPLLGGAGSTEVD-AVAVCHLDTSAWNPDHVAFKVLKVKPG  358

Query  183  KIEVCHWIFENDMTW  139
               VCH++ ++ + W
Sbjct  359  SEPVCHFLPQDHLVW  373



>ref|XP_003522684.1| PREDICTED: dehydration-responsive protein RD22-like [Glycine 
max]
Length=341

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 116/211 (55%), Gaps = 7/211 (3%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLA  586
            EK L SGT + +   +    + +FL R +A  +PFS++K+  +   F     S  A+++ 
Sbjct  133  EKDLHSGTKLDLHFTRSTSNQATFLSRQVADSIPFSSNKVDFIFNKFSVKPGSEEAQIMK  192

Query  585  DALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTE--NTEGSTKDIMIGSIK  412
            + +SECE    +GE K C TS+E M+DF+TS LG NV V +TE     G  K  +   +K
Sbjct  193  NTISECEEGGIKGEEKYCATSLESMVDFSTSKLGNNVEVVSTEVDKETGLQKYTVAPGVK  252

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             ++G    K+V CH+  +PY V+YCH     R Y    L+  +  ++   VA+CH DTS 
Sbjct  253  KLSGD---KAVVCHKQNYPYAVFYCHKTETTRAYSVP-LEGTNGVRVK-AVAVCHTDTSE  307

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W+  H AF  L   PG I VCH++ E+ + W
Sbjct  308  WNPKHLAFQVLKVKPGTIPVCHFLPEDHVVW  338



>gb|ACU19496.1| unknown [Glycine max]
Length=341

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 116/211 (55%), Gaps = 7/211 (3%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLA  586
            EK L SGT + +   +    + +FL R +A  +PFS++K+  +   F     S  A+++ 
Sbjct  133  EKDLHSGTKLDLHFTRSTSNQATFLSRQVADSIPFSSNKVDFIFNKFSVKPGSEEAQIMK  192

Query  585  DALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTE--NTEGSTKDIMIGSIK  412
            + +SECE    +GE K C TS+E M+DF+TS LG NV V +TE     G  K  +   +K
Sbjct  193  NTISECEEGGIKGEEKYCATSLESMVDFSTSKLGNNVEVVSTEVDKETGLQKYTVAPGVK  252

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             ++G    K+V CH+  +PY V+YCH     R Y    L+  +  ++   VA+CH DTS 
Sbjct  253  KLSGD---KAVVCHKQNYPYAVFYCHKTVTTRAYSVP-LEGTNGVRVK-AVAVCHTDTSE  307

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W+  H AF  L   PG I VCH++ E+ + W
Sbjct  308  WNPKHLAFQVLKVKPGTIPVCHFLPEDHVVW  338



>gb|KHN10237.1| Dehydration-responsive protein RD22 [Glycine soja]
Length=341

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 116/211 (55%), Gaps = 7/211 (3%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLA  586
            EK L SGT + +   +    + +FL R +A  +PFS++K+  +   F     S  A+++ 
Sbjct  133  EKDLHSGTKLDLHFTRSTSNQATFLSRQVADSIPFSSNKVDFIFNKFSVKPGSEEAQIMK  192

Query  585  DALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTE--NTEGSTKDIMIGSIK  412
            + +SECE    +GE K C TS+E M+DF+TS LG NV + +TE     G  K  +   +K
Sbjct  193  NTISECEEGGIKGEEKYCATSLESMVDFSTSKLGNNVEIVSTEVDKETGLQKYTVAPGVK  252

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             ++G    K+V CH+  +PY V+YCH     R Y    L+  +  ++   VA+CH DTS 
Sbjct  253  KLSGD---KAVVCHKQNYPYAVFYCHKTETTRAYSVP-LEGANGVRVK-AVAVCHTDTSE  307

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W+  H AF  L   PG I VCH++ E+ + W
Sbjct  308  WNPKHLAFQVLKIKPGTIPVCHFLPEDHVVW  338



>ref|XP_003588551.1| BURP domain-containing protein [Medicago truncatula]
 gb|AES58802.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=385

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 121/213 (57%), Gaps = 8/213 (4%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIK-DRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKML  589
            EK L  GT + +   K +      FLP+ +A+ +PFS+SK+  +  LF   + +  ++++
Sbjct  174  EKDLHQGTKLNLQFTKTNSNDDAKFLPKEVANSIPFSSSKVENILNLFSIKEGTEESEIV  233

Query  588  ADALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGST---KDIMIGS  418
             + +SECE    +GE K CVTS+E M+DF TS LG NV   +TE  + S+   + +M   
Sbjct  234  KNTISECEENGIKGEEKLCVTSLESMVDFTTSKLGNNVEAVSTEVKKESSDLQEYVMAKG  293

