BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048C05

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781542.1|  PREDICTED: probable leucine-rich repeat rece...    342   5e-115   Nicotiana sylvestris
ref|XP_004230391.1|  PREDICTED: probable leucine-rich repeat rece...    350   6e-110   Solanum lycopersicum
ref|XP_006358482.1|  PREDICTED: probable leucine-rich repeat rece...    350   7e-110   Solanum tuberosum [potatoes]
ref|XP_009605195.1|  PREDICTED: probable leucine-rich repeat rece...    344   9e-108   Nicotiana tomentosiformis
emb|CDO97682.1|  unnamed protein product                                338   2e-105   Coffea canephora [robusta coffee]
ref|XP_011088111.1|  PREDICTED: probable leucine-rich repeat rece...    333   1e-103   
gb|EYU33312.1|  hypothetical protein MIMGU_mgv1a0019072mg               325   6e-103   Erythranthe guttata [common monkey flower]
ref|XP_007023751.1|  Leucine-rich repeat family protein / protein...    313   5e-102   
ref|XP_011092240.1|  PREDICTED: probable leucine-rich repeat rece...    328   8e-102   
ref|XP_011092239.1|  PREDICTED: probable leucine-rich repeat rece...    328   1e-101   Sesamum indicum [beniseed]
ref|XP_011092238.1|  PREDICTED: probable leucine-rich repeat rece...    328   1e-101   Sesamum indicum [beniseed]
ref|XP_007023746.1|  Leucine-rich repeat protein kinase family pr...    319   9e-101   
ref|XP_007023744.1|  Leucine-rich repeat protein kinase family pr...    319   2e-98    
ref|XP_007023743.1|  Leucine-rich repeat protein kinase family pr...    319   3e-98    
ref|XP_007023753.1|  Leucine-rich repeat protein kinase family pr...    315   1e-96    
ref|XP_011092237.1|  PREDICTED: probable leucine-rich repeat rece...    314   2e-96    Sesamum indicum [beniseed]
gb|KJB57522.1|  hypothetical protein B456_009G167900                    312   7e-96    Gossypium raimondii
gb|KJB57523.1|  hypothetical protein B456_009G167900                    312   9e-96    Gossypium raimondii
ref|XP_009803111.1|  PREDICTED: probable leucine-rich repeat rece...    311   2e-95    Nicotiana sylvestris
ref|XP_009605193.1|  PREDICTED: probable leucine-rich repeat rece...    311   3e-95    Nicotiana tomentosiformis
ref|XP_006358480.1|  PREDICTED: probable leucine-rich repeat rece...    311   3e-95    
ref|XP_002303228.2|  hypothetical protein POPTR_0003s03690g             299   4e-95    
ref|XP_004230392.1|  PREDICTED: probable leucine-rich repeat rece...    310   6e-95    Solanum lycopersicum
gb|EPS61254.1|  hypothetical protein M569_13543                         301   7e-95    Genlisea aurea
ref|XP_006358563.1|  PREDICTED: probable leucine-rich repeat rece...    305   2e-94    Solanum tuberosum [potatoes]
gb|KHG12756.1|  hypothetical protein F383_03913                         309   2e-94    Gossypium arboreum [tree cotton]
ref|NP_001242669.1|  probable leucine-rich repeat receptor-like p...    302   8e-94    Glycine max [soybeans]
ref|XP_006358481.1|  PREDICTED: probable leucine-rich repeat rece...    306   2e-93    Solanum tuberosum [potatoes]
gb|EYU33236.1|  hypothetical protein MIMGU_mgv1a021943mg                306   2e-93    Erythranthe guttata [common monkey flower]
gb|KDP32456.1|  hypothetical protein JCGZ_13381                         298   6e-93    Jatropha curcas
gb|EPS73565.1|  hypothetical protein M569_01189                         305   8e-93    Genlisea aurea
ref|XP_010533231.1|  PREDICTED: probable leucine-rich repeat rece...    303   2e-92    Tarenaya hassleriana [spider flower]
ref|XP_006588460.1|  PREDICTED: probable leucine-rich repeat rece...    302   3e-92    Glycine max [soybeans]
emb|CDY21453.1|  BnaC03g27440D                                          290   6e-92    Brassica napus [oilseed rape]
ref|XP_002519381.1|  Serine/threonine-protein kinase PBS1, putative     302   6e-92    Ricinus communis
ref|XP_010521415.1|  PREDICTED: probable leucine-rich repeat rece...    302   6e-92    Tarenaya hassleriana [spider flower]
gb|KHN48167.1|  Putative leucine-rich repeat receptor-like protei...    301   6e-92    Glycine soja [wild soybean]
ref|XP_003541454.1|  PREDICTED: probable leucine-rich repeat rece...    301   6e-92    Glycine max [soybeans]
gb|KCW62550.1|  hypothetical protein EUGRSUZ_G00041                     301   8e-92    Eucalyptus grandis [rose gum]
gb|KCW62549.1|  hypothetical protein EUGRSUZ_G00041                     301   9e-92    Eucalyptus grandis [rose gum]
gb|EYU33238.1|  hypothetical protein MIMGU_mgv1a025286mg                301   9e-92    Erythranthe guttata [common monkey flower]
ref|XP_010067941.1|  PREDICTED: probable leucine-rich repeat rece...    301   1e-91    
ref|XP_010065205.1|  PREDICTED: probable leucine-rich repeat rece...    301   2e-91    
gb|KJB68016.1|  hypothetical protein B456_010G221900                    300   3e-91    Gossypium raimondii
gb|KJB68014.1|  hypothetical protein B456_010G221900                    300   4e-91    Gossypium raimondii
ref|XP_010065204.1|  PREDICTED: probable leucine-rich repeat rece...    300   4e-91    Eucalyptus grandis [rose gum]
ref|XP_010252252.1|  PREDICTED: probable leucine-rich repeat rece...    299   7e-91    Nelumbo nucifera [Indian lotus]
emb|CDY70266.1|  BnaCnng67530D                                          292   2e-90    Brassica napus [oilseed rape]
gb|KCW62551.1|  hypothetical protein EUGRSUZ_G00043                     297   3e-90    Eucalyptus grandis [rose gum]
ref|XP_010252242.1|  PREDICTED: probable leucine-rich repeat rece...    296   4e-90    Nelumbo nucifera [Indian lotus]
ref|XP_011028449.1|  PREDICTED: probable leucine-rich repeat rece...    294   7e-90    Populus euphratica
gb|KCW62548.1|  hypothetical protein EUGRSUZ_G00040                     296   9e-90    Eucalyptus grandis [rose gum]
ref|XP_010252241.1|  PREDICTED: probable leucine-rich repeat rece...    296   1e-89    Nelumbo nucifera [Indian lotus]
ref|XP_007148093.1|  hypothetical protein PHAVU_006G180200g             296   1e-89    Phaseolus vulgaris [French bean]
ref|XP_010065206.1|  PREDICTED: probable leucine-rich repeat rece...    296   1e-89    
ref|XP_006402242.1|  hypothetical protein EUTSA_v10012589mg             295   3e-89    Eutrema salsugineum [saltwater cress]
ref|XP_010442444.1|  PREDICTED: probable leucine-rich repeat rece...    294   5e-89    Camelina sativa [gold-of-pleasure]
ref|NP_199787.2|  leucine-rich repeat protein kinase-like protein       294   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028448.1|  PREDICTED: probable leucine-rich repeat rece...    293   7e-89    Populus euphratica
gb|KFK26616.1|  hypothetical protein AALP_AA8G271800                    294   8e-89    Arabis alpina [alpine rockcress]
ref|XP_011028446.1|  PREDICTED: probable leucine-rich repeat rece...    293   1e-88    Populus euphratica
ref|XP_010441071.1|  PREDICTED: probable leucine-rich repeat rece...    293   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010682075.1|  PREDICTED: probable leucine-rich repeat rece...    293   1e-88    Beta vulgaris subsp. vulgaris [field beet]
gb|KCW62546.1|  hypothetical protein EUGRSUZ_G00038                     292   1e-88    Eucalyptus grandis [rose gum]
ref|XP_010682076.1|  PREDICTED: probable leucine-rich repeat rece...    292   3e-88    
ref|XP_006385116.1|  leucine-rich repeat family protein                 292   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010065202.1|  PREDICTED: probable leucine-rich repeat rece...    292   5e-88    Eucalyptus grandis [rose gum]
ref|XP_009134024.1|  PREDICTED: probable leucine-rich repeat rece...    290   8e-88    Brassica rapa
ref|XP_006385112.1|  hypothetical protein POPTR_0004s24030g             291   8e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006281792.1|  hypothetical protein CARUB_v10027977mg             291   1e-87    
ref|XP_004485853.1|  PREDICTED: probable leucine-rich repeat rece...    290   2e-87    Cicer arietinum [garbanzo]
ref|XP_009416032.1|  PREDICTED: probable leucine-rich repeat rece...    290   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX83184.1|  BnaA03g23220D                                          290   2e-87    
ref|XP_009134023.1|  PREDICTED: probable leucine-rich repeat rece...    290   2e-87    Brassica rapa
emb|CDY21455.1|  BnaC03g27420D                                          290   2e-87    Brassica napus [oilseed rape]
ref|XP_011464973.1|  PREDICTED: probable leucine-rich repeat rece...    290   2e-87    Fragaria vesca subsp. vesca
ref|XP_003593682.1|  Somatic embryogenesis receptor-like kinase         289   2e-87    
emb|CDY61244.1|  BnaCnng37500D                                          290   2e-87    Brassica napus [oilseed rape]
emb|CDY21452.1|  BnaC03g27450D                                          290   3e-87    Brassica napus [oilseed rape]
ref|XP_010088710.1|  putative leucine-rich repeat receptor-like p...    290   4e-87    
ref|XP_003593681.1|  Somatic embryogenesis receptor-like kinase         289   4e-87    Medicago truncatula
ref|XP_010682078.1|  PREDICTED: probable leucine-rich repeat rece...    287   8e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010682077.1|  PREDICTED: probable leucine-rich repeat rece...    287   2e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010252249.1|  PREDICTED: probable leucine-rich repeat rece...    286   4e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010252248.1|  PREDICTED: probable leucine-rich repeat rece...    286   6e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010252250.1|  PREDICTED: probable leucine-rich repeat rece...    286   7e-86    Nelumbo nucifera [Indian lotus]
ref|XP_002864014.1|  leucine-rich repeat family protein                 286   7e-86    
dbj|BAA98164.1|  receptor protein kinase-like                           285   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482269.1|  PREDICTED: probable leucine-rich repeat rece...    285   2e-85    Camelina sativa [gold-of-pleasure]
gb|EYU33237.1|  hypothetical protein MIMGU_mgv1a000884mg                284   2e-85    Erythranthe guttata [common monkey flower]
ref|XP_010065203.1|  PREDICTED: probable leucine-rich repeat rece...    283   4e-85    
ref|XP_006402241.1|  hypothetical protein EUTSA_v10012584mg             282   1e-84    
ref|XP_009118911.1|  PREDICTED: probable leucine-rich repeat rece...    282   2e-84    Brassica rapa
ref|XP_006279961.1|  hypothetical protein CARUB_v10025827mg             282   2e-84    Capsella rubella
ref|XP_011464972.1|  PREDICTED: probable leucine-rich repeat rece...    282   2e-84    Fragaria vesca subsp. vesca
emb|CDY12940.1|  BnaA09g13340D                                          281   4e-84    Brassica napus [oilseed rape]
ref|XP_006279556.1|  hypothetical protein CARUB_v10025735mg             286   4e-84    
ref|XP_010252434.1|  PREDICTED: probable leucine-rich repeat rece...    275   7e-84    
ref|XP_002864015.1|  hypothetical protein ARALYDRAFT_495037             279   1e-83    
ref|XP_008802221.1|  PREDICTED: probable leucine-rich repeat rece...    280   2e-83    
gb|KCW62545.1|  hypothetical protein EUGRSUZ_G00037                     278   3e-83    Eucalyptus grandis [rose gum]
emb|CDY19539.1|  BnaC09g13640D                                          278   3e-83    Brassica napus [oilseed rape]
emb|CAN68980.1|  hypothetical protein VITISV_004150                     276   5e-83    Vitis vinifera
ref|XP_006470792.1|  PREDICTED: probable leucine-rich repeat rece...    277   1e-82    Citrus sinensis [apfelsine]
ref|XP_010252247.1|  PREDICTED: probable leucine-rich repeat rece...    275   1e-82    Nelumbo nucifera [Indian lotus]
ref|XP_010252245.1|  PREDICTED: probable leucine-rich repeat rece...    275   2e-82    Nelumbo nucifera [Indian lotus]
emb|CAN68981.1|  hypothetical protein VITISV_004151                     273   2e-82    Vitis vinifera
ref|XP_010441081.1|  PREDICTED: probable leucine-rich repeat rece...    276   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010482271.1|  PREDICTED: probable leucine-rich repeat rece...    276   2e-82    
ref|XP_010252244.1|  PREDICTED: probable leucine-rich repeat rece...    275   2e-82    Nelumbo nucifera [Indian lotus]
ref|XP_010482272.1|  PREDICTED: probable leucine-rich repeat rece...    276   3e-82    Camelina sativa [gold-of-pleasure]
gb|KDO40687.1|  hypothetical protein CISIN_1g002189mg                   275   3e-82    Citrus sinensis [apfelsine]
ref|XP_010252243.1|  PREDICTED: probable leucine-rich repeat rece...    275   3e-82    Nelumbo nucifera [Indian lotus]
ref|XP_010657900.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    276   3e-82    
ref|NP_199788.1|  putative leucine-rich repeat receptor-like prot...    276   3e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006431373.1|  hypothetical protein CICLE_v10000176mg             275   5e-82    Citrus clementina [clementine]
gb|KDO40686.1|  hypothetical protein CISIN_1g002189mg                   275   6e-82    Citrus sinensis [apfelsine]
emb|CDY12939.1|  BnaA09g13350D                                          275   9e-82    Brassica napus [oilseed rape]
ref|XP_008802212.1|  PREDICTED: probable leucine-rich repeat rece...    274   1e-81    
ref|XP_009113087.1|  PREDICTED: probable leucine-rich repeat rece...    273   2e-81    
ref|XP_004486417.1|  PREDICTED: probable leucine-rich repeat rece...    274   2e-81    Cicer arietinum [garbanzo]
gb|AAX92929.1|  At5g49760                                               273   2e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002269419.1|  PREDICTED: probable leucine-rich repeat rece...    273   2e-81    Vitis vinifera
gb|EEC67947.1|  hypothetical protein OsI_35675                          273   3e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_010442445.1|  PREDICTED: probable leucine-rich repeat rece...    273   4e-81    
gb|EEE51910.1|  hypothetical protein OsJ_33512                          273   4e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010482273.1|  PREDICTED: probable leucine-rich repeat rece...    273   4e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010930348.1|  PREDICTED: probable leucine-rich repeat rece...    273   5e-81    
ref|XP_010930347.1|  PREDICTED: probable leucine-rich repeat rece...    271   6e-81    
gb|KEH37006.1|  LRR receptor-like kinase                                272   7e-81    Medicago truncatula
gb|AES64685.2|  LRR receptor-like kinase                                272   9e-81    Medicago truncatula
ref|XP_003594434.1|  Somatic embryogenesis receptor-like kinase         272   1e-80    
emb|CBI29612.3|  unnamed protein product                                276   2e-80    Vitis vinifera
ref|XP_010671953.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    270   3e-80    
gb|KHN40213.1|  Putative leucine-rich repeat receptor-like protei...    270   3e-80    Glycine soja [wild soybean]
gb|KFK31438.1|  hypothetical protein AALP_AA6G111800                    269   6e-80    Arabis alpina [alpine rockcress]
gb|EPS73566.1|  hypothetical protein M569_01190                         264   9e-80    Genlisea aurea
ref|XP_008227090.1|  PREDICTED: probable leucine-rich repeat rece...    269   9e-80    Prunus mume [ume]
ref|XP_004960772.1|  PREDICTED: probable leucine-rich repeat rece...    269   1e-79    Setaria italica
ref|XP_006584125.1|  PREDICTED: probable leucine-rich repeat rece...    269   1e-79    Glycine max [soybeans]
ref|XP_006584124.1|  PREDICTED: probable leucine-rich repeat rece...    269   1e-79    Glycine max [soybeans]
ref|XP_007213558.1|  hypothetical protein PRUPE_ppa017796mg             268   2e-79    
ref|XP_010682082.1|  PREDICTED: probable leucine-rich repeat rece...    268   3e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006836951.1|  hypothetical protein AMTR_s00099p00159710          267   4e-79    
ref|XP_009364692.1|  PREDICTED: probable leucine-rich repeat rece...    258   1e-78    
emb|CDM81495.1|  unnamed protein product                                266   2e-78    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010441118.1|  PREDICTED: probable leucine-rich repeat rece...    254   3e-78    
ref|XP_002441998.1|  hypothetical protein SORBIDRAFT_08g006710          265   3e-78    Sorghum bicolor [broomcorn]
ref|XP_010930467.1|  PREDICTED: probable leucine-rich repeat rece...    265   3e-78    
ref|XP_008366451.1|  PREDICTED: probable leucine-rich repeat rece...    263   9e-78    
dbj|BAJ94480.1|  predicted protein                                      264   9e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89467.1|  predicted protein                                      264   9e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009403664.1|  PREDICTED: probable leucine-rich repeat rece...    261   1e-77    
emb|CDM81501.1|  unnamed protein product                                263   2e-77    Triticum aestivum [Canadian hard winter wheat]
ref|XP_007147542.1|  hypothetical protein PHAVU_006G133400g             263   2e-77    Phaseolus vulgaris [French bean]
ref|XP_006282275.1|  hypothetical protein CARUB_v10028556mg             262   2e-77    
ref|XP_006371694.1|  hypothetical protein POPTR_0018s002602g            242   3e-76    
dbj|BAD93860.1|  receptor protein kinase-like                           258   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364675.1|  PREDICTED: probable leucine-rich repeat rece...    259   3e-76    
gb|KHN40742.1|  Putative leucine-rich repeat receptor-like protei...    259   5e-76    Glycine soja [wild soybean]
ref|NP_199789.5|  leucine-rich repeat protein kinase-like protein       258   5e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864016.1|  predicted protein                                  258   8e-76    
ref|XP_009335437.1|  PREDICTED: probable leucine-rich repeat rece...    258   1e-75    Pyrus x bretschneideri [bai li]
ref|XP_006662853.1|  PREDICTED: probable leucine-rich repeat rece...    258   1e-75    
dbj|BAA98166.1|  receptor protein kinase-like                           258   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578779.1|  PREDICTED: probable leucine-rich repeat rece...    257   2e-75    Brachypodium distachyon [annual false brome]
ref|XP_009406445.1|  PREDICTED: probable leucine-rich repeat rece...    257   3e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406444.1|  PREDICTED: probable leucine-rich repeat rece...    257   3e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007207226.1|  hypothetical protein PRUPE_ppa000992mg             256   4e-75    
emb|CDP08081.1|  unnamed protein product                                256   5e-75    Coffea canephora [robusta coffee]
ref|XP_010482268.1|  PREDICTED: probable leucine-rich repeat rece...    253   1e-74    
ref|XP_009387132.1|  PREDICTED: probable leucine-rich repeat rece...    254   3e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010482267.1|  PREDICTED: probable leucine-rich repeat rece...    253   3e-74    
ref|XP_006282197.1|  hypothetical protein CARUB_v10028463mg             252   4e-74    
ref|XP_010482266.1|  PREDICTED: probable leucine-rich repeat rece...    253   4e-74    
ref|XP_007212514.1|  hypothetical protein PRUPE_ppa017853mg             252   8e-74    
ref|XP_006385117.1|  hypothetical protein POPTR_0004s24080g             252   1e-73    
ref|XP_010442449.1|  PREDICTED: probable leucine-rich repeat rece...    251   1e-73    
ref|XP_008227086.1|  PREDICTED: probable leucine-rich repeat rece...    252   2e-73    Prunus mume [ume]
ref|XP_004137665.1|  PREDICTED: probable leucine-rich repeat rece...    252   2e-73    Cucumis sativus [cucumbers]
gb|EEC69015.1|  hypothetical protein OsI_37810                          251   2e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_008804670.1|  PREDICTED: probable leucine-rich repeat rece...    251   4e-73    
ref|XP_009387702.1|  PREDICTED: probable leucine-rich repeat rece...    251   5e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007156284.1|  hypothetical protein PHAVU_003G273700g             250   6e-73    Phaseolus vulgaris [French bean]
ref|XP_008442305.1|  PREDICTED: probable leucine-rich repeat rece...    249   1e-72    Cucumis melo [Oriental melon]
ref|XP_009600216.1|  PREDICTED: probable leucine-rich repeat rece...    249   1e-72    Nicotiana tomentosiformis
ref|NP_001066400.1|  Os12g0210400                                       249   2e-72    
ref|XP_009761326.1|  PREDICTED: probable leucine-rich repeat rece...    249   2e-72    Nicotiana sylvestris
ref|XP_008245810.1|  PREDICTED: probable leucine-rich repeat rece...    238   3e-72    
ref|XP_006852584.1|  hypothetical protein AMTR_s00021p00213800          248   3e-72    Amborella trichopoda
ref|XP_011461103.1|  PREDICTED: probable leucine-rich repeat rece...    248   3e-72    Fragaria vesca subsp. vesca
ref|XP_006338928.1|  PREDICTED: probable leucine-rich repeat rece...    248   5e-72    Solanum tuberosum [potatoes]
ref|XP_010275979.1|  PREDICTED: probable leucine-rich repeat rece...    248   6e-72    Nelumbo nucifera [Indian lotus]
gb|KCW47574.1|  hypothetical protein EUGRSUZ_K01321                     248   6e-72    Eucalyptus grandis [rose gum]
ref|XP_010038738.1|  PREDICTED: probable leucine-rich repeat rece...    248   6e-72    Eucalyptus grandis [rose gum]
ref|XP_011077100.1|  PREDICTED: probable leucine-rich repeat rece...    247   8e-72    Sesamum indicum [beniseed]
ref|XP_010044547.1|  PREDICTED: probable leucine-rich repeat rece...    247   8e-72    Eucalyptus grandis [rose gum]
ref|XP_007147540.1|  hypothetical protein PHAVU_006G133200g             247   8e-72    Phaseolus vulgaris [French bean]
gb|KCW88500.1|  hypothetical protein EUGRSUZ_A00886                     247   1e-71    Eucalyptus grandis [rose gum]
ref|XP_010088707.1|  putative leucine-rich repeat receptor-like p...    243   1e-71    
ref|XP_004249557.1|  PREDICTED: probable leucine-rich repeat rece...    246   1e-71    Solanum lycopersicum
ref|XP_004961711.1|  PREDICTED: probable leucine-rich repeat rece...    246   2e-71    Setaria italica
ref|XP_004961712.1|  PREDICTED: probable leucine-rich repeat rece...    246   2e-71    
gb|KJB29747.1|  hypothetical protein B456_005G116800                    246   2e-71    Gossypium raimondii
ref|XP_010044564.1|  PREDICTED: probable leucine-rich repeat rece...    246   3e-71    Eucalyptus grandis [rose gum]
ref|XP_010044506.1|  PREDICTED: probable leucine-rich repeat rece...    246   3e-71    Eucalyptus grandis [rose gum]
gb|EMT33703.1|  Putative LRR receptor-like serine/threonine-prote...    244   5e-71    
emb|CDO97683.1|  unnamed protein product                                244   6e-71    Coffea canephora [robusta coffee]
ref|XP_003566120.1|  PREDICTED: probable leucine-rich repeat rece...    244   6e-71    Brachypodium distachyon [annual false brome]
gb|KHN40741.1|  Putative leucine-rich repeat receptor-like protei...    244   6e-71    Glycine soja [wild soybean]
ref|XP_003535032.1|  PREDICTED: probable leucine-rich repeat rece...    244   7e-71    Glycine max [soybeans]
ref|XP_008465343.1|  PREDICTED: probable leucine-rich repeat rece...    244   9e-71    Cucumis melo [Oriental melon]
ref|XP_010922852.1|  PREDICTED: probable leucine-rich repeat rece...    244   1e-70    Elaeis guineensis
ref|XP_010113026.1|  putative leucine-rich repeat receptor-like p...    244   1e-70    Morus notabilis
ref|XP_006385111.1|  hypothetical protein POPTR_0004s24020g             243   1e-70    
emb|CDM84720.1|  unnamed protein product                                243   2e-70    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006385110.1|  hypothetical protein POPTR_0004s24010g             243   2e-70    
ref|XP_009391654.1|  PREDICTED: probable leucine-rich repeat rece...    243   2e-70    
gb|KCW88501.1|  hypothetical protein EUGRSUZ_A00887                     243   2e-70    Eucalyptus grandis [rose gum]
ref|XP_008465342.1|  PREDICTED: probable leucine-rich repeat rece...    243   2e-70    Cucumis melo [Oriental melon]
ref|XP_010044526.1|  PREDICTED: probable leucine-rich repeat rece...    243   2e-70    Eucalyptus grandis [rose gum]
gb|EEE52938.1|  hypothetical protein OsJ_35570                          243   3e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010044534.1|  PREDICTED: probable leucine-rich repeat rece...    243   3e-70    Eucalyptus grandis [rose gum]
ref|XP_007208371.1|  hypothetical protein PRUPE_ppa000921mg             243   4e-70    Prunus persica
gb|KDP21809.1|  hypothetical protein JCGZ_00596                         238   4e-70    Jatropha curcas
ref|XP_011461109.1|  PREDICTED: probable leucine-rich repeat rece...    241   5e-70    Fragaria vesca subsp. vesca
ref|XP_011461107.1|  PREDICTED: probable leucine-rich repeat rece...    241   7e-70    Fragaria vesca subsp. vesca
ref|XP_011461106.1|  PREDICTED: probable leucine-rich repeat rece...    241   8e-70    Fragaria vesca subsp. vesca