Query  417  IKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDT  238
            +K +  G+  K+V CH+  +PY V+YCH     +VY    L+    S++   VA+CH DT
Sbjct  294  VKKL--GEKNKAVVCHKESYPYAVFYCHKTDSTKVYSVP-LEGVDGSRVK-AVAVCHTDT  349

Query  237  SSWSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            S W+  H AF  L   PG + VCH++ ++ + W
Sbjct  350  SQWNPKHLAFQVLNVQPGTVPVCHFLPQDHVVW  382



>ref|XP_004498543.1| PREDICTED: dehydration-responsive protein RD22-like [Cicer arietinum]
Length=381

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 116/211 (55%), Gaps = 6/211 (3%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLA  586
            EK L  GT + M   K    +   LPR +A+ +PFS++KI  +   F   + S  ++++ 
Sbjct  172  EKDLHQGTKLNMQFTKTSDNEAKILPREVANSIPFSSNKIETILNHFSIKEGSEESEIVK  231

Query  585  DALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTE-NTEGSTKDIMIGSIKG  409
              ++ECE    +GE K CVTS+E M+DF TS LG NV   +TE N E   +   I   +G
Sbjct  232  TTINECEETGIKGEEKLCVTSLESMVDFTTSKLGNNVEAVSTEVNKESDLQQYRI--TQG  289

Query  408  ING-GKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
            +   G+  K+V CH+  +PY V+YCH     +VY    L+    S++   VA+CH DTS 
Sbjct  290  VKKLGEKNKAVVCHKENYPYAVFYCHKTDSTKVYSVP-LEGVDGSRVK-AVAVCHTDTSQ  347

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W+  H AF  L   PG + VCH+I ++ + W
Sbjct  348  WNPKHLAFQVLKVQPGTVPVCHFIPQDHVVW  378



>ref|XP_003588464.1| Dehydration-responsive protein RD22 [Medicago truncatula]
 gb|AES58715.1| dehydration-responsive protein RD22 [Medicago truncatula]
 gb|KEH16133.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=325

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 116/211 (55%), Gaps = 6/211 (3%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLA  586
            EK L  GT + +   K      +FLPR +A+ +PFS +K+  +    +    S   +++ 
Sbjct  116  EKDLHHGTKLNLQFTKTTSNAATFLPRQVANSIPFSLNKVEYIINKLNIKKGSKGVQIVK  175

Query  585  DALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTE-NTEGSTKDIMIGS-IK  412
            + +SECE    +GE K CVTS+E M+DF TS LG+NV   +TE N E + +   I S +K
Sbjct  176  NTISECEEQGIKGEEKVCVTSLESMVDFTTSKLGKNVEAVSTEVNKESNLQQYTIASGVK  235

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             +  G+  K+V CH+  +PY V+YCH     + Y    L+    S++   +A+CH DTS 
Sbjct  236  KL--GEKNKAVVCHKENYPYAVFYCHKTDTTKAYSVP-LEGADGSRVK-AIAVCHTDTSE  291

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W+  H AF  L   PG + VCH + E+ + W
Sbjct  292  WNPKHLAFQVLKVQPGTVPVCHLLPEDHVVW  322



>emb|CAN75710.1| hypothetical protein VITISV_004492 [Vitis vinifera]
Length=369

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 114/209 (55%), Gaps = 4/209 (2%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLA  586
            EK ++ GT M +  I+D     +FLPR +A+ +PFS+ K   +   F    +S  A+ + 
Sbjct  162  EKNMQPGTKMELHFIRDAN-LATFLPRQVANSIPFSSKKFPEILNEFSIKPESEEAETIK  220

Query  585  DALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGI  406
            + + ECE    +GE K C TS+E M+DF+TS LG+ V + +TE  E  T +       G+
Sbjct  221  NTIRECEEPGIKGEEKYCATSLESMVDFSTSKLGKGVQMISTE-VEKETPEQQYTITTGV  279

Query  405  NGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWS  226
                  K+V CH+  +PY V+YCH     R Y   L+     SK+   VA+CH DTS+W+
Sbjct  280  KKLAGDKAVVCHKQSYPYAVFYCHKTQTTRAYMVPLVGADG-SKVK-AVAVCHTDTSAWN  337

Query  225  STHGAFIALGSGPGKIEVCHWIFENDMTW  139
              H AF  L   PG + +CH++ E+ + W
Sbjct  338  PKHLAFQVLKVKPGTVPICHFLPEDHVVW  366