gb|EMT20930.1|  Putative LRR receptor-like serine/threonine-prote...    242   8e-70    
ref|XP_011461108.1|  PREDICTED: probable leucine-rich repeat rece...    241   8e-70    Fragaria vesca subsp. vesca
ref|XP_004295860.1|  PREDICTED: probable leucine-rich repeat rece...    241   8e-70    Fragaria vesca subsp. vesca
gb|EAZ13939.1|  hypothetical protein OsJ_03866                          241   9e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011084699.1|  PREDICTED: probable leucine-rich repeat rece...    241   1e-69    Sesamum indicum [beniseed]
dbj|BAD82283.1|  putative receptor-like protein kinase 2                242   1e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417852.1|  PREDICTED: probable leucine-rich repeat rece...    241   1e-69    
ref|XP_009417853.1|  PREDICTED: probable leucine-rich repeat rece...    240   1e-69    
ref|XP_009365989.1|  PREDICTED: probable leucine-rich repeat rece...    241   1e-69    
gb|AFW78432.1|  putative leucine-rich repeat receptor-like protei...    237   2e-69    
ref|XP_011028445.1|  PREDICTED: probable leucine-rich repeat rece...    241   2e-69    Populus euphratica
ref|XP_009365992.1|  PREDICTED: probable leucine-rich repeat rece...    241   2e-69    
ref|XP_009417849.1|  PREDICTED: probable leucine-rich repeat rece...    240   2e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009365988.1|  PREDICTED: probable leucine-rich repeat rece...    240   2e-69    Pyrus x bretschneideri [bai li]
ref|XP_009417851.1|  PREDICTED: probable leucine-rich repeat rece...    240   2e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009337850.1|  PREDICTED: probable leucine-rich repeat rece...    240   3e-69    Pyrus x bretschneideri [bai li]
gb|EMT14100.1|  Putative LRR receptor-like serine/threonine-prote...    239   3e-69    
ref|XP_008345657.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    242   3e-69    
gb|EAY76270.1|  hypothetical protein OsI_04206                          240   3e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_006644901.1|  PREDICTED: probable leucine-rich repeat rece...    240   3e-69    Oryza brachyantha
ref|XP_010938089.1|  PREDICTED: probable leucine-rich repeat rece...    239   5e-69    Elaeis guineensis
emb|CAQ58615.1|  ATP binding / kinase/ protein serine / threonine...    239   5e-69    Vitis vinifera
ref|XP_010653092.1|  PREDICTED: probable leucine-rich repeat rece...    239   5e-69    Vitis vinifera
ref|XP_011088110.1|  PREDICTED: probable leucine-rich repeat rece...    239   5e-69    Sesamum indicum [beniseed]
ref|XP_008782739.1|  PREDICTED: probable leucine-rich repeat rece...    239   5e-69    Phoenix dactylifera
ref|XP_002519985.1|  receptor protein kinase, putative                  239   6e-69    Ricinus communis
emb|CBI31129.3|  unnamed protein product                                239   6e-69    Vitis vinifera
ref|XP_011466378.1|  PREDICTED: probable leucine-rich repeat rece...    239   7e-69    Fragaria vesca subsp. vesca
gb|KCW88496.1|  hypothetical protein EUGRSUZ_A00883                     238   8e-69    Eucalyptus grandis [rose gum]
ref|XP_010233531.1|  PREDICTED: probable leucine-rich repeat rece...    236   9e-69    
gb|EYU39493.1|  hypothetical protein MIMGU_mgv1a025586mg                238   9e-69    Erythranthe guttata [common monkey flower]
ref|XP_008245239.1|  PREDICTED: probable leucine-rich repeat rece...    230   1e-68    
ref|XP_009370844.1|  PREDICTED: probable leucine-rich repeat rece...    238   1e-68    Pyrus x bretschneideri [bai li]
ref|XP_009391655.1|  PREDICTED: probable leucine-rich repeat rece...    238   1e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007019718.1|  Leucine-rich repeat protein kinase family pr...    236   2e-68    
gb|KEH20269.1|  LRR receptor-like kinase                                238   2e-68    Medicago truncatula
ref|XP_008649802.1|  PREDICTED: probable leucine-rich repeat rece...    238   2e-68    Zea mays [maize]
ref|XP_003547844.1|  PREDICTED: probable leucine-rich repeat rece...    237   2e-68    Glycine max [soybeans]
ref|XP_006358564.1|  PREDICTED: probable leucine-rich repeat rece...    237   3e-68    Solanum tuberosum [potatoes]
ref|XP_007208107.1|  hypothetical protein PRUPE_ppa000924mg             237   4e-68    Prunus persica
ref|XP_004970368.1|  PREDICTED: probable leucine-rich repeat rece...    237   4e-68    Setaria italica
gb|KHN40214.1|  Putative leucine-rich repeat receptor-like protei...    236   4e-68    Glycine soja [wild soybean]
gb|KEH20271.1|  receptor-like kinase                                    232   5e-68    Medicago truncatula
ref|XP_008245573.1|  PREDICTED: probable leucine-rich repeat rece...    236   5e-68    
ref|XP_007019716.1|  Leucine-rich repeat protein kinase family pr...    236   5e-68    
ref|XP_010044552.1|  PREDICTED: probable leucine-rich repeat rece...    236   6e-68    Eucalyptus grandis [rose gum]
ref|XP_008782792.1|  PREDICTED: probable leucine-rich repeat rece...    236   6e-68    
ref|XP_003561670.2|  PREDICTED: probable leucine-rich repeat rece...    236   8e-68    Brachypodium distachyon [annual false brome]
ref|XP_007023747.1|  Leucine-rich repeat protein kinase family pr...    233   9e-68    
ref|XP_002456530.1|  hypothetical protein SORBIDRAFT_03g037960          235   1e-67    
gb|KHN40734.1|  Putative leucine-rich repeat receptor-like protei...    236   1e-67    Glycine soja [wild soybean]
ref|XP_003530535.1|  PREDICTED: probable leucine-rich repeat rece...    236   1e-67    
ref|XP_007208219.1|  hypothetical protein PRUPE_ppa018586mg             235   1e-67    
gb|KCW88497.1|  hypothetical protein EUGRSUZ_A00884                     235   1e-67    
ref|XP_006651341.1|  PREDICTED: probable leucine-rich repeat rece...    235   2e-67    
ref|XP_010314124.1|  PREDICTED: probable leucine-rich repeat rece...    233   2e-67    
ref|XP_008793424.1|  PREDICTED: probable leucine-rich repeat rece...    234   3e-67    
ref|XP_006429976.1|  hypothetical protein CICLE_v100110351mg            232   3e-67    
gb|EMT20931.1|  Putative LRR receptor-like serine/threonine-prote...    234   3e-67    
ref|XP_010233532.1|  PREDICTED: probable leucine-rich repeat rece...    234   3e-67    
ref|XP_010067427.1|  PREDICTED: probable leucine-rich repeat rece...    234   4e-67    
ref|XP_011028453.1|  PREDICTED: probable leucine-rich repeat rece...    233   5e-67    
ref|XP_010314121.1|  PREDICTED: probable leucine-rich repeat rece...    234   5e-67    
ref|XP_011028451.1|  PREDICTED: probable leucine-rich repeat rece...    234   5e-67    
ref|XP_011028452.1|  PREDICTED: probable leucine-rich repeat rece...    233   5e-67    
ref|XP_011028450.1|  PREDICTED: probable leucine-rich repeat rece...    233   5e-67    
gb|ABF95747.1|  Protein kinase domain containing protein, expressed     233   6e-67    
gb|EEC75182.1|  hypothetical protein OsI_11410                          233   7e-67    
ref|XP_008793425.1|  PREDICTED: probable leucine-rich repeat rece...    232   8e-67    
ref|XP_006481666.1|  PREDICTED: probable leucine-rich repeat rece...    233   9e-67    
emb|CDM84721.1|  unnamed protein product                                232   1e-66    
gb|EYU39755.1|  hypothetical protein MIMGU_mgv1a000835mg                233   1e-66    
gb|KDO70764.1|  hypothetical protein CISIN_1g002121mg                   233   1e-66    
tpg|DAA57113.1|  TPA: putative transmembrane protein kinase famil...    232   2e-66    
dbj|BAJ85679.1|  predicted protein                                      229   2e-66    
ref|XP_002467924.1|  hypothetical protein SORBIDRAFT_01g036470          232   2e-66    
ref|XP_010688349.1|  PREDICTED: probable leucine-rich repeat rece...    231   4e-66    
ref|XP_008674899.1|  PREDICTED: probable leucine-rich repeat rece...    231   4e-66    
ref|XP_004972229.1|  PREDICTED: probable leucine-rich repeat rece...    230   7e-66    
ref|XP_002323702.2|  leucine-rich repeat transmembrane protein ki...    230   1e-65    
gb|EPS73567.1|  hypothetical protein M569_01191                         215   2e-65    
ref|XP_008643850.1|  PREDICTED: uncharacterized protein LOC100382...    229   3e-65    
gb|EMT31021.1|  Putative LRR receptor-like serine/threonine-prote...    228   3e-65    
ref|XP_009593371.1|  PREDICTED: probable leucine-rich repeat rece...    228   3e-65    
ref|XP_008643846.1|  PREDICTED: uncharacterized protein LOC100382...    229   4e-65    
ref|XP_010690203.1|  PREDICTED: probable leucine-rich repeat rece...    228   5e-65    
ref|XP_009761610.1|  PREDICTED: probable leucine-rich repeat rece...    228   5e-65    
gb|AAT01330.1|  putative receptor protein kinase                        228   7e-65    
ref|NP_001055877.1|  Os05g0486100                                       228   7e-65    
ref|XP_002308292.2|  leucine-rich repeat transmembrane protein ki...    228   8e-65    
ref|XP_011461097.1|  PREDICTED: probable leucine-rich repeat rece...    227   9e-65    
ref|XP_011012973.1|  PREDICTED: probable leucine-rich repeat rece...    227   1e-64    
ref|XP_008370574.1|  PREDICTED: probable leucine-rich repeat rece...    226   1e-64    
ref|XP_011012970.1|  PREDICTED: probable leucine-rich repeat rece...    227   2e-64    
ref|XP_010252233.1|  PREDICTED: probable leucine-rich repeat rece...    226   3e-64    
ref|XP_010252232.1|  PREDICTED: probable leucine-rich repeat rece...    226   4e-64    
ref|XP_006300598.1|  hypothetical protein CARUB_v10019721mg             225   5e-64    
gb|EEC79425.1|  hypothetical protein OsI_20397                          225   6e-64    
ref|XP_011018905.1|  PREDICTED: probable leucine-rich repeat rece...    224   1e-63    
ref|XP_009128375.1|  PREDICTED: probable leucine-rich repeat rece...    224   1e-63    
ref|XP_006655431.1|  PREDICTED: probable leucine-rich repeat rece...    224   2e-63    
ref|XP_002993941.1|  hypothetical protein SELMODRAFT_449258             223   4e-63    
ref|NP_001055151.1|  Os05g0305900                                       212   4e-63    
ref|XP_002962583.1|  hypothetical protein SELMODRAFT_438263             222   5e-63    
ref|XP_002889259.1|  hypothetical protein ARALYDRAFT_477135             222   6e-63    
emb|CDY49740.1|  BnaA02g19320D                                          224   7e-63    
gb|EYU33251.1|  hypothetical protein MIMGU_mgv1a021972mg                221   9e-63    
ref|NP_178080.2|  putative serine/threonine kinase                      221   2e-62    
gb|AAF68126.1|AC010793_21  F20B17.5                                     221   2e-62    
ref|XP_010429861.1|  PREDICTED: probable leucine-rich repeat rece...    221   2e-62    
ref|XP_010417632.1|  PREDICTED: probable leucine-rich repeat rece...    221   2e-62    
ref|XP_008370579.1|  PREDICTED: probable leucine-rich repeat rece...    219   5e-62    
emb|CDP15606.1|  unnamed protein product                                219   7e-62    
ref|XP_010537840.1|  PREDICTED: probable leucine-rich repeat rece...    219   1e-61    
gb|KFK42372.1|  hypothetical protein AALP_AA2G247300                    218   2e-61    
emb|CDY22287.1|  BnaC02g25910D                                          219   5e-61    
ref|XP_006664421.1|  PREDICTED: probable leucine-rich repeat rece...    215   1e-60    
ref|XP_009419865.1|  PREDICTED: probable leucine-rich repeat rece...    215   1e-60    
ref|XP_004962484.1|  PREDICTED: probable leucine-rich repeat rece...    214   3e-60    
ref|XP_010690261.1|  PREDICTED: probable leucine-rich repeat rece...    213   7e-60    
ref|XP_010690253.1|  PREDICTED: probable leucine-rich repeat rece...    213   8e-60    
ref|XP_010690246.1|  PREDICTED: probable leucine-rich repeat rece...    213   8e-60    
ref|XP_010690238.1|  PREDICTED: probable leucine-rich repeat rece...    213   8e-60    
ref|XP_010690267.1|  PREDICTED: probable leucine-rich repeat rece...    213   8e-60    
gb|EEE63180.1|  hypothetical protein OsJ_17989                          213   1e-59    
gb|EEC78946.1|  hypothetical protein OsI_19395                          213   1e-59    
ref|XP_011012972.1|  PREDICTED: probable leucine-rich repeat rece...    212   2e-59    
ref|XP_006655181.1|  PREDICTED: probable leucine-rich repeat rece...    213   3e-59    
ref|NP_001131018.1|  uncharacterized LOC100192366 precursor             211   6e-59    
ref|XP_001780578.1|  predicted protein                                  210   9e-59    
gb|KHN03568.1|  Putative leucine-rich repeat receptor-like protei...    202   9e-59    
ref|XP_003566601.1|  PREDICTED: probable leucine-rich repeat rece...    210   1e-58    
gb|EMT13742.1|  Putative LRR receptor-like serine/threonine-prote...    211   2e-58    
gb|EEC79423.1|  hypothetical protein OsI_20395                          211   2e-58    
dbj|BAJ91189.1|  predicted protein                                      207   1e-57    
dbj|BAK05595.1|  predicted protein                                      207   1e-57    
ref|XP_002440790.1|  hypothetical protein SORBIDRAFT_09g006630          204   9e-57    
ref|XP_007023750.1|  Leucine-rich repeat protein kinase family pr...    193   2e-56    
ref|XP_009417854.1|  PREDICTED: probable leucine-rich repeat rece...    203   2e-56    
ref|XP_010682227.1|  PREDICTED: probable leucine-rich repeat rece...    197   4e-54    
ref|XP_002965380.1|  hypothetical protein SELMODRAFT_24884              186   2e-53    
ref|XP_002977227.1|  hypothetical protein SELMODRAFT_24883              186   2e-53    
ref|XP_010484994.1|  PREDICTED: probable leucine-rich repeat rece...    192   2e-52    
ref|XP_001777494.1|  predicted protein                                  191   2e-51    
ref|XP_008370575.1|  PREDICTED: probable leucine-rich repeat rece...    188   4e-51    
ref|XP_010067119.1|  PREDICTED: probable LRR receptor-like serine...    186   2e-50    
ref|XP_010481035.1|  PREDICTED: probable LRR receptor-like serine...    177   6e-50    
ref|XP_010278958.1|  PREDICTED: probable LRR receptor-like serine...    184   1e-49    
ref|XP_009116056.1|  PREDICTED: putative leucine-rich repeat rece...    185   1e-49    
gb|AAK82714.1|AF288564_1  putative Pto-like serine/threonine kinase     172   2e-49    
gb|KGN63923.1|  hypothetical protein Csa_1G027520                       174   2e-49    
gb|KCW88415.1|  hypothetical protein EUGRSUZ_A00802                     184   2e-49    
ref|XP_001760085.1|  predicted protein                                  186   2e-49    
emb|CDX78191.1|  BnaA09g33860D                                          185   4e-49    
ref|XP_010043804.1|  PREDICTED: probable LRR receptor-like serine...    184   4e-49    
emb|CDX73538.1|  BnaC08g24650D                                          184   5e-49    
ref|XP_007047405.1|  Receptor-like protein kinase, putative             181   1e-48    
ref|XP_004504595.1|  PREDICTED: receptor-like protein kinase FERO...    177   2e-48    
ref|XP_011466400.1|  PREDICTED: probable LRR receptor-like serine...    172   2e-48    
emb|CDY61605.1|  BnaC03g71340D                                          182   2e-48    
gb|KJB41732.1|  hypothetical protein B456_007G117400                    179   3e-48    
ref|XP_008366212.1|  PREDICTED: probable LRR receptor-like serine...    181   3e-48    
gb|KCW54833.1|  hypothetical protein EUGRSUZ_I007772                    174   3e-48    
ref|XP_010504126.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    181   5e-48    
ref|XP_002972798.1|  hypothetical protein SELMODRAFT_15419              171   5e-48    
ref|XP_009374406.1|  PREDICTED: probable LRR receptor-like serine...    180   6e-48    
tpg|DAA57081.1|  TPA: putative leucine-rich repeat receptor-like ...    179   6e-48    
ref|XP_009374400.1|  PREDICTED: probable LRR receptor-like serine...    180   6e-48    
ref|XP_006356401.1|  PREDICTED: receptor-like protein kinase HERK...    172   8e-48    
ref|XP_008366925.1|  PREDICTED: probable LRR receptor-like serine...    172   1e-47    
ref|XP_008652670.1|  PREDICTED: probable LRR receptor-like serine...    179   1e-47    
emb|CAN68061.1|  hypothetical protein VITISV_037438                     171   1e-47    
emb|CAN65310.1|  hypothetical protein VITISV_043086                     170   2e-47    
ref|XP_006290609.1|  hypothetical protein CARUB_v10016698mg             178   2e-47    
ref|XP_010427010.1|  PREDICTED: putative leucine-rich repeat rece...    179   2e-47    
ref|XP_010098172.1|  Putative leucine-rich repeat receptor-like p...    178   2e-47    
ref|XP_009396541.1|  PREDICTED: probable LRR receptor-like protei...    179   2e-47    
ref|XP_010095327.1|  putative receptor-like protein kinase              178   2e-47    
ref|XP_009617176.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    180   2e-47    
dbj|BAF79988.1|  receptor-like kinase                                   173   2e-47    
ref|XP_008652663.1|  PREDICTED: probable LRR receptor-like serine...    179   2e-47    
ref|XP_010475436.1|  PREDICTED: probable LRR receptor-like serine...    178   2e-47    
dbj|BAG94134.1|  unnamed protein product                                170   2e-47    
ref|XP_004163829.1|  PREDICTED: probable LRR receptor-like serine...    176   3e-47    
ref|XP_004154760.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    178   3e-47    
ref|XP_009759079.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    179   3e-47    
ref|XP_006362336.1|  PREDICTED: probable LRR receptor-like serine...    178   3e-47    
ref|XP_010920748.1|  PREDICTED: probable receptor-like protein ki...    177   4e-47    
ref|XP_006403671.1|  hypothetical protein EUTSA_v10010104mg             178   4e-47    
gb|AFW78405.1|  putative leucine-rich repeat receptor-like protei...    168   4e-47    
ref|XP_010457836.1|  PREDICTED: probable LRR receptor-like serine...    177   4e-47    
gb|KFK42998.1|  hypothetical protein AALP_AA1G066200                    178   4e-47    
ref|XP_010475435.1|  PREDICTED: probable LRR receptor-like serine...    178   4e-47    
ref|XP_009406863.1|  PREDICTED: probable LRR receptor-like serine...    178   4e-47    
ref|XP_009614147.1|  PREDICTED: probable LRR receptor-like serine...    178   5e-47    
ref|XP_010486768.1|  PREDICTED: probable LRR receptor-like serine...    177   5e-47    
ref|XP_006359984.1|  PREDICTED: probable LRR receptor-like serine...    178   5e-47    
ref|XP_006286080.1|  hypothetical protein CARUB_v10007617mg             177   5e-47    
ref|XP_010500450.1|  PREDICTED: receptor-like protein kinase At3g...    177   5e-47    
ref|XP_002870531.1|  hypothetical protein ARALYDRAFT_493720             177   5e-47    
ref|XP_009385337.1|  PREDICTED: probable LRR receptor-like protei...    167   5e-47    
ref|XP_004249029.1|  PREDICTED: probable LRR receptor-like serine...    178   5e-47    
gb|KDO53713.1|  hypothetical protein CISIN_1g002461mg                   177   5e-47    
gb|KDO53712.1|  hypothetical protein CISIN_1g002461mg                   177   5e-47    
ref|XP_006426842.1|  hypothetical protein CICLE_v10024853mg             177   6e-47    
ref|XP_007205469.1|  hypothetical protein PRUPE_ppa008002mg             171   6e-47    
ref|XP_006853763.1|  hypothetical protein AMTR_s00056p00191650          170   6e-47    
ref|XP_007206440.1|  hypothetical protein PRUPE_ppa000952mg             177   6e-47    
gb|AAK82715.1|AF288565_1  putative Pto-like serine/threonine kinase     165   6e-47    
ref|XP_010486760.1|  PREDICTED: probable LRR receptor-like serine...    177   7e-47    
ref|XP_006448887.1|  hypothetical protein CICLE_v10014250mg             177   7e-47    
ref|NP_175336.1|  putative leucine-rich repeat protein kinase           177   7e-47    
dbj|BAF79978.1|  receptor-like kinase                                   178   7e-47    
gb|KCW45810.1|  hypothetical protein EUGRSUZ_L00361                     168   7e-47    
ref|XP_006465720.1|  PREDICTED: putative leucine-rich repeat rece...    177   7e-47    
ref|XP_008354310.1|  PREDICTED: probable LRR receptor-like serine...    175   8e-47    
ref|XP_008392238.1|  PREDICTED: probable receptor-like protein ki...    176   8e-47    
ref|XP_010683435.1|  PREDICTED: probable LRR receptor-like serine...    177   8e-47    
ref|XP_010683436.1|  PREDICTED: probable LRR receptor-like serine...    177   8e-47    
ref|XP_007154092.1|  hypothetical protein PHAVU_003G0900001g            164   8e-47    
ref|XP_008239253.1|  PREDICTED: probable LRR receptor-like serine...    177   8e-47    
ref|XP_004137258.1|  PREDICTED: receptor-like protein kinase FERO...    177   8e-47    
ref|XP_010039671.1|  PREDICTED: receptor-like protein kinase HERK 1     168   8e-47    
ref|XP_010457834.1|  PREDICTED: probable LRR receptor-like serine...    177   1e-46    
ref|XP_006465719.1|  PREDICTED: putative leucine-rich repeat rece...    177   1e-46    
gb|EAZ08768.1|  hypothetical protein OsI_31031                          167   1e-46    
ref|XP_009130612.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    177   1e-46    
gb|AAK82693.1|AF288543_1  putative Pto-like serine/threonine kinase     164   1e-46    
ref|NP_001132279.1|  uncharacterized protein LOC100193715               169   1e-46    
gb|ABK93453.1|  unknown                                                 167   1e-46    
gb|KHN30021.1|  Putative leucine-rich repeat receptor-like protei...    173   1e-46    
ref|XP_002447392.1|  hypothetical protein SORBIDRAFT_06g000230          166   1e-46    
ref|XP_008800166.1|  PREDICTED: receptor-like protein kinase THES...    174   1e-46    
ref|XP_006306079.1|  hypothetical protein CARUB_v10011410mg             176   2e-46    
ref|XP_010510555.1|  PREDICTED: probable LRR receptor-like serine...    169   2e-46    
gb|AAF63151.1|AC011001_21  Hypothetical protein                         176   2e-46    
ref|XP_010450496.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    176   2e-46    
ref|XP_006426833.1|  hypothetical protein CICLE_v10027271mg             175   2e-46    
ref|XP_010479688.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46    
ref|XP_009783324.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46    
ref|XP_009144874.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46    
ref|NP_198561.1|  probable LRR receptor-like serine/threonine-pro...    176   2e-46    
ref|XP_010244582.1|  PREDICTED: probable LRR receptor-like serine...    175   2e-46    
ref|XP_006392992.1|  hypothetical protein EUTSA_v10011224mg             176   2e-46    
ref|XP_010271376.1|  PREDICTED: probable leucine-rich repeat rece...    172   2e-46    
dbj|BAB10966.1|  receptor protein kinase-like protein                   176   2e-46    
gb|KDO53727.1|  hypothetical protein CISIN_1g002809mg                   175   2e-46    
ref|XP_002892361.1|  predicted protein                                  176   2e-46    
ref|XP_011461389.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46    
ref|XP_011080636.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46    
emb|CDY43931.1|  BnaA05g15410D                                          175   2e-46    
ref|XP_011461391.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46    
ref|XP_009780438.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46    
dbj|BAD73350.1|  protein kinase-like                                    171   3e-46    
ref|NP_172169.2|  probable LRR receptor-like serine/threonine-pro...    176   3e-46    
ref|XP_002515909.1|  Nodulation receptor kinase precursor, putative     175   3e-46    
sp|C0LGU1.1|Y5374_ARATH  RecName: Full=Probable LRR receptor-like...    176   3e-46    
gb|KDO75244.1|  hypothetical protein CISIN_1g047215mg                   175   3e-46    
ref|XP_006842574.1|  hypothetical protein AMTR_s00077p00152440          175   3e-46    
ref|XP_009783321.1|  PREDICTED: probable LRR receptor-like serine...    176   3e-46    
ref|XP_006468319.1|  PREDICTED: probable receptor-like protein ki...    175   3e-46    
ref|XP_009621388.1|  PREDICTED: probable LRR receptor-like serine...    175   3e-46    
ref|XP_010672753.1|  PREDICTED: receptor-like protein kinase HERK 1     174   3e-46    
ref|XP_011096691.1|  PREDICTED: probable receptor-like protein ki...    175   4e-46    
gb|AAK82707.1|AF288557_1  putative Pto-like serine/threonine kinase     163   4e-46    
ref|XP_009783320.1|  PREDICTED: probable LRR receptor-like serine...    175   4e-46    
gb|KEH30081.1|  receptor-like kinase theseus protein                    173   4e-46    
ref|XP_004137372.1|  PREDICTED: probable LRR receptor-like serine...    175   4e-46    
ref|XP_008794322.1|  PREDICTED: probable receptor-like protein ki...    174   4e-46    
ref|XP_006366328.1|  PREDICTED: receptor-like protein kinase HERK...    174   4e-46    
ref|XP_008800163.1|  PREDICTED: receptor-like protein kinase THES...    174   4e-46    
ref|XP_008371230.1|  PREDICTED: receptor-like protein kinase THES...    174   4e-46    



>ref|XP_009781542.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nicotiana sylvestris]
 ref|XP_009781544.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nicotiana sylvestris]
Length=241

 Score =   342 bits (876),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 187/212 (88%), Gaps = 1/212 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHDLVNPPIIHRDIK+NNILLDERLNAKVADFGLSK LG+ E+ H+TTQVKG
Sbjct  24   GAARGLQYLHDLVNPPIIHRDIKSNNILLDERLNAKVADFGLSKLLGDSERGHITTQVKG  83

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMT QLTEKSDVYSFGVVLLEI+T + PIEKGKYIVREV+ AMDKTKDMY+
Sbjct  84   TMGYMDPEYYMTQQLTEKSDVYSFGVVLLEIVTGKIPIEKGKYIVREVRTAMDKTKDMYN  143

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ILDP + S  TP+S+EKFVD+A++C+E+   +RPTM EVVKEIE IME+VGLNP+A+
Sbjct  144  LHEILDPVVRSGATPKSVEKFVDLAIKCVEEEGVKRPTMSEVVKEIEYIMEIVGLNPNAE  203

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SASTSE+Y G +KG  HPY+DESL VY+G  P
Sbjct  204  SASTSETYEGANKGL-HPYTDESLFVYSGAYP  234



>ref|XP_004230391.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=959

 Score =   350 bits (898),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHDLVNPPIIHRDIK+NNILLD+RLNA+VADFGLSK LG+ ++ H+TTQVKG
Sbjct  741  GAARGLQYLHDLVNPPIIHRDIKSNNILLDDRLNARVADFGLSKLLGDSDRGHITTQVKG  800

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMTNQLTEKSDVYSFGVVLLEI+T + PIEKG+YIVREVK AMD++KDMY+
Sbjct  801  TMGYMDPEYYMTNQLTEKSDVYSFGVVLLEIVTGKVPIEKGRYIVREVKTAMDRSKDMYN  860

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP++ +  TPRSLEKFVD+AL+C+E+  A RP+M EVVKEIE+IMEM GLNP+AD
Sbjct  861  LQDILDPAVRAGATPRSLEKFVDLALKCVEEEGANRPSMSEVVKEIENIMEMAGLNPNAD  920

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLPK  115
            SAS+S +Y G +KG  HPY+DESL VY+G  P 
Sbjct  921  SASSSATYEGPNKGMNHPYTDESLFVYSGAYPN  953



>ref|XP_006358482.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=959

 Score =   350 bits (898),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHDLVNPPIIHRDIK+NNILLD+RLNA+VADFGLSK LG+ ++ H+TTQVKG
Sbjct  741  GAARGLQYLHDLVNPPIIHRDIKSNNILLDDRLNARVADFGLSKLLGDSDRGHITTQVKG  800

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMTNQLTEKSDVYSFGVVLLEI+T + PIEKG+YIVREVK AMDK+KDMY+
Sbjct  801  TMGYMDPEYYMTNQLTEKSDVYSFGVVLLEIVTGKVPIEKGRYIVREVKSAMDKSKDMYN  860

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP++ +  TPRSLEKFVD+AL+C+E+  A RP+M EVVKEIE+IME+ GLNP+AD
Sbjct  861  LQDILDPAVRAGATPRSLEKFVDLALKCVEEEGANRPSMNEVVKEIENIMEIAGLNPNAD  920

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLPK  115
            SAS+S +Y G +KG  HPY+DESL VY+G  P 
Sbjct  921  SASSSATYEGPNKGMNHPYTDESLFVYSGAYPN  953



>ref|XP_009605195.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=957

 Score =   344 bits (883),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 188/212 (89%), Gaps = 1/212 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHDLVNPPIIHRDIK+NNILLDERLNAKVADFGLSK LG+ E+ H+TTQVKG
Sbjct  740  GAARGLQYLHDLVNPPIIHRDIKSNNILLDERLNAKVADFGLSKLLGDSERGHITTQVKG  799

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMT QLTEKSDVYSFGVVLLEI+T + PIEKG+YIVREV+ AMDKTKDMY+
Sbjct  800  TMGYMDPEYYMTQQLTEKSDVYSFGVVLLEIVTGKIPIEKGRYIVREVRTAMDKTKDMYN  859

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ILDP++ S  TP+S+EKFVD+A++C+E+   +RPTM EVVKEIE IME+VGLNP+A+
Sbjct  860  LHEILDPAVRSGATPKSIEKFVDLAIKCVEEEGVKRPTMSEVVKEIEYIMEIVGLNPNAE  919

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SASTSE+Y G +KG  HPY+DESL VY+G  P
Sbjct  920  SASTSETYEGANKG-LHPYTDESLFVYSGAYP  950



>emb|CDO97682.1| unnamed protein product [Coffea canephora]
Length=953

 Score =   338 bits (867),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+G+QYLH L NPPIIHRDIK+NN+LLDERLNAKVADFGLSK +G  ++ HVTTQVKG
Sbjct  735  GAARGIQYLHVLANPPIIHRDIKSNNVLLDERLNAKVADFGLSKPMGSPDRTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMT QLTEKSDVYSFGV+LLE++TAR PI+KGKYIVREVK AMDKTKD+Y+
Sbjct  795  TMGYMDPEYYMTQQLTEKSDVYSFGVLLLELVTARAPIDKGKYIVREVKLAMDKTKDLYN  854