>ref|NP_001268112.1| RD22-like protein precursor [Vitis vinifera]
 gb|AAV36561.1| RD22-like protein [Vitis vinifera]
Length=364

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 114/209 (55%), Gaps = 4/209 (2%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLA  586
            EK ++ GT M +  I+D     +FLPR +A+ +PFS+ K   +   F    +S  A+ + 
Sbjct  157  EKNMQPGTKMELHFIRDAN-LATFLPRQVANSIPFSSKKFPEILNEFSIKPESEEAETIK  215

Query  585  DALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGI  406
            + + ECE    +GE K C TS+E M+DF+TS LG+ V + +TE  E  T +       G+
Sbjct  216  NTIRECEEPGIKGEEKYCATSLESMVDFSTSKLGKGVQMISTE-VEKETPEQQYTITTGV  274

Query  405  NGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSSWS  226
                  K+V CH+  +PY V+YCH     R Y   L+     SK+   VA+CH DTS+W+
Sbjct  275  KKLAGDKAVVCHKQSYPYAVFYCHKTQTTRAYMVPLVGADG-SKVK-AVAVCHTDTSAWN  332

Query  225  STHGAFIALGSGPGKIEVCHWIFENDMTW  139
              H AF  L   PG + +CH++ E+ + W
Sbjct  333  PKHLAFQVLKVKPGTVPICHFLPEDHVVW  361



>ref|XP_003588559.1| BURP domain-containing protein [Medicago truncatula]
 gb|ACJ84431.1| unknown [Medicago truncatula]
 gb|AES58810.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=325

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 117/211 (55%), Gaps = 6/211 (3%)
 Frame = -3

Query  765  EKMLKSGTIMPMPDIKDRMPKRSFLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLA  586
            EK L  GT + +   K      +FLPR +A+ +PFS++K+  +    +    S   +++ 
Sbjct  116  EKDLHHGTKLNLQFSKTTSNAATFLPRQVANSIPFSSNKMEYIINKLNIKKGSKGVQIVK  175

Query  585  DALSECERAPSRGETKRCVTSVEDMIDFATSVLGRNVVVRTTE-NTEGSTKDIMIGS-IK  412
            + +SECE    +GE K CVTS+E M+DF TS LG+NV   +TE N E + +   I S +K
Sbjct  176  NTISECEEQGIKGEEKVCVTSLESMVDFTTSKLGKNVEAVSTEVNKESNLQQYTIASGVK  235

Query  411  GINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPKSKSKINHGVAICHIDTSS  232
             +  G+  K+V CH+  +PY V+YCH     + Y    L+    S++   +A+CH DTS 
Sbjct  236  KL--GEKNKAVVCHKENYPYAVFYCHKTDTTKAYSVP-LEGADGSRVK-AIAVCHTDTSE  291

Query  231  WSSTHGAFIALGSGPGKIEVCHWIFENDMTW  139
            W+  H AF  L   PG + VCH + E+ + W
Sbjct  292  WNPKHLAFQVLKVQPGTVPVCHLLPEDHVVW  322



>ref|XP_002284368.1| PREDICTED: dehydration-responsive protein RD22 [Vitis vinifera]
Length=297

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 104/188 (55%), Gaps = 10/188 (5%)
 Frame = -3

Query  696  FLPRVIASKLPFSTSKIGALKQLFHAADDSTMAKMLADALSECERAPSRGETKRCVTSVE  517
            FLPR +A  +PFS+ K+  +       + S  A+++   + +CE     GE++ C TS+E
Sbjct  115  FLPRQVADSIPFSSKKLPEILNRLSVKEKSAEAELMKKEIEKCEEPAMDGESRFCATSLE  174

Query  516  DMIDFATSVLGRNVVVRTTENTEGSTKDIMIGSIKGINGGKVT-KSVSCHQSLFPYLVYY  340
             +IDF+TS LGRNV V T E   GS +        G+   KV  KSV CH+  +PY V+Y
Sbjct  175  SLIDFSTSKLGRNVNVLTNEVRMGSQEFEF-----GVRMKKVADKSVVCHKMNYPYAVFY  229

Query  339  CHSVPKVRVYEADLL-DPKSKSKINHGVAICHIDTSSWSSTHGAFIALGSGPGKIEVCHW  163
            CH+  K R Y   L+ D  SK+K    +A CH DTS+W   H AF  L   PG + +CH+
Sbjct  230  CHTFAKTRTYMIPLVGDDGSKAK---AMAACHSDTSAWHPQHVAFQVLKIKPGTVPICHF  286

Query  162  IFENDMTW  139
            +  N M W
Sbjct  287  LHNNAMVW  294



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100