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ++DP I SSV P SLEKFVD+AL C+ +    RPTM EVVKEIESIME+ GLNPH +
Sbjct  855  LQELIDPVIVSSVAPGSLEKFVDLALDCVAEEGVNRPTMSEVVKEIESIMELAGLNPHTE  914

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SASTS++Y G  KG EHPYSD+SL VY+G  P
Sbjct  915  SASTSDNYDGARKGYEHPYSDDSLFVYSGAYP  946



>ref|XP_011088111.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=952

 Score =   333 bits (855),  Expect = 1e-103, Method: Composition-based stats.
 Identities = 157/209 (75%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+G+QYLHDL NPPIIHRDIK+NNILLDERLNAKVADFGLSK LGE E+ HVTTQVKG
Sbjct  734  GAARGVQYLHDLANPPIIHRDIKSNNILLDERLNAKVADFGLSKPLGESERGHVTTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE++T+R PIEKGKYIVREVKQAMD TKDMY+
Sbjct  794  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLELLTSRSPIEKGKYIVREVKQAMDMTKDMYN  853

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ+ LDP +AS ++ RS+EKFVD++LRC+++    RPTM EVVKEIE IME+ GLNP+A+
Sbjct  854  LQAFLDPIVASGMSSRSIEKFVDLSLRCVQESGINRPTMSEVVKEIERIMEIAGLNPNAE  913

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            SASTS +Y   SKG  HPYS+ES+  Y+G
Sbjct  914  SASTSATYEEESKGLNHPYSNESMFAYSG  942



>gb|EYU33312.1| hypothetical protein MIMGU_mgv1a0019072mg, partial [Erythranthe 
guttata]
Length=684

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+G+QYLHDL NPPIIHRDIK+NNILLDERLNAKVADFGLSK +GE EK +VTTQVKG
Sbjct  466  GAARGVQYLHDLANPPIIHRDIKSNNILLDERLNAKVADFGLSKPMGEPEKGYVTTQVKG  525

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVYSFGV+L EI+TAR PI  GKYIVREVK+AMD+TK +Y+
Sbjct  526  TMGYLDPEYYMTNQLTEKSDVYSFGVLLFEILTARSPIVNGKYIVREVKEAMDRTKVLYN  585

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ILDP +A++  P S+EKF D+ALRC+++    RPTM EV KEIE+IME  GLNPHA+
Sbjct  586  LHDILDPIVAANSAPGSVEKFADLALRCVQESGDSRPTMNEVAKEIENIMESAGLNPHAE  645

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            SASTS SY G  K  EHPY  ESL  Y+G
Sbjct  646  SASTSNSYEGKGKDHEHPYIKESLFAYSG  674



>ref|XP_007023751.1| Leucine-rich repeat family protein / protein kinase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY26373.1| Leucine-rich repeat family protein / protein kinase family protein 
isoform 2 [Theobroma cacao]
Length=353

 Score =   313 bits (801),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 177/216 (82%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YL  L NPPIIHRDIK+ NILLDERLNAKVADFGLSK +G+ EK HVTTQVKG
Sbjct  139  GAARGLAYLQKLANPPIIHRDIKSTNILLDERLNAKVADFGLSKPMGDGEKGHVTTQVKG  198

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LEI+TAR PIE+GKYIVREV+ AMDKTK +Y+
Sbjct  199  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEIVTARKPIERGKYIVREVRLAMDKTKSLYN  258

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILD SI  + TP+ LE FVD+A+ C+E+  A RPTM EVVKEIE+IM++ G+NP+ +
Sbjct  259  LQEILDASIGFAATPKGLEMFVDLAMSCVEESGADRPTMGEVVKEIENIMQLAGMNPNVE  318

Query  213  SASTSESYSGVSK-GSEHPYSDESLSVYTGVLPK*R  109
            SAS+S +Y   +K GS HPYSD+  S Y+G  P  R
Sbjct  319  SASSSATYKEATKGGSLHPYSDD-FSAYSGAFPAPR  353



>ref|XP_011092240.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Sesamum indicum]
Length=934

 Score =   328 bits (841),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 180/209 (86%), Gaps = 0/209 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+G+QYLHDL +PPIIHRDIK+NNILLDERLNAKVADFGLSK +GE E  HVTTQVKG
Sbjct  716  GAARGVQYLHDLADPPIIHRDIKSNNILLDERLNAKVADFGLSKLMGETESGHVTTQVKG  775

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFG+VLLE++TA+ PIE+GKYIVREVK AMDKTK+MY+
Sbjct  776  TMGYLDPEYYMTQQLTEKSDVYSFGIVLLELLTAKSPIERGKYIVREVKVAMDKTKEMYN  835

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LDP +A+++ P S+EKF D+ALRC+++    RP M EVVKEIE+IME+ GLNP+ +
Sbjct  836  LQGVLDPIVAANMAPGSVEKFADLALRCVQESGLNRPMMSEVVKEIENIMELAGLNPNTE  895

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            SAS SESY    KG EHPY++ESL  Y+G
Sbjct  896  SASASESYEEAKKGFEHPYTNESLFAYSG  924



>ref|XP_011092239.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Sesamum indicum]
Length=953

 Score =   328 bits (841),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 180/209 (86%), Gaps = 0/209 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+G+QYLHDL +PPIIHRDIK+NNILLDERLNAKVADFGLSK +GE E  HVTTQVKG
Sbjct  735  GAARGVQYLHDLADPPIIHRDIKSNNILLDERLNAKVADFGLSKLMGETESGHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFG+VLLE++TA+ PIE+GKYIVREVK AMDKTK+MY+
Sbjct  795  TMGYLDPEYYMTQQLTEKSDVYSFGIVLLELLTAKSPIERGKYIVREVKVAMDKTKEMYN  854

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LDP +A+++ P S+EKF D+ALRC+++    RP M EVVKEIE+IME+ GLNP+ +
Sbjct  855  LQGVLDPIVAANMAPGSVEKFADLALRCVQESGLNRPMMSEVVKEIENIMELAGLNPNTE  914

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            SAS SESY    KG EHPY++ESL  Y+G
Sbjct  915  SASASESYEEAKKGFEHPYTNESLFAYSG  943



>ref|XP_011092238.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Sesamum indicum]
Length=964

 Score =   328 bits (841),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 180/209 (86%), Gaps = 0/209 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+G+QYLHDL +PPIIHRDIK+NNILLDERLNAKVADFGLSK +GE E  HVTTQVKG
Sbjct  746  GAARGVQYLHDLADPPIIHRDIKSNNILLDERLNAKVADFGLSKLMGETESGHVTTQVKG  805

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFG+VLLE++TA+ PIE+GKYIVREVK AMDKTK+MY+
Sbjct  806  TMGYLDPEYYMTQQLTEKSDVYSFGIVLLELLTAKSPIERGKYIVREVKVAMDKTKEMYN  865

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LDP +A+++ P S+EKF D+ALRC+++    RP M EVVKEIE+IME+ GLNP+ +
Sbjct  866  LQGVLDPIVAANMAPGSVEKFADLALRCVQESGLNRPMMSEVVKEIENIMELAGLNPNTE  925

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            SAS SESY    KG EHPY++ESL  Y+G
Sbjct  926  SASASESYEEAKKGFEHPYTNESLFAYSG  954



>ref|XP_007023746.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY26368.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=670

 Score =   319 bits (818),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLDERLNAKVADFGLSK +G+ EK HVTTQVKG
Sbjct  452  GAARGLAYLHELANPPIIHRDIKSTNILLDERLNAKVADFGLSKPMGDSEKGHVTTQVKG  511

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LEI+TAR PIE+GKYIVREV+ AMDKTK +Y+
Sbjct  512  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEIVTARKPIERGKYIVREVRLAMDKTKSLYN  571

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILD SI  + TP+ LE FVD+A+ C+E+  A RPTM EVVKEIE+IM++ G+NP+A+
Sbjct  572  LQEILDASIGLAATPKGLEMFVDLAMSCVEESGANRPTMSEVVKEIENIMQLAGMNPNAE  631

Query  213  SASTSESYSGVSK-GSEHPYSDESLSVYTGVLP  118
            SAS S +Y   +K GS HPYSD+S + Y+GV P
Sbjct  632  SASGSATYEEATKGGSLHPYSDDSFA-YSGVFP  663



>ref|XP_007023744.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY26366.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
Length=909

 Score =   319 bits (817),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 181/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLDERLNAKVADFGLSK +G+ E+ HVTTQVKG
Sbjct  691  GAARGLAYLHELANPPIIHRDIKSTNILLDERLNAKVADFGLSKPMGDSERGHVTTQVKG  750

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LEI+TAR PIE+GKYIVREV+ AMDKTK +Y+
Sbjct  751  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEIVTARRPIERGKYIVREVRMAMDKTKSLYN  810

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILD S+  + TP+ LEKFVD+A+ C+E+  A RPTM EVVKEIE+IM++ G+NP+A+
Sbjct  811  LQEILDASMGFAATPKGLEKFVDLAMSCVEESGANRPTMGEVVKEIENIMQLAGMNPNAE  870

Query  213  SASTSESYSGVSK-GSEHPYSDESLSVYTGVLP  118
            SAS+S +Y   +K GS HPY D+S + Y+GV P
Sbjct  871  SASSSATYEEATKGGSLHPYGDDSFA-YSGVFP  902



>ref|XP_007023743.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY26365.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=955

 Score =   319 bits (817),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 181/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLDERLNAKVADFGLSK +G+ E+ HVTTQVKG
Sbjct  737  GAARGLAYLHELANPPIIHRDIKSTNILLDERLNAKVADFGLSKPMGDSERGHVTTQVKG  796

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LEI+TAR PIE+GKYIVREV+ AMDKTK +Y+
Sbjct  797  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEIVTARRPIERGKYIVREVRMAMDKTKSLYN  856

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILD S+  + TP+ LEKFVD+A+ C+E+  A RPTM EVVKEIE+IM++ G+NP+A+
Sbjct  857  LQEILDASMGFAATPKGLEKFVDLAMSCVEESGANRPTMGEVVKEIENIMQLAGMNPNAE  916

Query  213  SASTSESYSGVSK-GSEHPYSDESLSVYTGVLP  118
            SAS+S +Y   +K GS HPY D+S + Y+GV P
Sbjct  917  SASSSATYEEATKGGSLHPYGDDSFA-YSGVFP  948



>ref|XP_007023753.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY26375.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=956

 Score =   315 bits (807),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 180/216 (83%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH L NPPIIHRDIK++NILLDERLNAKVADFGLSK +G+ E+ HVTTQVKG
Sbjct  742  GAARGLAYLHKLANPPIIHRDIKSSNILLDERLNAKVADFGLSKPMGDSERGHVTTQVKG  801

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MT QLTEKSDVYSFGV++LEI+TAR PIE+GKYIVREV+ AMDKTK +Y+
Sbjct  802  TMGYLDPEYFMTQQLTEKSDVYSFGVLMLEIVTARKPIERGKYIVREVRLAMDKTKSLYN  861

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILD SI  + TP+ LE FVD+A+ C+E+  A RPTM EVVKEIE+IM++ G+NP+ +
Sbjct  862  LQEILDASIGFAATPKGLEMFVDLAMSCVEESGADRPTMSEVVKEIENIMQLAGMNPNVE  921

Query  213  SASTSESYSGVSK-GSEHPYSDESLSVYTGVLPK*R  109
            SAS+S +Y   +K GS HPYSD+S S Y+G  P  R
Sbjct  922  SASSSATYEEATKGGSLHPYSDDS-SAYSGAFPAPR  956



>ref|XP_011092237.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=943

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+G+ YLH+L +PPIIHRDIKT+NILLDERLNAKVADFGLSK +GEQE++HVTT+VKG
Sbjct  732  GAARGIHYLHELADPPIIHRDIKTSNILLDERLNAKVADFGLSKPMGEQERSHVTTEVKG  791

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T GY DPEYYMT QLT+KSDVYSFGVVLLE++TAR PIEKGKYIV EVKQAMDKTKDMY+
Sbjct  792  TAGYFDPEYYMTQQLTQKSDVYSFGVVLLELLTARRPIEKGKYIVNEVKQAMDKTKDMYN  851

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ ILDP +AS+  P S+EK  D+AL+C+++    RPTM EV+KEIE+IME+ GLNP+A+
Sbjct  852  LEGILDPIVASNTVPGSVEKVTDLALKCIQEPGFNRPTMGEVLKEIENIMELAGLNPNAE  911

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            S ++S+S+    K S HPY+ ESLS ++G  P
Sbjct  912  STASSQSFD-ARKASSHPYTSESLSSHSGASP  942



>gb|KJB57522.1| hypothetical protein B456_009G167900 [Gossypium raimondii]
Length=925

 Score =   312 bits (800),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 181/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L NPPIIHRDIK+ NILLDERLNAKVADFGLSK +G+ EK HV+TQVKG
Sbjct  705  GAAKGVAYLHELANPPIIHRDIKSTNILLDERLNAKVADFGLSKPMGDSEKGHVSTQVKG  764

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LEIITAR PIE+GKYIVRE++ +MDKTK +Y+
Sbjct  765  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEIITARRPIERGKYIVREMRMSMDKTKSLYN  824

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM+M G+NP+A+
Sbjct  825  LQQILDPAIGFGTSSKGLERFVELAMRCVEESGADRPTMGEVVKEIENIMQMDGMNPNAE  884

Query  213  SASTSESYSGVSKGSE-HPYSDESLSVYTGVLP  118
            SAS+S +Y   +KG++ HPY +ES + Y+G  P
Sbjct  885  SASSSATYEDATKGADLHPYDNESFA-YSGAFP  916



>gb|KJB57523.1| hypothetical protein B456_009G167900 [Gossypium raimondii]
Length=959

 Score =   312 bits (800),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 181/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L NPPIIHRDIK+ NILLDERLNAKVADFGLSK +G+ EK HV+TQVKG
Sbjct  739  GAAKGVAYLHELANPPIIHRDIKSTNILLDERLNAKVADFGLSKPMGDSEKGHVSTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LEIITAR PIE+GKYIVRE++ +MDKTK +Y+
Sbjct  799  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEIITARRPIERGKYIVREMRMSMDKTKSLYN  858

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM+M G+NP+A+
Sbjct  859  LQQILDPAIGFGTSSKGLERFVELAMRCVEESGADRPTMGEVVKEIENIMQMDGMNPNAE  918

Query  213  SASTSESYSGVSKGSE-HPYSDESLSVYTGVLP  118
            SAS+S +Y   +KG++ HPY +ES + Y+G  P
Sbjct  919  SASSSATYEDATKGADLHPYDNESFA-YSGAFP  950



>ref|XP_009803111.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana sylvestris]
Length=948

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHD V+PPIIHRDIK+NNILLDERLNAKVADFGLSKS+ E EK +V+TQVKG
Sbjct  736  GAARGLQYLHDHVDPPIIHRDIKSNNILLDERLNAKVADFGLSKSMIEPEKGYVSTQVKG  795

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYY + QLTEKSDVYSFGVVLLE+ITAR PI KGKYIV+E+KQA+DK+KDMY+
Sbjct  796  TMGYMDPEYYTSQQLTEKSDVYSFGVVLLELITARSPIVKGKYIVKELKQAIDKSKDMYN  855

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            +   +DP+I SS+TP S  KFVD+ALRC+E+    RPTM EVVKEIE+IME+ G+N +A+
Sbjct  856  IDGFVDPNIPSSMTPISFRKFVDLALRCVEEAGVHRPTMCEVVKEIENIMEIDGMNTNAE  915

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            S STS S  G S   +HPYS+ESL  Y+G
Sbjct  916  SGSTSASCEGTSIACDHPYSEESLVRYSG  944



>ref|XP_009605193.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=948

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHD V PPIIHRDIK+NNILLDE LNAKVADFGLSKS+ E EK +V+TQVKG
Sbjct  735  GAARGLQYLHDHVYPPIIHRDIKSNNILLDEHLNAKVADFGLSKSMSEPEKGYVSTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYY + QLTEKSDVYSFGVVLLE+ITAR PI +GKYIV+EVKQA+DK+KDMY+
Sbjct  795  TMGYMDPEYYTSQQLTEKSDVYSFGVVLLELITARSPIVRGKYIVKEVKQAIDKSKDMYN  854

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            +   +DP+I SS+TP S  KFVD+ALRC+E+    RPTM EVVKEIE+IMEM G+N +A+
Sbjct  855  IDGFVDPTIPSSMTPISFRKFVDLALRCVEEAGVHRPTMYEVVKEIENIMEMDGMNTYAE  914

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            S STS S  G S    HPYS+ESL  Y+G
Sbjct  915  SGSTSASCEGTSIACGHPYSEESLVSYSG  943



>ref|XP_006358480.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=960

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 175/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHD VNPPI+HRDIK+NNILL + LNAKVADFGLSK LGE  + H+TTQVKG
Sbjct  754  GAARGLQYLHDHVNPPIVHRDIKSNNILLADHLNAKVADFGLSKLLGE--RGHITTQVKG  811

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMTNQLTEKSDV+SFGVVLLEI+T + PI+KG+YIV+EVK AMD TKD+Y+
Sbjct  812  TMGYMDPEYYMTNQLTEKSDVFSFGVVLLEIVTGKVPIDKGRYIVKEVKDAMDMTKDLYN  871

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ILDP++ S  TPRSLEKFVD+AL+C+E+    RP M EVVK+IE IME+ GLNP  +
Sbjct  872  LHEILDPAVCSGATPRSLEKFVDLALKCVEEKGVNRPKMSEVVKQIEYIMEIEGLNPDDE  931

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYT  130
            SASTS +Y G +KG  HPY+ ESL VY+
Sbjct  932  SASTSATYEGANKGLNHPYT-ESLFVYS  958



>ref|XP_002303228.2| hypothetical protein POPTR_0003s03690g [Populus trichocarpa]
 gb|EEE78207.2| hypothetical protein POPTR_0003s03690g [Populus trichocarpa]
Length=488

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 171/202 (85%), Gaps = 1/202 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLDE LNAKVADFGLSK +G+ EK  VTTQVKG
Sbjct  268  GAARGLAYLHELANPPIIHRDIKSTNILLDESLNAKVADFGLSKLMGDSEKGRVTTQVKG  327

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE++T R P+E+GKY+VREVK A+D+ KD+Y+
Sbjct  328  TMGYLDPEYYMTLQLTEKSDVYSFGVVMLELLTGRRPVERGKYVVREVKMALDRAKDLYN  387

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ +LDPSI    T + L+KFVDVAL+C+++  + RPTM EVV EIE+I+++ GLNP+AD
Sbjct  388  LRELLDPSIGLDTTLKGLDKFVDVALKCVQENGSDRPTMGEVVNEIENILQLAGLNPNAD  447

Query  213  SASTSESYSGVSKGS-EHPYSD  151
            SASTS SY  VSKGS +HPY +
Sbjct  448  SASTSASYDDVSKGSAKHPYKN  469



>ref|XP_004230392.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=951

 Score =   310 bits (794),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHD V+PPIIHRDIK+NNILLDERLNAKVADFGLSK++ E +K +V+TQVKG
Sbjct  738  GAARGLQYLHDHVDPPIIHRDIKSNNILLDERLNAKVADFGLSKTMSEPDKGYVSTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYY T QLTEKSDVYSFGV+LLE+ITAR PI +GKYIV+E++QA+DK+KDMY+
Sbjct  798  TMGYMDPEYYTTQQLTEKSDVYSFGVLLLELITARSPIVRGKYIVKELRQAIDKSKDMYN  857

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            +   +DP+I S++TP S  KFVD+A  CLED  A RPTM EVVKEIE+IME+ GLN  A+
Sbjct  858  IDEFVDPAIPSNMTPISFRKFVDLAFMCLEDAGANRPTMGEVVKEIENIMEIDGLNSCAE  917

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGV  124
            S STS S+ G S   +HPYS+ESL+ Y GV
Sbjct  918  SRSTSVSHEGTSATFDHPYSEESLNRYNGV  947



>gb|EPS61254.1| hypothetical protein M569_13543, partial [Genlisea aurea]
Length=566

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 175/215 (81%), Gaps = 3/215 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+NNILLD+RLNAKVADFGLSK L E E +H+TTQVKG
Sbjct  350  GAARGLHYLHELANPPIIHRDIKSNNILLDDRLNAKVADFGLSKPLTESEISHITTQVKG  409

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMT +LTEKSDVYSFGV+LLE++T+R PIE GKYIV++VKQ MD TK  YD
Sbjct  410  TMGYMDPEYYMTQRLTEKSDVYSFGVLLLELLTSRNPIEGGKYIVQQVKQRMDSTKPFYD  469

Query  393  LQSILDPSIASSVTP--RSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
            LQ +LDP++ S+ +P   S+E  VD+ALRC+E+    RP+M  V KEIE++ME +GLNP+
Sbjct  470  LQPLLDPTVISTASPAVASVENLVDLALRCVEEHGLDRPSMSAVAKEIENVMESIGLNPN  529

Query  219  ADSASTSESYSGVSKGSE-HPYSDESLSVYTGVLP  118
            A+SASTS SY    +G + HPYS+ESL  Y+G  P
Sbjct  530  AESASTSSSYEAAGRGEKLHPYSNESLFTYSGAYP  564



>ref|XP_006358563.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like, partial [Solanum tuberosum]
Length=738

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 3/208 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHDLV+PPIIHRDIK+NNILLD  LNAKVADFGLS+ LGE  K H+TTQVKG
Sbjct  532  GAARGLQYLHDLVSPPIIHRDIKSNNILLDANLNAKVADFGLSRFLGE--KGHITTQVKG  589

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMTNQLTEKSDV+SFGVVLLEI+T + PI+KG+YIV+EVK AMD TKD+Y+
Sbjct  590  TMGYMDPEYYMTNQLTEKSDVFSFGVVLLEIVTGKVPIDKGRYIVKEVKDAMDMTKDLYN  649

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L   LDP + S  TPRSLE+FV +AL+C+E+    RP M EVVK+IE+IME+  LNP+AD
Sbjct  650  LHETLDPVVRSGATPRSLEEFVVLALKCVEEGGVNRPKMSEVVKQIENIMEIERLNPYAD  709

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYT  130
             ASTS +Y G +KG  HPY+ ESL VY+
Sbjct  710  YASTSATYEGENKGLNHPYT-ESLFVYS  736



>gb|KHG12756.1| hypothetical protein F383_03913 [Gossypium arboreum]
 gb|KHG27402.1| hypothetical protein F383_16446 [Gossypium arboreum]
Length=959

 Score =   309 bits (792),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 180/213 (85%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L NPPIIHRDIK+ NILLDERLNAKVADFGLSK +G+ EK HV+TQVKG
Sbjct  739  GAAKGVAYLHELANPPIIHRDIKSTNILLDERLNAKVADFGLSKPMGDSEKGHVSTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LEIITAR PIE+GKYIVRE++ +MDKTK +Y+
Sbjct  799  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEIITARRPIERGKYIVREMRMSMDKTKSLYN  858

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+    RPTM EVVKEIE+IM+M G+NP+A+
Sbjct  859  LQQILDPAIGFGTSSKGLERFVELAMRCVEESGTDRPTMGEVVKEIENIMQMDGMNPNAE  918

Query  213  SASTSESYSGVSKGSE-HPYSDESLSVYTGVLP  118
            SAS+S +Y   +KG++ HPY ++S + Y+G  P
Sbjct  919  SASSSATYEDATKGADLHPYDNDSFA-YSGAFP  950



>ref|NP_001242669.1| probable leucine-rich repeat receptor-like protein kinase At5g49770-like 
precursor [Glycine max]
 gb|ACM89577.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=723

 Score =   302 bits (774),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 181/216 (84%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPIIHRDIK++NILLD  LNAKVADFGLSK L + E+ HVTTQVKG
Sbjct  505  GAARGLAYLHELADPPIIHRDIKSSNILLDHHLNAKVADFGLSKLLVDSERGHVTTQVKG  564

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYS+GV++LE+ TAR PIE+GKYIVREV + MD +KD+Y+
Sbjct  565  TMGYLDPEYYMTQQLTEKSDVYSYGVLMLELATARRPIEQGKYIVREVLRVMDTSKDLYN  624

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L SILDP+I  +  P+ LEKFV +A+RC+++ AA+RPTM EVVKEIESI+E+VGLNP+++
Sbjct  625  LHSILDPTIMKATRPKGLEKFVMLAMRCVKEYAAERPTMAEVVKEIESIIELVGLNPNSE  684

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SA+TSE+Y   + G ++HPY +E  S Y+G+ P  R
Sbjct  685  SATTSETYEEANAGNAQHPYREEDFS-YSGIFPSTR  719



>ref|XP_006358481.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=947

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 176/210 (84%), Gaps = 0/210 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GLQYLHD V+PPIIHRDIK+NNILLDERL AKVADFGLSK++ E +K +V+TQVKG
Sbjct  734  GAARGLQYLHDHVDPPIIHRDIKSNNILLDERLTAKVADFGLSKTMYEPDKGYVSTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYY T QLTEKSDVYSFGV+LLE+ITAR PI +GKYIV+E++QA+DK+KDMY+
Sbjct  794  TMGYMDPEYYTTQQLTEKSDVYSFGVLLLELITARSPIVRGKYIVKELRQAIDKSKDMYN  853

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            +   +DP+I S++TP S  KFVD+A  CLED  A RPTM EVVKEIE+IME+ GLN  A+
Sbjct  854  IDEFVDPAIPSNMTPISFRKFVDLAFTCLEDAGANRPTMAEVVKEIENIMEIDGLNSCAE  913

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGV  124
            S STS S+ G S   +HPYS+ESL+ Y GV
Sbjct  914  SRSTSVSHEGTSATFDHPYSEESLNRYNGV  943



>gb|EYU33236.1| hypothetical protein MIMGU_mgv1a021943mg [Erythranthe guttata]
Length=955

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+QYLHD  NPPIIHRDIK+NNILLDERLNAKVADFGLSK + + E+ HVTTQVKG
Sbjct  736  GAAKGIQYLHDEANPPIIHRDIKSNNILLDERLNAKVADFGLSKIMHDSERNHVTTQVKG  795

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFG+++ E++TAR PIEK K+IVR+V  +MDK+K MY+
Sbjct  796  TMGYLDPEYYMTQQLTEKSDVYSFGILMFELLTARLPIEKNKHIVRQVMSSMDKSKSMYN  855

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LDP++AS ++ +S+E FVD+AL C++++ + RP+M EVVKEIE+ ME+ G+NP+A+
Sbjct  856  LQGLLDPAVASRMSTKSVEMFVDLALWCVKELGSNRPSMSEVVKEIENTMEIAGINPNAE  915

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            S  +S +Y   +K S+HPYSDESL  Y+G
Sbjct  916  STPSSSTYVDANKASKHPYSDESLFAYSG  944



>gb|KDP32456.1| hypothetical protein JCGZ_13381 [Jatropha curcas]
Length=634

 Score =   298 bits (762),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 173/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL Y+H+L +PPIIHRDIK+ NILLDERL AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  418  GAARGLAYMHELADPPIIHRDIKSTNILLDERLIAKVADFGLSKPVGDTEKGHVTTQVKG  477

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE++T R PIE+G YIVREV+ A+D+TKD+Y+
Sbjct  478  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTGRRPIERGHYIVREVRLALDRTKDLYN  537

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP I    T   L+KFVD+A+RC+++  A RPTM EVVKEIE+I+++ GLNP+A+
Sbjct  538  LHELLDPGIGLETTLNGLDKFVDLAMRCVQESGADRPTMGEVVKEIENILQLAGLNPNAE  597

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SASTS SY    KGS HPYS ++   Y+G  P
Sbjct  598  SASTSASYEEAGKGS-HPYSKDAFD-YSGGFP  627



>gb|EPS73565.1| hypothetical protein M569_01189, partial [Genlisea aurea]
Length=957

 Score =   305 bits (780),  Expect = 8e-93, Method: Composition-based stats.
 Identities = 143/215 (67%), Positives = 178/215 (83%), Gaps = 3/215 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+G+ YLH+L NPPIIHRDIK+NNILLD+RLNAKVADFGLSK + + ++ H+TTQVKG
Sbjct  739  GAARGIHYLHELANPPIIHRDIKSNNILLDDRLNAKVADFGLSKLMLDSDRGHITTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMT +LTEKSDVYSFGV+LLE++T R PIE+GKYIVREVKQAMD TK +Y+
Sbjct  799  TLGYLDPEYYMTQRLTEKSDVYSFGVLLLELLTGRTPIEQGKYIVREVKQAMDTTKTLYN  858

Query  393  LQSI-LDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ+I LDP +A++ +  S+E F+D+ALRC+++ +  RP M  VVKEIE IME+ GLNPHA
Sbjct  859  LQNILLDPIVAATTSTNSVELFIDLALRCVQESSLNRPAMSTVVKEIEKIMELAGLNPHA  918

Query  216  DSASTSESYSGVSKGS--EHPYSDESLSVYTGVLP  118
            +SAS+S SY G  KG    HPYS+ESL  Y+G  P
Sbjct  919  ESASSSTSYEGAPKGGPIRHPYSNESLFAYSGAYP  953



>ref|XP_010533231.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=954

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPIIHRDIK+NNILLD+ L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  737  GAARGLAYLHELADPPIIHRDIKSNNILLDDTLTAKVADFGLSKLVGDPEKTHVTTQVKG  796

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMT QLTEKSDVY FGVV+LE++T RPPIE+GKY+VREVK  MDK++++YD
Sbjct  797  TLGYLDPEYYMTQQLTEKSDVYGFGVVMLELLTGRPPIERGKYVVREVKTKMDKSRNLYD  856

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LD SI  S T +  E+FVDVALRC+E+    RP+M EVVKEIE+IM++ G+NP+ D
Sbjct  857  LQEVLDSSIIVSTTLKGFERFVDVALRCVEESGEDRPSMGEVVKEIENIMQLAGMNPNTD  916

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SAS+S +Y   SKGS +PY  ES   Y+G  P
Sbjct  917  SASSSRTYDDASKGSGNPYGTESFE-YSGNFP  947



>ref|XP_006588460.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
 gb|KHN32231.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=932

 Score =   302 bits (774),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 181/216 (84%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPIIHRDIK++NILLD  LNAKVADFGLSK L + E+ HVTTQVKG
Sbjct  714  GAARGLAYLHELADPPIIHRDIKSSNILLDHHLNAKVADFGLSKLLVDSERGHVTTQVKG  773

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYS+GV++LE+ TAR PIE+GKYIVREV + MD +KD+Y+
Sbjct  774  TMGYLDPEYYMTQQLTEKSDVYSYGVLMLELATARRPIEQGKYIVREVLRVMDTSKDLYN  833

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L SILDP+I  +  P+ LEKFV +A+RC+++ AA+RPTM EVVKEIESI+E+VGLNP+++
Sbjct  834  LHSILDPTIMKATRPKGLEKFVMLAMRCVKEYAAERPTMAEVVKEIESIIELVGLNPNSE  893

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SA+TSE+Y   + G ++HPY +E  S Y+G+ P  R
Sbjct  894  SATTSETYEEANAGNAQHPYREEDFS-YSGIFPSTR  928



>emb|CDY21453.1| BnaC03g27440D [Brassica napus]
Length=439

 Score =   290 bits (741),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  221  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKIVGDPEKTHVTTQVKG  280

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  M+K++ +YD
Sbjct  281  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKTKMNKSRSLYD  340

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++D + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  341  LQELMDTTIIASSSNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNV  400

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSAS+S +Y    KGS  PY  +S   Y+G  P
Sbjct  401  DSASSSRTYEEAIKGSGDPYGKDSFE-YSGNFP  432



>ref|XP_002519381.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF42998.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=960

 Score =   302 bits (774),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 177/213 (83%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL Y+H+L NPPIIHRD+K+ NILLDERLNAKVADFGLSK + + EK HVTTQVKG
Sbjct  742  GSARGLAYMHELANPPIIHRDVKSTNILLDERLNAKVADFGLSKPMSDSEKGHVTTQVKG  801

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE++T + PIE+GKYIVREVK AMD+TKD+Y+
Sbjct  802  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTGKRPIERGKYIVREVKLAMDRTKDLYN  861

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP I    T + L+KFVD+A++C++++ A RPTM +VVKEIE+I+++ G+NP+A+
Sbjct  862  LHELLDPGIGLETTLKGLDKFVDLAMKCVQELGADRPTMGDVVKEIENILKLAGVNPNAE  921

Query  213  SASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            SASTS SY   SKGS  HPY+ ++   Y+G  P
Sbjct  922  SASTSASYEEASKGSPHHPYNKDAFE-YSGAFP  953



>ref|XP_010521415.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Tarenaya hassleriana]
Length=957

 Score =   302 bits (774),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPIIHRD+K+NNILLD+ L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  740  GAARGLAYLHELADPPIIHRDVKSNNILLDDTLTAKVADFGLSKLVGDPEKTHVTTQVKG  799

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE++T R PIE+GKY+V+EVK  MDK++++YD
Sbjct  800  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTGRQPIERGKYVVKEVKAKMDKSRNLYD  859

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDPSI  S T +  E+FVDVAL C+E+    RP+M EVVKEIE+IM++VG+NP+ D
Sbjct  860  LQEILDPSIIVSTTLKGFERFVDVALTCVEESREGRPSMGEVVKEIENIMQIVGVNPNTD  919

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SAS+S +Y   SKGS +PY   S   Y+G+ P
Sbjct  920  SASSSRTYDEASKGSSNPYGKGSFE-YSGIFP  950



>gb|KHN48167.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=931

 Score =   301 bits (772),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 182/217 (84%), Gaps = 4/217 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPIIHRDIK++NILLD  LNAKVADFGLSK L + E+ HVTTQVKG
Sbjct  713  GAARGLAYLHELADPPIIHRDIKSSNILLDHHLNAKVADFGLSKLLVDSERGHVTTQVKG  772

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ TAR PIE+GKYIVREV + MD +KD+Y+
Sbjct  773  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELATARRPIEQGKYIVREVMRVMDTSKDLYN  832

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L SILDP+I  +  P+ LEKFV +A+RC+++ AA+RPTM EVVKEIES++E+VGLNP+++
Sbjct  833  LHSILDPTIMKATRPKGLEKFVMLAMRCVKEYAAERPTMAEVVKEIESMIELVGLNPNSE  892

Query  213  SASTSESY--SGVSKGSEHPYSDESLSVYTGVLPK*R  109
            SA+TSE+Y  +GV   ++HPY +E  S Y+G+ P  R
Sbjct  893  SATTSETYVEAGVGN-AQHPYREEDFS-YSGIFPSTR  927



>ref|XP_003541454.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=931

 Score =   301 bits (772),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 182/217 (84%), Gaps = 4/217 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPIIHRDIK++NILLD  LNAKVADFGLSK L + E+ HVTTQVKG
Sbjct  713  GAARGLAYLHELADPPIIHRDIKSSNILLDHHLNAKVADFGLSKLLVDSERGHVTTQVKG  772

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ TAR PIE+GKYIVREV + MD +KD+Y+
Sbjct  773  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELATARRPIEQGKYIVREVMRVMDTSKDLYN  832

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L SILDP+I  +  P+ LEKFV +A+RC+++ AA+RPTM EVVKEIES++E+VGLNP+++
Sbjct  833  LHSILDPTIMKATRPKGLEKFVMLAMRCVKEYAAERPTMAEVVKEIESMIELVGLNPNSE  892

Query  213  SASTSESY--SGVSKGSEHPYSDESLSVYTGVLPK*R  109
            SA+TSE+Y  +GV   ++HPY +E  S Y+G+ P  R
Sbjct  893  SATTSETYVEAGVGN-AQHPYREEDFS-YSGIFPSTR  927



>gb|KCW62550.1| hypothetical protein EUGRSUZ_G00041 [Eucalyptus grandis]
Length=933

 Score =   301 bits (772),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK +GE E+ HVTTQVKG
Sbjct  714  GAARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKLVGEDERGHVTTQVKG  773

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVY FGV++LE++TAR PIE+G+YIVREV+  M+K KD+Y+
Sbjct  774  TMGYLDPEYYMTQQLTEKSDVYGFGVLMLELLTARRPIERGRYIVREVRVLMNKDKDLYN  833

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLNP A+
Sbjct  834  LQGILDPAIGLGTSLKGLERFVELAMRCVEESGADRPTMGEVVKEIENIMVFEGLNPKAE  893

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SA+ S SY   SKG S HPYS+E    Y+G  P  R
Sbjct  894  SATASASYEEASKGYSTHPYSNEDFLEYSGGFPPSR  929



>gb|KCW62549.1| hypothetical protein EUGRSUZ_G00041 [Eucalyptus grandis]
Length=940

 Score =   301 bits (772),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK +GE E+ HVTTQVKG
Sbjct  721  GAARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKLVGEDERGHVTTQVKG  780

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVY FGV++LE++TAR PIE+G+YIVREV+  M+K KD+Y+
Sbjct  781  TMGYLDPEYYMTQQLTEKSDVYGFGVLMLELLTARRPIERGRYIVREVRVLMNKDKDLYN  840

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLNP A+
Sbjct  841  LQGILDPAIGLGTSLKGLERFVELAMRCVEESGADRPTMGEVVKEIENIMVFEGLNPKAE  900

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SA+ S SY   SKG S HPYS+E    Y+G  P  R
Sbjct  901  SATASASYEEASKGYSTHPYSNEDFLEYSGGFPPSR  936



>gb|EYU33238.1| hypothetical protein MIMGU_mgv1a025286mg [Erythranthe guttata]
Length=952

 Score =   301 bits (772),  Expect = 9e-92, Method: Composition-based stats.
 Identities = 141/212 (67%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKGLQYLHD  +PPIIHRDIK+NNILLDERL AKVADFGLSK +G+ E+ HVTTQVKG
Sbjct  732  GAAKGLQYLHDEADPPIIHRDIKSNNILLDERLTAKVADFGLSKLMGDSERGHVTTQVKG  791

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFG++LLE++TAR PIE GK+IVREV+  MD +K+MY+
Sbjct  792  TMGYLDPEYYMTQQLTEKSDVYSFGILLLELLTARLPIENGKHIVREVRSVMDTSKNMYN  851

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP++AS ++ +S+E FVD+ALRC++++ + RP+M EVVKEIE+ ME+ G+NP+A+
Sbjct  852  LQGILDPAVASGMSAKSVEMFVDLALRCVQELGSNRPSMSEVVKEIENTMEIAGINPNAE  911

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SA TS +Y   +K  +HPYS+E++  Y+G  P
Sbjct  912  SAPTSSTYEDANKDGKHPYSNENMFAYSGAYP  943



>ref|XP_010067941.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=947

 Score =   301 bits (771),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK +GE E+ HVTTQVKG
Sbjct  728  GAARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKLVGEDERGHVTTQVKG  787

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVY FGV++LE++TAR PIE+G+YIVREV+  M+K KD+Y+
Sbjct  788  TMGYLDPEYYMTQQLTEKSDVYGFGVLMLELLTARRPIERGRYIVREVRVLMNKDKDLYN  847

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLNP A+
Sbjct  848  LQGILDPAIGLGTSLKGLERFVELAMRCVEESGADRPTMGEVVKEIENIMVFEGLNPKAE  907

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SA+ S SY   SKG S HPYS+E    Y+G  P  R
Sbjct  908  SATASASYEEASKGYSTHPYSNEDFLEYSGGFPPSR  943



>ref|XP_010065205.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=955

 Score =   301 bits (770),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 142/216 (66%), Positives = 174/216 (81%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK +G+ E+ HVTTQVKG
Sbjct  736  GAARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKPMGDGERGHVTTQVKG  795

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVY FGV++LE++TAR PIE+G+YIVREV+  M+K KD+Y+
Sbjct  796  TMGYLDPEYYMTQQLTEKSDVYGFGVLMLELLTARRPIERGRYIVREVRMLMNKDKDLYN  855

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLNP A+
Sbjct  856  LQGILDPAIGLGTSLKGLERFVELAIRCVEESGADRPTMGEVVKEIENIMVFAGLNPKAE  915

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SA+TS SY   SKG + HPY +E  S Y+G  P  R
Sbjct  916  SATTSASYEEASKGYAAHPYGNEDFSQYSGGFPPSR  951



>gb|KJB68016.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=943

 Score =   300 bits (768),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPP+IHRD+K+ NILLDERLNAKVADFGLSK +G+ EK HVTTQVKG
Sbjct  738  GAARGLAYLHELANPPVIHRDVKSTNILLDERLNAKVADFGLSKPMGDSEKGHVTTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LEI+TAR PIE GKYIVREV  +MDK++ +Y+
Sbjct  798  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLEIVTARKPIEHGKYIVREVATSMDKSRSLYN  857

Query  393  LQSILDPSIA--SSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
            LQ ILDP+I   +   P  LE FVD+A+RC+ED    RPTM EVVKEIE+IM++ GLNP+
Sbjct  858  LQEILDPTIGLDTDTIPHGLENFVDLAMRCVEDARTDRPTMGEVVKEIENIMQVAGLNPN  917

Query  219  ADSASTSESYSGVSKGS-EHPYSDE  148
            A+SAS+S +Y   +KG+  HPY  +
Sbjct  918  AESASSSATYEDANKGTPHHPYGSK  942



>gb|KJB68014.1| hypothetical protein B456_010G221900 [Gossypium raimondii]
Length=947

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPP+IHRD+K+ NILLDERLNAKVADFGLSK +G+ EK HVTTQVKG
Sbjct  742  GAARGLAYLHELANPPVIHRDVKSTNILLDERLNAKVADFGLSKPMGDSEKGHVTTQVKG  801

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LEI+TAR PIE GKYIVREV  +MDK++ +Y+
Sbjct  802  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLEIVTARKPIEHGKYIVREVATSMDKSRSLYN  861

Query  393  LQSILDPSIA--SSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
            LQ ILDP+I   +   P  LE FVD+A+RC+ED    RPTM EVVKEIE+IM++ GLNP+
Sbjct  862  LQEILDPTIGLDTDTIPHGLENFVDLAMRCVEDARTDRPTMGEVVKEIENIMQVAGLNPN  921

Query  219  ADSASTSESYSGVSKGS-EHPYSDE  148
            A+SAS+S +Y   +KG+  HPY  +
Sbjct  922  AESASSSATYEDANKGTPHHPYGSK  946



>ref|XP_010065204.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=955

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK +G+ E+ HVTTQVKG
Sbjct  736  GAARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKPMGDGERGHVTTQVKG  795

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++TAR PIE+G+YIVREV+  ++K KD+Y+
Sbjct  796  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELLTARRPIERGRYIVREVRVLINKDKDLYN  855

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC E+  A RPTM EVVKEIE+IM   GLNP A+
Sbjct  856  LQGILDPAIGLGTSLKGLERFVELAMRCAEESGADRPTMGEVVKEIENIMVFAGLNPKAE  915

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SA+TS SY   SKG + HPY +E    Y+G  P  R
Sbjct  916  SATTSASYEEASKGYATHPYRNEDFFEYSGGFPPSR  951



>ref|XP_010252252.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=953

 Score =   299 bits (766),  Expect = 7e-91, Method: Composition-based stats.
 Identities = 145/213 (68%), Positives = 172/213 (81%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+  NPPIIHRDIK+ NILLD+RLNAKV+DFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSARGLAYLHEHANPPIIHRDIKSTNILLDDRLNAKVSDFGLSKLMGDNEKDHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYM+ QLTEKSDVYSFGVV+LE+ITAR PIE+GKYIVREVK A+DKTKD+Y 
Sbjct  795  TMGYLDPEYYMSQQLTEKSDVYSFGVVMLELITARKPIERGKYIVREVKMAIDKTKDLYG  854

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L   LDP+I    T +  EKFVD+A+ C+E+  A RP M EVVKEIE+IM++ GLNP+AD
Sbjct  855  LHEFLDPAIGLGTTLKGFEKFVDLAMSCVEESGADRPMMSEVVKEIENIMQLAGLNPNAD  914

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLP  118
            SASTS SY G   G   HPY+D+ L  Y+G  P
Sbjct  915  SASTSASYGGTGGGHPRHPYNDD-LFDYSGGYP  946



>emb|CDY70266.1| BnaCnng67530D [Brassica napus]
Length=641

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  423  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  482

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIEKGKY+VREVK  M+K++ +YD
Sbjct  483  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIEKGKYVVREVKMKMNKSRSLYD  542

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  +K+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  543  LQELLDTTIIASSSNLKGFDKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNG  602

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSASTS +Y    KGS  PY  +S   Y+G  P
Sbjct  603  DSASTSATYEDAIKGSGDPYGKDSFQ-YSGNFP  634



>gb|KCW62551.1| hypothetical protein EUGRSUZ_G00043, partial [Eucalyptus grandis]
Length=945

 Score =   297 bits (761),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 171/210 (81%), Gaps = 1/210 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK +G+ E+ HVTTQVKG
Sbjct  736  GAARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKPMGDGERGHVTTQVKG  795

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++TAR PIE+G+YIVREV+  ++K KD+Y+
Sbjct  796  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELLTARRPIERGRYIVREVRVLINKDKDLYN  855

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC E+  A RPTM EVVKEIE+IM   GLNP A+
Sbjct  856  LQGILDPAIGLGTSLKGLERFVELAMRCAEESGADRPTMGEVVKEIENIMVFAGLNPKAE  915

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTG  127
            SA+TS SY   SKG + HPY +E    Y+G
Sbjct  916  SATTSASYEEASKGYATHPYRNEDFFEYSG  945



>ref|XP_010252242.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nelumbo nucifera]
Length=906

 Score =   296 bits (759),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 173/212 (82%), Gaps = 3/212 (1%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            +A+GL YLHD  +PPIIHRDIK+NNILLDERLNAKVADFGLSKS+GE EK H+TTQVKGT
Sbjct  690  SARGLAYLHDHADPPIIHRDIKSNNILLDERLNAKVADFGLSKSMGE-EKDHLTTQVKGT  748

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYM+ QLTEKSDVYSFGV+LLE+ITA+ PIE+G+YIVRE++  +DKTKD+Y L
Sbjct  749  MGYLDPEYYMSQQLTEKSDVYSFGVLLLELITAKKPIERGRYIVREMRITIDKTKDLYGL  808

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHADS  211
              +LDP+I    + +  EK+VD+A+ C+E+    RPTM EVVKEIESIM++ GLNP+A+S
Sbjct  809  HELLDPAIGLGTSLKGFEKYVDLAMWCVEESGTDRPTMSEVVKEIESIMQIAGLNPNAES  868

Query  210  ASTSESYSGVSKG-SEHPYSDESLSVYTGVLP  118
            ASTS +Y G S G S HPY  ES   Y+G  P
Sbjct  869  ASTSATYGGTSGGHSRHPYGHESFD-YSGGYP  899



>ref|XP_011028449.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Populus euphratica]
Length=808

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 177/218 (81%), Gaps = 7/218 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAH---VTTQ  583
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSK +G+ EK H   VTTQ
Sbjct  585  GAARGLAYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKPMGDSEKGHLTHVTTQ  644

Query  582  VKGTMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKD  403
            VKGTMGY+DPEYYMT QLTEKSDVYSFGVV+LE++T + PIEKGKY+VREVK A+D+ K 
Sbjct  645  VKGTMGYMDPEYYMTQQLTEKSDVYSFGVVMLELLTGKRPIEKGKYVVREVKTALDRAKY  704

Query  402  MYDLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            +Y+L  +LD SI    T + L+KFVDVAL+C+E+  + RPTM EVVKEIE+I+++ GLNP
Sbjct  705  LYNLGELLDSSIGLDTTLKGLDKFVDVALKCVEENGSDRPTMGEVVKEIENILQLAGLNP  764

Query  222  HADSASTSESYSGVSKG-SEHPY--SDESLSVYTGVLP  118
            +ADSASTS SY   SKG ++HPY  S ++   Y+G  P
Sbjct  765  NADSASTSASYDDASKGNAKHPYIFSKDAFD-YSGGFP  801



>gb|KCW62548.1| hypothetical protein EUGRSUZ_G00040, partial [Eucalyptus grandis]
Length=933

 Score =   296 bits (758),  Expect = 9e-90, Method: Composition-based stats.
 Identities = 138/206 (67%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK +G+ E+ HVTTQVKG
Sbjct  728  GAARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKPMGDGERGHVTTQVKG  787

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVY FGV++LE++TAR PIE+G+YIVREV+  M+K KD+Y+
Sbjct  788  TMGYLDPEYYMTQQLTEKSDVYGFGVLMLELLTARRPIERGRYIVREVRMLMNKDKDLYN  847

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLNP A+
Sbjct  848  LQGILDPAIGLGTSLKGLERFVELAIRCVEESGADRPTMGEVVKEIENIMVFAGLNPKAE  907

Query  213  SASTSESYSGVSKG-SEHPYSDESLS  139
            SA+TS SY   SKG + HPY +E  S
Sbjct  908  SATTSASYEEASKGYAAHPYGNEDFS  933



>ref|XP_010252241.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=955

 Score =   296 bits (758),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 173/212 (82%), Gaps = 3/212 (1%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            +A+GL YLHD  +PPIIHRDIK+NNILLDERLNAKVADFGLSKS+GE EK H+TTQVKGT
Sbjct  739  SARGLAYLHDHADPPIIHRDIKSNNILLDERLNAKVADFGLSKSMGE-EKDHLTTQVKGT  797

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYM+ QLTEKSDVYSFGV+LLE+ITA+ PIE+G+YIVRE++  +DKTKD+Y L
Sbjct  798  MGYLDPEYYMSQQLTEKSDVYSFGVLLLELITAKKPIERGRYIVREMRITIDKTKDLYGL  857

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHADS  211
              +LDP+I    + +  EK+VD+A+ C+E+    RPTM EVVKEIESIM++ GLNP+A+S
Sbjct  858  HELLDPAIGLGTSLKGFEKYVDLAMWCVEESGTDRPTMSEVVKEIESIMQIAGLNPNAES  917

Query  210  ASTSESYSGVSKG-SEHPYSDESLSVYTGVLP  118
            ASTS +Y G S G S HPY  ES   Y+G  P
Sbjct  918  ASTSATYGGTSGGHSRHPYGHESFD-YSGGYP  948



>ref|XP_007148093.1| hypothetical protein PHAVU_006G180200g [Phaseolus vulgaris]
 gb|ESW20087.1| hypothetical protein PHAVU_006G180200g [Phaseolus vulgaris]
Length=930

 Score =   296 bits (757),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 178/216 (82%), Gaps = 3/216 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK++NILLD+ L AKVADFGLSK L + E+ HVTTQVKG
Sbjct  713  GAARGLAYLHELANPPIIHRDIKSSNILLDDHLIAKVADFGLSKLLVDSERGHVTTQVKG  772

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ TAR PIE+GKYIVREV + MD +KD+Y+
Sbjct  773  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELATARRPIEQGKYIVREVMRVMDTSKDLYN  832

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L SI+DP+I  +  P+ LEKFV + +RC+++ AA+RPTM EV KEIESI+E+VGLNP+A+
Sbjct  833  LHSIIDPTILKT-RPKGLEKFVMLGMRCVKEYAAERPTMAEVAKEIESIIELVGLNPNAE  891

Query  213  SASTSESYSGVSK-GSEHPYSDESLSVYTGVLPK*R  109
            SA+TSE+Y    K  ++HPY +E  S Y+G+ P  R
Sbjct  892  SATTSETYEEAGKENAQHPYKEEDFS-YSGIFPSTR  926



>ref|XP_010065206.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 gb|KCW62547.1| hypothetical protein EUGRSUZ_G00039 [Eucalyptus grandis]
Length=958

 Score =   296 bits (757),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 142/216 (66%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLD+ LNA+VADFGLSK L E E+ HVTTQVKG
Sbjct  739  GAARGLAYLHELANPPIIHRDIKSTNILLDDHLNARVADFGLSKLLREGERGHVTTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++TAR PIE+G+YIVREV+  M+K KD+Y+
Sbjct  799  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELLTARTPIEQGRYIVREVRVLMNKDKDLYN  858

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLN  A+
Sbjct  859  LQGILDPAIGLGTSLKGLERFVELAMRCVEESGADRPTMGEVVKEIENIMVFAGLNSKAE  918

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SA+TS SY   SKG + HPY +E  S Y+G  P  R
Sbjct  919  SATTSASYEEASKGYATHPYHNEDFSKYSGGFPPSR  954



>ref|XP_006402242.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
 gb|ESQ43695.1| hypothetical protein EUTSA_v10012589mg [Eutrema salsugineum]
Length=953

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 172/214 (80%), Gaps = 2/214 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  M+K++ +YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKTKMNKSRSLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  855  LQELLDTTIIASSSNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNV  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLPK  115
            DSASTS +Y   SKGS  PY  +S   Y+G  P+
Sbjct  915  DSASTSRTYEEASKGSGDPYGKDSFE-YSGNFPE  947



>ref|XP_010442444.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=953

 Score =   294 bits (753),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T R PIE+GKY+VREVK  M+ ++++YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGRSPIERGKYVVREVKTKMNTSRNLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+A
Sbjct  855  LQELLDTTIIASSGNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNA  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S +Y    KGS  PY  ES   Y+G  P
Sbjct  915  DSATSSRTYEDAIKGSGDPYGSESFQ-YSGNFP  946



>ref|NP_199787.2| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAC41801.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAP21294.1| At5g49760 [Arabidopsis thaliana]
 gb|ACN59388.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95854.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=953

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVVLLE++T R PIE+GKY+VREVK  M+K++ +YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVLLELLTGRSPIERGKYVVREVKTKMNKSRSLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP++
Sbjct  855  LQELLDTTIIASSGNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNS  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S +Y    KGS  PY  ES   Y+G  P
Sbjct  915  DSATSSRTYEDAIKGSGDPYGSESFQ-YSGNFP  946



>ref|XP_011028448.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Populus euphratica]
Length=888

 Score =   293 bits (750),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 177/218 (81%), Gaps = 7/218 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAH---VTTQ  583
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSK +G+ EK H   VTTQ
Sbjct  665  GAARGLAYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKPMGDSEKGHLTHVTTQ  724

Query  582  VKGTMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKD  403
            VKGTMGY+DPEYYMT QLTEKSDVYSFGVV+LE++T + PIEKGKY+VREVK A+D+ K 
Sbjct  725  VKGTMGYMDPEYYMTQQLTEKSDVYSFGVVMLELLTGKRPIEKGKYVVREVKTALDRAKY  784

Query  402  MYDLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            +Y+L  +LD SI    T + L+KFVDVAL+C+E+  + RPTM EVVKEIE+I+++ GLNP
Sbjct  785  LYNLGELLDSSIGLDTTLKGLDKFVDVALKCVEENGSDRPTMGEVVKEIENILQLAGLNP  844

Query  222  HADSASTSESYSGVSKG-SEHPY--SDESLSVYTGVLP  118
            +ADSASTS SY   SKG ++HPY  S ++   Y+G  P
Sbjct  845  NADSASTSASYDDASKGNAKHPYIFSKDAFD-YSGGFP  881



>gb|KFK26616.1| hypothetical protein AALP_AA8G271800 [Arabis alpina]
Length=952

 Score =   294 bits (752),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  734  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  MDK++ +YD
Sbjct  794  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKTKMDKSRGLYD  853

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD S IASS   +  EK+VD+ALRC+E+   +RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  854  LQELLDTSIIASSGNLKGFEKYVDLALRCVEEEGVRRPSMGEVVKEIENIMQLAGLNPNV  913

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSASTS +Y   SK S  PY  +S   Y+G  P
Sbjct  914  DSASTSRTYEDASKESGDPYGKDSFQ-YSGNFP  945



>ref|XP_011028446.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Populus euphratica]
Length=958

 Score =   293 bits (751),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 177/218 (81%), Gaps = 7/218 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAH---VTTQ  583
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSK +G+ EK H   VTTQ
Sbjct  735  GAARGLAYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKPMGDSEKGHLTHVTTQ  794

Query  582  VKGTMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKD  403
            VKGTMGY+DPEYYMT QLTEKSDVYSFGVV+LE++T + PIEKGKY+VREVK A+D+ K 
Sbjct  795  VKGTMGYMDPEYYMTQQLTEKSDVYSFGVVMLELLTGKRPIEKGKYVVREVKTALDRAKY  854

Query  402  MYDLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            +Y+L  +LD SI    T + L+KFVDVAL+C+E+  + RPTM EVVKEIE+I+++ GLNP
Sbjct  855  LYNLGELLDSSIGLDTTLKGLDKFVDVALKCVEENGSDRPTMGEVVKEIENILQLAGLNP  914

Query  222  HADSASTSESYSGVSKG-SEHPY--SDESLSVYTGVLP  118
            +ADSASTS SY   SKG ++HPY  S ++   Y+G  P
Sbjct  915  NADSASTSASYDDASKGNAKHPYIFSKDAFD-YSGGFP  951



>ref|XP_010441071.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=953

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDEDLTAKVADFGLSKLVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T R PIE+GKY+VREVK  M+ ++++YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGRSPIERGKYVVREVKTKMNTSRNLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+A
Sbjct  855  LQELLDTTIIASSGNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNA  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S +Y    KGS  PY  ES   Y+G  P
Sbjct  915  DSATSSRTYEDAIKGSGDPYGSESFQ-YSGNFP  946



>ref|XP_010682075.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=959

 Score =   293 bits (750),  Expect = 1e-88, Method: Composition-based stats.
 Identities = 140/215 (65%), Positives = 177/215 (82%), Gaps = 3/215 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGE-QEKAHVTTQVK  577
            G+A+GLQYLH+L +PPIIHRDIK+ NILLDERL AKVADFGLSK  G+  +K +VTTQVK
Sbjct  740  GSARGLQYLHELADPPIIHRDIKSTNILLDERLIAKVADFGLSKLFGDTDQKGYVTTQVK  799

Query  576  GTMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMY  397
            GTMGYLDPEY+MTNQLTEKSDV+SFGVV+LE++TAR PI+ GKYIV+E+K+AMD+TKD+Y
Sbjct  800  GTMGYLDPEYFMTNQLTEKSDVFSFGVVMLEMVTARKPIQDGKYIVKEIKEAMDRTKDLY  859

Query  396  DLQSILDPSIASSVTPR-SLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
             L  ++DP +  + T    LEKFVD+AL+C++D  A RPTM EVVK+IE I ++ G+NP+
Sbjct  860  SLHRVIDPILLRNTTMLVGLEKFVDLALKCVQDDGANRPTMGEVVKDIEHIAKLAGMNPN  919

Query  219  ADSASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            ADS +TS+SY G S G+  HPYSD SL  Y+G +P
Sbjct  920  ADSTTTSQSYEGASGGNFGHPYSDNSLFQYSGSIP  954



>gb|KCW62546.1| hypothetical protein EUGRSUZ_G00038 [Eucalyptus grandis]
Length=889

 Score =   292 bits (747),  Expect = 1e-88, Method: Composition-based stats.
 Identities = 141/215 (66%), Positives = 170/215 (79%), Gaps = 1/215 (0%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            AA+GL YLH+  NPPIIHRDIK+ NILLD+ LNA+VADFGLSK + E E+ HVTTQVKGT
Sbjct  674  AARGLAYLHEFANPPIIHRDIKSTNILLDDHLNARVADFGLSKPVTEGERGHVTTQVKGT  733

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYMT QLTEKSDVYSFGVV+LE++TAR PIE+G YIVREV+  MDK KD+Y+L
Sbjct  734  MGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTARRPIERGTYIVREVRVVMDKDKDLYNL  793

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHADS  211
            Q ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLNP A+S
Sbjct  794  QGILDPAIGLGTSLKGLERFVELAMRCVEESGADRPTMGEVVKEIENIMVFAGLNPKAES  853

Query  210  ASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            A+TS SY   SKG S  PYS+E  +  +G  P  R
Sbjct  854  ATTSASYEEASKGYSTDPYSNEDFTEDSGGFPPSR  888



>ref|XP_010682076.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=945

 Score =   292 bits (747),  Expect = 3e-88, Method: Composition-based stats.
 Identities = 140/215 (65%), Positives = 177/215 (82%), Gaps = 3/215 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGE-QEKAHVTTQVK  577
            G+A+GLQYLH+L +PPIIHRDIK+ NILLDERL AKVADFGLSK  G+  +K +VTTQVK
Sbjct  726  GSARGLQYLHELADPPIIHRDIKSTNILLDERLIAKVADFGLSKLFGDTDQKGYVTTQVK  785

Query  576  GTMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMY  397
            GTMGYLDPEY+MTNQLTEKSDV+SFGVV+LE++TAR PI+ GKYIV+E+K+AMD+TKD+Y
Sbjct  786  GTMGYLDPEYFMTNQLTEKSDVFSFGVVMLEMVTARKPIQDGKYIVKEIKEAMDRTKDLY  845

Query  396  DLQSILDPSIASSVTPR-SLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
             L  ++DP +  + T    LEKFVD+AL+C++D  A RPTM EVVK+IE I ++ G+NP+
Sbjct  846  SLHRVIDPILLRNTTMLVGLEKFVDLALKCVQDDGANRPTMGEVVKDIEHIAKLAGMNPN  905

Query  219  ADSASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            ADS +TS+SY G S G+  HPYSD SL  Y+G +P
Sbjct  906  ADSTTTSQSYEGASGGNFGHPYSDNSLFQYSGSIP  940



>ref|XP_006385116.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|ERP62913.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=958

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 175/218 (80%), Gaps = 7/218 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAH---VTTQ  583
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSK +G+ E  H   VTTQ
Sbjct  735  GAARGLAYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKPMGDSETGHLTHVTTQ  794

Query  582  VKGTMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKD  403
            VKGTMGY+DPEYYMT QLTEKSDVYSFGVV+LE++T R PIEKGKY+VREVK A+D+ K 
Sbjct  795  VKGTMGYMDPEYYMTQQLTEKSDVYSFGVVMLELLTGRRPIEKGKYVVREVKTALDRAKY  854

Query  402  MYDLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            +Y+L  +LD SI    T + L+KFVDVAL+C+E+  + RPTM EVVKEIE+I+ + GLNP
Sbjct  855  LYNLGELLDSSIGLDTTLKGLDKFVDVALKCVEENGSDRPTMGEVVKEIENILHLAGLNP  914

Query  222  HADSASTSESYSGVSKG-SEHPY--SDESLSVYTGVLP  118
            +ADSASTS SY   SKG ++HPY  S ++   Y+G  P
Sbjct  915  NADSASTSASYDDASKGNAKHPYIFSKDAFD-YSGGFP  951



>ref|XP_010065202.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=975

 Score =   292 bits (747),  Expect = 5e-88, Method: Composition-based stats.
 Identities = 141/215 (66%), Positives = 170/215 (79%), Gaps = 1/215 (0%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            AA+GL YLH+  NPPIIHRDIK+ NILLD+ LNA+VADFGLSK + E E+ HVTTQVKGT
Sbjct  760  AARGLAYLHEFANPPIIHRDIKSTNILLDDHLNARVADFGLSKPVTEGERGHVTTQVKGT  819

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYMT QLTEKSDVYSFGVV+LE++TAR PIE+G YIVREV+  MDK KD+Y+L
Sbjct  820  MGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTARRPIERGTYIVREVRVVMDKDKDLYNL  879

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHADS  211
            Q ILDP+I    + + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLNP A+S
Sbjct  880  QGILDPAIGLGTSLKGLERFVELAMRCVEESGADRPTMGEVVKEIENIMVFAGLNPKAES  939

Query  210  ASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            A+TS SY   SKG S  PYS+E  +  +G  P  R
Sbjct  940  ATTSASYEEASKGYSTDPYSNEDFTEDSGGFPPSR  974



>ref|XP_009134024.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=899

 Score =   290 bits (743),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  681  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKIVGDPEKTHVTTQVKG  740

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  M+K++ +YD
Sbjct  741  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKTKMNKSRSLYD  800

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++D + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  801  LQELMDTTIIASSSNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNV  860

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSAS+S +Y    KGS  PY  +S   Y+G  P
Sbjct  861  DSASSSRTYEEAIKGSGDPYGKDSFE-YSGNFP  892



>ref|XP_006385112.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa]
 gb|ERP62909.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa]
Length=959

 Score =   291 bits (745),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAH---VTTQ  583
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSK +G+ E  H   VTTQ
Sbjct  736  GAARGLAYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKPMGDSETGHLTHVTTQ  795

Query  582  VKGTMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKD  403
            VKGTMGY+DPEYYMT QLTEKSDVYSFGVV+LE++T + PIEKGKY+VREVK A+D+ K 
Sbjct  796  VKGTMGYMDPEYYMTQQLTEKSDVYSFGVVMLELLTGKRPIEKGKYVVREVKTALDRAKY  855

Query  402  MYDLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            +Y+L  +LD SI    T + L+KFVDVAL+C+E+  + RPTM EVVKEIE+I+ + GLNP
Sbjct  856  LYNLGELLDSSIGLDTTLKGLDKFVDVALKCVEENGSDRPTMGEVVKEIENILHLAGLNP  915

Query  222  HADSASTSESYSGVSKG-SEHPY  157
            +ADSASTS SY   SKG ++HPY
Sbjct  916  NADSASTSASYDDASKGNAKHPY  938



>ref|XP_006281792.1| hypothetical protein CARUB_v10027977mg, partial [Capsella rubella]
 gb|EOA14690.1| hypothetical protein CARUB_v10027977mg, partial [Capsella rubella]
Length=952

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  733  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T R PIE+GKY+VREVK  M+ ++++YD
Sbjct  793  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGRSPIERGKYVVREVKTKMNTSRNLYD  852

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+A
Sbjct  853  LQELLDTTIIASSGNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNA  912

Query  216  DSASTSESYSGVSKGSEHPYSDES  145
            DSA++S +Y    KGS  PY  ES
Sbjct  913  DSATSSRTYEDAIKGSGDPYGSES  936



>ref|XP_004485853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cicer arietinum]
Length=934

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 175/216 (81%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK++NILLD  L AKVADFGLSK L + E+ HVTTQVKG
Sbjct  715  GAARGLTYLHELANPPIIHRDIKSSNILLDNHLIAKVADFGLSKLLVDSERGHVTTQVKG  774

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ TAR PIE+GKYIVREV + MD +K++Y+
Sbjct  775  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELATARKPIEQGKYIVREVMRVMDTSKELYN  834

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L SILD SI     P+ LE++V++ALRC+++ AA RPTM E  KEIESI+E+VG+NP+++
Sbjct  835  LHSILDQSILIGTRPKGLERYVELALRCVKEYAADRPTMAEAAKEIESIIELVGVNPNSE  894

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SAST+E+Y     G ++HPY+++    Y+G+ P  R
Sbjct  895  SASTTETYEEAGVGDAKHPYANDDEFEYSGIFPSIR  930



>ref|XP_009416032.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 174/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPI+HRDIK++NILLDE LNAKV+DFGLSK LG+++K HV+TQVKG
Sbjct  747  GAARGLAYLHELASPPIVHRDIKSSNILLDENLNAKVSDFGLSKPLGDEKKGHVSTQVKG  806

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE++TA+ PIE G+Y+VREV+  MDK+KD+Y 
Sbjct  807  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLELVTAKKPIEHGRYVVREVRCTMDKSKDLYG  866

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ++DP++         EKFV++A++C+E+    RPTM EVVKEIE+IM++ G+NP+AD
Sbjct  867  LHELIDPALGLGNRLGGFEKFVELAMKCVEESGIDRPTMGEVVKEIENIMKLAGMNPNAD  926

Query  213  SASTSESYSGVSKGS-EHPYSDESLSVYTGVLPK*R  109
            SAS S SY+G S+ S  HPYS+E    Y+G  P  R
Sbjct  927  SASNSMSYAGASRSSVRHPYSNEPFD-YSGTAPSSR  961



>emb|CDX83184.1| BnaA03g23220D [Brassica napus]
Length=953

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKIVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  M+K++ +YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKTKMNKSRSLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++D + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  855  LQELMDTTIIASSSNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNV  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSAS+S +Y    KGS  PY  +S   Y+G  P
Sbjct  915  DSASSSRTYEEAIKGSGDPYGKDSFE-YSGNFP  946



>ref|XP_009134023.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=953

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKIVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  M+K++ +YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKTKMNKSRSLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++D + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  855  LQELMDTTIIASSSNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNV  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSAS+S +Y    KGS  PY  +S   Y+G  P
Sbjct  915  DSASSSRTYEEAIKGSGDPYGKDSFE-YSGNFP  946



>emb|CDY21455.1| BnaC03g27420D [Brassica napus]
Length=953

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKIVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  M+K++ +YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKTKMNKSRSLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++D + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  855  LQELMDTTIIASSSNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNV  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSAS+S +Y    KGS  PY  +S   Y+G  P
Sbjct  915  DSASSSRTYEEAIKGSGDPYGKDSFE-YSGNFP  946



>ref|XP_011464973.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011464974.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=955

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 172/212 (81%), Gaps = 2/212 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+L +PPIIHRDIK+ N+LLD  LNAKVADFGLSKS+G   + HV+TQVKG
Sbjct  739  GTARGLAYLHELCDPPIIHRDIKSTNVLLDNHLNAKVADFGLSKSMGNSGRDHVSTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMT +LTEKSDVY FGV++LE++TAR PIE+GKYIVREV+ AMDKTK++Y+
Sbjct  799  TMGYMDPEYYMTQRLTEKSDVYGFGVLMLELLTARRPIEQGKYIVREVRTAMDKTKELYN  858

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ILD +I    T + LE+FVD+A+ C+E+  A RPTM EVVKEIE+IM++ GLNP+A+
Sbjct  859  LHDILDLAIGLGTTLKGLERFVDLAMTCVEEEGANRPTMSEVVKEIENIMQLAGLNPNAE  918

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SASTS SY   +  ++HPYSDE+   Y+G  P
Sbjct  919  SASTSASYEDQAS-TKHPYSDEAFD-YSGGFP  948



>ref|XP_003593682.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
Length=909

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 176/216 (81%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPIIHRDIK++NILLD  L AKVADFGLSK L + E+ HVTTQVKG
Sbjct  690  GAARGLTYLHELADPPIIHRDIKSSNILLDNHLIAKVADFGLSKLLVDSERGHVTTQVKG  749

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ T+R PIE+GKYIVREV + MD +K++Y+
Sbjct  750  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELATSRKPIEQGKYIVREVMRVMDTSKELYN  809

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L SILD S+     P+ LE++V++ALRC+++ AA+RP+M EV KEIESI+E+VG+NP+++
Sbjct  810  LHSILDQSLLKGTRPKGLERYVELALRCVKEYAAERPSMAEVAKEIESIIELVGVNPNSE  869

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SAST+E+Y     G  +HPY++E    Y+G+ P  R
Sbjct  870  SASTTENYEEAGAGDGKHPYANEEEFEYSGIFPTIR  905



>emb|CDY61244.1| BnaCnng37500D [Brassica napus]
Length=953

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 169/213 (79%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIEKGKY+VREVK  M+K++ +YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIEKGKYVVREVKMKMNKSRSLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  EK+VD+ALRC+E+    RP M +VVKEIE+IM++ GLNP+ 
Sbjct  855  LQELLDTTIIASSSNLKGFEKYVDLALRCVEEEGVNRPPMGDVVKEIENIMQLAGLNPNG  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSASTS +Y    KGS  PY  +S   Y+G  P
Sbjct  915  DSASTSATYEDEIKGSGDPYGKDSFQ-YSGNFP  946



>emb|CDY21452.1| BnaC03g27450D [Brassica napus]
Length=953

 Score =   290 bits (741),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 170/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKIVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  M+K++ +YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKTKMNKSRSLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++D + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  855  LQELMDTTIIASSSNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNV  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSAS+S +Y    KGS  PY  +S   Y+G  P
Sbjct  915  DSASSSRTYEEAIKGSGDPYGKDSFE-YSGNFP  946



>ref|XP_010088710.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXB36891.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=1000

 Score =   290 bits (742),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 169/214 (79%), Gaps = 2/214 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+L +PPIIHRDIK+ N+LLD+RLNAKVADFGLSK +G+ EK HV+TQVKG
Sbjct  788  GTARGLAYLHELADPPIIHRDIKSTNVLLDDRLNAKVADFGLSKLMGDGEKDHVSTQVKG  847

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT  L EKSDVYSFGV++LE+ITAR PIE+GKYIVREV+  MDKTKD+Y+
Sbjct  848  TMGYLDPEYYMTQHLNEKSDVYSFGVLMLELITARKPIEQGKYIVREVRMTMDKTKDLYN  907

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L + LDP+I         E+FVD+A+RC+ED    RP+M EVVKEIE+IM+  GLNP+AD
Sbjct  908  LDTFLDPAIGLGTRLIGFERFVDLAMRCVEDARVDRPSMSEVVKEIEAIMQHAGLNPNAD  967

Query  213  SASTSESYSGVSKGS-EHPYSDESLSVYTGVLPK  115
            SAS S SY   +K +  HPYS +S   ++G  P+
Sbjct  968  SASISASYEEANKQAPNHPYSQDSFD-HSGSFPQ  1000



>ref|XP_003593681.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
 gb|AES63932.1| LRR receptor-like kinase [Medicago truncatula]
Length=934

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 176/216 (81%), Gaps = 1/216 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPIIHRDIK++NILLD  L AKVADFGLSK L + E+ HVTTQVKG
Sbjct  715  GAARGLTYLHELADPPIIHRDIKSSNILLDNHLIAKVADFGLSKLLVDSERGHVTTQVKG  774

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ T+R PIE+GKYIVREV + MD +K++Y+
Sbjct  775  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELATSRKPIEQGKYIVREVMRVMDTSKELYN  834

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L SILD S+     P+ LE++V++ALRC+++ AA+RP+M EV KEIESI+E+VG+NP+++
Sbjct  835  LHSILDQSLLKGTRPKGLERYVELALRCVKEYAAERPSMAEVAKEIESIIELVGVNPNSE  894

Query  213  SASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            SAST+E+Y     G  +HPY++E    Y+G+ P  R
Sbjct  895  SASTTENYEEAGAGDGKHPYANEEEFEYSGIFPTIR  930



>ref|XP_010682078.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=882

 Score =   287 bits (735),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GLQYLH L +PPIIHRDIK+NNILLDE LNAKVADFGLS+  G+ +K +VTTQVKG
Sbjct  662  GSARGLQYLHQLADPPIIHRDIKSNNILLDECLNAKVADFGLSRLFGDTDKGYVTTQVKG  721

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MTNQLTEKSD++SFGVVLLEI+TAR PI+ GK+IV+++K+ +D TKD+Y+
Sbjct  722  TMGYLDPEYFMTNQLTEKSDIFSFGVVLLEILTARKPIQLGKFIVKQIKETVDTTKDLYN  781

Query  393  LQSILDPSIASSVTPR-SLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  ++DP + SS T     EKFVD+ L+C+E+  A RP+  EVVKE+E+IM++ G+NP A
Sbjct  782  LSEMMDPMLLSSSTMLVGFEKFVDLTLKCVEEFGADRPSTGEVVKELENIMKLAGMNPDA  841

Query  216  DSASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            +S +TS++Y G S+ S  HPYSDESL  Y   +P
Sbjct  842  ESTTTSQTYDGSSRQSFGHPYSDESLVQYNEGIP  875



>ref|XP_010682077.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=954

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GLQYLH L +PPIIHRDIK+NNILLDE LNAKVADFGLS+  G+ +K +VTTQVKG
Sbjct  734  GSARGLQYLHQLADPPIIHRDIKSNNILLDECLNAKVADFGLSRLFGDTDKGYVTTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MTNQLTEKSD++SFGVVLLEI+TAR PI+ GK+IV+++K+ +D TKD+Y+
Sbjct  794  TMGYLDPEYFMTNQLTEKSDIFSFGVVLLEILTARKPIQLGKFIVKQIKETVDTTKDLYN  853

Query  393  LQSILDPSIASSVTPR-SLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  ++DP + SS T     EKFVD+ L+C+E+  A RP+  EVVKE+E+IM++ G+NP A
Sbjct  854  LSEMMDPMLLSSSTMLVGFEKFVDLTLKCVEEFGADRPSTGEVVKELENIMKLAGMNPDA  913

Query  216  DSASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            +S +TS++Y G S+ S  HPYSDESL  Y   +P
Sbjct  914  ESTTTSQTYDGSSRQSFGHPYSDESLVQYNEGIP  947



>ref|XP_010252249.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nelumbo nucifera]
Length=915

 Score =   286 bits (731),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+  NP IIHRDIK+ NILLD+RLNAKVADFGLSK +G+ EK H+TTQVKG
Sbjct  700  GSARGLAYLHEHANPSIIHRDIKSTNILLDDRLNAKVADFGLSKLMGDTEKDHITTQVKG  759

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYM+  LTEKSDVYSFGV+LLE+ITA+ P+E+GK+IVREV+ ++DKTKD+Y 
Sbjct  760  TMGYLDPEYYMSQMLTEKSDVYSFGVLLLELITAKKPLERGKHIVREVRISIDKTKDLYG  819

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP+I    + +  EK+VD+A+ C E+  A RP M EVVKEIE+IM+  GLNP+AD
Sbjct  820  LHQLLDPAIGLGTSLKGFEKYVDLAMSCTEETGADRPIMSEVVKEIENIMQFAGLNPNAD  879

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SASTS S+SG    S+HPY++ES   ++G  P
Sbjct  880  SASTSGSHSG--GHSKHPYNNESFD-FSGTCP  908



>ref|XP_010252248.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=959

 Score =   286 bits (732),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+  NP IIHRDIK+ NILLD+RLNAKVADFGLSK +G+ EK H+TTQVKG
Sbjct  744  GSARGLAYLHEHANPSIIHRDIKSTNILLDDRLNAKVADFGLSKLMGDTEKDHITTQVKG  803

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYM+  LTEKSDVYSFGV+LLE+ITA+ P+E+GK+IVREV+ ++DKTKD+Y 
Sbjct  804  TMGYLDPEYYMSQMLTEKSDVYSFGVLLLELITAKKPLERGKHIVREVRISIDKTKDLYG  863

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP+I    + +  EK+VD+A+ C E+  A RP M EVVKEIE+IM+  GLNP+AD
Sbjct  864  LHQLLDPAIGLGTSLKGFEKYVDLAMSCTEETGADRPIMSEVVKEIENIMQFAGLNPNAD  923

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SASTS S+SG    S+HPY++ES   ++G  P
Sbjct  924  SASTSGSHSG--GHSKHPYNNESFD-FSGTCP  952



>ref|XP_010252250.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=955

 Score =   286 bits (731),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+  NPPIIHRDIK+ NILLDERLNAKVADFGLSK + + EK HV+TQVKG
Sbjct  735  GSARGLAYLHEHANPPIIHRDIKSTNILLDERLNAKVADFGLSKLMADNEKDHVSTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYY +  LTEKSDVYSFGV++LE+IT R PIE+G+YIVREV+  MDKTKD+Y 
Sbjct  795  TMGYMDPEYYTSQMLTEKSDVYSFGVLMLELITGRRPIERGRYIVREVRVKMDKTKDLYG  854

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP I    + + LEKFVD+A+RC+E++ + RP M EVVKEIESI+++ GLNP+ D
Sbjct  855  LDELLDPVIVLGTSLKGLEKFVDLAMRCVEELGSDRPMMSEVVKEIESILQLAGLNPNVD  914

Query  213  SASTSESYSGVSKG-SEHPYSD  151
            SASTSESY G S   ++HP SD
Sbjct  915  SASTSESYVGSSGSHTQHPNSD  936



>ref|XP_002864014.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40273.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=953

 Score =   286 bits (731),  Expect = 7e-86, Method: Composition-based stats.
 Identities = 137/212 (65%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            + KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKGT
Sbjct  736  SGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKGT  795

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYMTNQLTEKSDVY FGVV+LE++T R PIE+GKY+VREVK  M+ ++++YDL
Sbjct  796  MGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGRSPIERGKYVVREVKTKMNTSRNLYDL  855

Query  390  QSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            Q +LD + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP++D
Sbjct  856  QELLDTTIIASSGNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNSD  915

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SA++S +Y    KGS  PY  ES   Y+G  P
Sbjct  916  SATSSRTYEDAIKGSGDPYGSESFQ-YSGNFP  946



>dbj|BAA98164.1| receptor protein kinase-like [Arabidopsis thaliana]
Length=941

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  710  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  769

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVVLLE++T R PIE+GKY+VREVK  M+K++ +YD
Sbjct  770  TMGYLDPEYYMTNQLTEKSDVYGFGVVLLELLTGRSPIERGKYVVREVKTKMNKSRSLYD  829

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM++ GLNP++
Sbjct  830  LQELLDTTIIASSGNLKGFEKYVDLALRCVEEEGVNRPSMGEVVKEIENIMQLAGLNPNS  889

Query  216  DSASTSESYSGVSKGSE  166
            DSA++S +Y    KGS+
Sbjct  890  DSATSSRTYEDAIKGSD  906



>ref|XP_010482269.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=955

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLD+ L AKVADFGLSK +G+ EK  VTTQVKG
Sbjct  737  GSGKGLAYLHELADPPIIHRDIKSNNILLDDSLTAKVADFGLSKLVGDPEKIQVTTQVKG  796

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMTNQLTEKSDVY FGVV+LE++T R PIE+GKY+VREVK  M+ + D+YD
Sbjct  797  TLGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGRSPIERGKYVVREVKMKMNTSSDLYD  856

Query  393  LQSILDPSIAS-SVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LDP+I S S   +  EK+VD+ALRC+E+    RPTM EVVKEIE+IM + G+NP+ 
Sbjct  857  LQELLDPTIISTSGNLKGFEKYVDLALRCVEEEGVNRPTMGEVVKEIENIMHLAGVNPNI  916

Query  216  DSASTSESYSGVSKGSEHPYSDESL  142
            DSA++S +Y   SKGS +PY  +S 
Sbjct  917  DSAASSRTYEDASKGSGNPYGKDSF  941



>gb|EYU33237.1| hypothetical protein MIMGU_mgv1a000884mg [Erythranthe guttata]
Length=951

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 170/209 (81%), Gaps = 5/209 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+QYLHD  +PPI+HRDIK+NNILLDERLNAKVADFGLSK + + E+ HVTTQ   
Sbjct  736  GAAKGIQYLHDEADPPIVHRDIKSNNILLDERLNAKVADFGLSKIMHDSERGHVTTQ---  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
              GYLDPEY++T QLTEKSDVYSFG++L E++TARPPIE  K+IVR VK  MD++KDMY+
Sbjct  793  --GYLDPEYFLTRQLTEKSDVYSFGILLFELLTARPPIENHKHIVRLVKSTMDESKDMYN  850

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LDP++A  ++ +S+E  VD+ALRC++D+ + RP+M EVVKEIE+ M + G+NP+A+
Sbjct  851  LQGLLDPAVAFGMSTKSVEMLVDLALRCVQDLGSDRPSMSEVVKEIENTMVIAGINPNAE  910

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            S  +S +Y   +K S+HPYSDE+L  Y+G
Sbjct  911  STPSSSAYEDANKASKHPYSDENLFAYSG  939



>ref|XP_010065203.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=929

 Score =   283 bits (725),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 173/220 (79%), Gaps = 6/220 (3%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            AA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK + E E+ +VTTQVKGT
Sbjct  706  AARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKLVTEGERGYVTTQVKGT  765

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYMT QLTEKSDVYSFGVV+LE++TAR PIE+G+YIVREV+ AMDK KD+Y+L
Sbjct  766  MGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTARRPIEQGRYIVREVRVAMDKDKDLYNL  825

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLN-----  226
            Q ILDP+I   ++ + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLN     
Sbjct  826  QGILDPAIGLGMSLKGLERFVELAMRCVEESVADRPTMGEVVKEIENIMVFAGLNPKAES  885

Query  225  PHADSASTSESYSGVSKG-SEHPYSDESLSVYTGVLPK*R  109
            P A+SA+TS SY   SK  + H YS+E  +  +G  P  R
Sbjct  886  PKAESATTSASYEESSKEYATHLYSNEDFTEDSGGFPPSR  925



>ref|XP_006402241.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
 gb|ESQ43694.1| hypothetical protein EUTSA_v10012584mg [Eutrema salsugineum]
Length=964

 Score =   282 bits (722),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  763  GSGKGLAYLHELADPPIIHRDIKSNNILLDESLTAKVADFGLSKLVGDPEKIHVTTQVKG  822

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI+ GKY+VREVK  MDK++++YD
Sbjct  823  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDGGKYVVREVKTKMDKSRNLYD  882

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD   IASS      EK+VD+AL C+ED   +RP+M +VVKEIE+IM++ GL P+ 
Sbjct  883  LQELLDTKIIASSENLNGFEKYVDLALSCVEDEGVRRPSMGDVVKEIENIMQLAGLKPNL  942

Query  216  DSASTSESYSGVSKGSEHPY  157
            DSA++S +Y  VSKGS  PY
Sbjct  943  DSATSSRTYEEVSKGSSDPY  962



>ref|XP_009118911.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=940

 Score =   282 bits (721),  Expect = 2e-84, Method: Composition-based stats.
 Identities = 134/205 (65%), Positives = 163/205 (80%), Gaps = 1/205 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKVADFGLSKLVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV  LE++T + PIEKGKY+VREVK  M+K++ +YD
Sbjct  795  TMGYLDPEYYMTNQLTEKSDVYGFGVATLELLTGKSPIEKGKYVVREVKMKMNKSRSLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + I SS   +  EK+VD+ALRC+E+    RP+M +VVKEIE+IM++ GLNP+ 
Sbjct  855  LQELLDTTIITSSSNLKGFEKYVDLALRCVEEEGVNRPSMGDVVKEIENIMQLAGLNPNG  914

Query  216  DSASTSESYSGVSKGSEHPYSDESL  142
            DSASTS +Y    KGS  PY  +S 
Sbjct  915  DSASTSATYEDAIKGSGDPYGKDSF  939



>ref|XP_006279961.1| hypothetical protein CARUB_v10025827mg [Capsella rubella]
 gb|EOA12859.1| hypothetical protein CARUB_v10025827mg [Capsella rubella]
Length=953

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 166/210 (79%), Gaps = 2/210 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AK+ADFGLSK +G+ EK HVTTQVKG
Sbjct  735  GSGKGLAYLHELADPPIIHRDIKSNNILLDENLTAKIADFGLSKLVGDPEKTHVTTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYY TNQLTEKSDVY FGVV+ E++T R PIE+GKY+VREVK  M+ ++ +YD
Sbjct  795  TMGYLDPEYYTTNQLTEKSDVYGFGVVMFELLTGRSPIERGKYVVREVKMKMNTSRTLYD  854

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IASS   +  EK+VD+ALRC+E+    RP+M EVVKEIE+IM + GLNP+A
Sbjct  855  LQELLDTTIIASSGNLKGFEKYVDLALRCVEEEGFNRPSMSEVVKEIENIMLLAGLNPNA  914

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTG  127
            DSA++S +Y    +GS  PY  E+   Y+G
Sbjct  915  DSATSSRTYEDAIRGSGDPYGSETFR-YSG  943



>ref|XP_011464972.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=962

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+L +PPIIHRDIK+ N+LLD RL+AKVADFGLSKS+G+  + HV+TQVKG
Sbjct  744  GTARGLAYLHELCHPPIIHRDIKSTNVLLDNRLSAKVADFGLSKSMGDSGRDHVSTQVKG  803

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYMT +LTEKSDVY FGV++LEI+TAR PIE+GKYIVREV+ AMD+TK++Y+
Sbjct  804  TMGYMDPEYYMTQRLTEKSDVYGFGVLMLEILTARKPIEQGKYIVREVRMAMDRTKELYN  863

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ILD +I    T   LE+FVD+A+ C+++    RPTM EVVKEIE IM++ GLNP+A+
Sbjct  864  LHVILDSAIGLRTTLVGLERFVDLAMACVQEEGVNRPTMSEVVKEIEYIMQLAGLNPNAE  923

Query  213  SASTSESYSGVSKGSEHPYSD-ESLSVYTGVLP  118
            SASTS SY   ++   HPYS+ E+   Y+GV P
Sbjct  924  SASTSSSYEDPAR-VRHPYSNIEAAFDYSGVFP  955



>emb|CDY12940.1| BnaA09g13340D [Brassica napus]
Length=931

 Score =   281 bits (718),  Expect = 4e-84, Method: Composition-based stats.
 Identities = 133/203 (66%), Positives = 166/203 (82%), Gaps = 1/203 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+++GL YLH+L +PPIIHRDIK+NNILLDE LNAKVADFGLSK +G+ EK HVTTQVKG
Sbjct  727  GSSRGLAYLHELADPPIIHRDIKSNNILLDESLNAKVADFGLSKLVGDPEKNHVTTQVKG  786

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE GKY+VREVK  MDK+ ++YD
Sbjct  787  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIEGGKYVVREVKAKMDKSMNLYD  846

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++D + IA+S      EK+VD+ALRC++    +RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  847  LQELVDTTIIANSGNLNGFEKYVDLALRCVDGEGVKRPSMGEVVKEIENIMQLAGLNPNI  906

Query  216  DSASTSESYSGVSKGSEHPYSDE  148
            DSA+ S +Y   SKGS  PY +E
Sbjct  907  DSATNSRTYEEASKGSGDPYGNE  929



>ref|XP_006279556.1| hypothetical protein CARUB_v10025735mg [Capsella rubella]
 gb|EOA12454.1| hypothetical protein CARUB_v10025735mg [Capsella rubella]
Length=1844

 Score =   286 bits (731),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 171/213 (80%), Gaps = 2/213 (1%)
 Frame = -1

Query  753   GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
             G+ KGL YLH+L +PPIIHRDIK+NNILLDE L AKVADFGLSK +G+ EK HVTTQVKG
Sbjct  1626  GSGKGLAYLHELADPPIIHRDIKSNNILLDETLTAKVADFGLSKLVGDPEKVHVTTQVKG  1685

Query  573   TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
             T+GYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE+GKY+VREVK  M+ + D+YD
Sbjct  1686  TLGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIERGKYVVREVKMKMNTSSDLYD  1745

Query  393   LQSILDPSIAS-SVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             LQ +LD +I S S   +  EK+VD+ALRC+E+   +RPTM EVVKEIE+IM + G+NP+ 
Sbjct  1746  LQELLDETIISTSGNLKGFEKYVDLALRCVEEEGLKRPTMGEVVKEIENIMHLAGVNPNI  1805

Query  216   DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
             DSA++S +Y   SKGS +PY ++S + Y+   P
Sbjct  1806  DSAASSRTYEDSSKGSGNPYGNDSFA-YSADFP  1837


 Score =   270 bits (689),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILLDE L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  734  GSGKGLAYLHELADPPIIHRDVKSNNILLDENLTAKVADFGLSKLVGDPEKAHVTTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G Y+V+EVK+ MDKT+ +YD
Sbjct  794  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKTRALYD  853

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IA+S   +  EK+VDVALRC+E     RP+M EVV+EIESI+ + GLNP+A
Sbjct  854  LQELLDTTIIANSGNIKGFEKYVDVALRCVEAEGVDRPSMSEVVQEIESILRLAGLNPNA  913

Query  216  DSASTSES  193
            +SA+  E+
Sbjct  914  ESATFDEA  921



>ref|XP_010252434.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=648

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 164/211 (78%), Gaps = 2/211 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+G+ YLH+ VNPPIIHRDIK+ NILLD  LNAKV+DFGLSK + + EK HV+TQVKG
Sbjct  428  GSARGVAYLHEHVNPPIIHRDIKSTNILLDNHLNAKVSDFGLSKLMDDDEKGHVSTQVKG  487

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSD YSFGV++LE+ITAR PIE GKYIVREVK  MDKTKD+Y 
Sbjct  488  TMGYLDPEYYMTQQLTEKSDAYSFGVIMLELITARKPIEHGKYIVREVKAIMDKTKDLYG  547

Query  393  LQSILDPSIA-SSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP +   S + +  E+FVD+A+RCL++  A RP M EVVKEIE IM+  GLN   
Sbjct  548  LHELLDPVLGLISTSLKGFEEFVDLAMRCLQESTADRPLMSEVVKEIEGIMKFSGLNTTD  607

Query  216  DSASTSESYSGVSK-GSEHPYSDESLSVYTG  127
            D ASTSESY   S+  S +PYS+E++   +G
Sbjct  608  DFASTSESYGETSREHSGNPYSNETIEYSSG  638



>ref|XP_002864015.1| hypothetical protein ARALYDRAFT_495037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40274.1| hypothetical protein ARALYDRAFT_495037 [Arabidopsis lyrata subsp. 
lyrata]
Length=944

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 169/213 (79%), Gaps = 9/213 (4%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILLDE L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  736  GSGKGLAYLHELADPPIIHRDVKSNNILLDEDLTAKVADFGLSKLVGDPEKAHVTTQVKG  795

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G Y+V+EVK+ MDK++++YD
Sbjct  796  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKSRNLYD  855

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IA+S   +  EK+VDVALRC+E     RPTM EVV+EIES++ +VGLNP+A
Sbjct  856  LQELLDTTIIANSGNLKGFEKYVDVALRCVEPEGVDRPTMSEVVQEIESVLRLVGLNPNA  915

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA+  E+       S  PY  +S   YTG+ P
Sbjct  916  DSATYEEA-------SGDPYGRDSFE-YTGIFP  940



>ref|XP_008802221.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=967

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 168/214 (79%), Gaps = 3/214 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L +PPI+HRDIK+ NILLD+ LNAKV+DFGLSK LG+  K +VTTQVKG
Sbjct  748  GAARGLAYLHELADPPIVHRDIKSTNILLDDHLNAKVSDFGLSKPLGDDAKGYVTTQVKG  807

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLEIITA+ P+E+G+YIVRE++  MDK KD+Y 
Sbjct  808  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEIITAKKPLERGRYIVRELRVMMDKRKDLYG  867

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP+I    T    EK+VD+A++C+E+ +  RP M EVVKEIE+IM++ G+NP+AD
Sbjct  868  LHELLDPAIGLGTTLGGFEKYVDLAIKCVEESSNDRPAMSEVVKEIENIMQLAGINPNAD  927

Query  213  SASTSESYSGVSKGS--EHPYSDESLSVYTGVLP  118
            SAS S S  G S+ S   HPY +E    Y+G  P
Sbjct  928  SASASLSCIG-SRSSPLHHPYGNEGCFDYSGGQP  960



>gb|KCW62545.1| hypothetical protein EUGRSUZ_G00037, partial [Eucalyptus grandis]
Length=937

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 162/197 (82%), Gaps = 5/197 (3%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            AA+GL YLH+L NPPIIHRDIK+ NILLD+ LNAKVADFGLSK + E E+ +VTTQVKGT
Sbjct  741  AARGLAYLHELANPPIIHRDIKSTNILLDDHLNAKVADFGLSKLVTEGERGYVTTQVKGT  800

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYMT QLTEKSDVYSFGVV+LE++TAR PIE+G+YIVREV+ AMDK KD+Y+L
Sbjct  801  MGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTARRPIEQGRYIVREVRVAMDKDKDLYNL  860

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLN-----  226
            Q ILDP+I   ++ + LE+FV++A+RC+E+  A RPTM EVVKEIE+IM   GLN     
Sbjct  861  QGILDPAIGLGMSLKGLERFVELAMRCVEESVADRPTMGEVVKEIENIMVFAGLNPKAES  920

Query  225  PHADSASTSESYSGVSK  175
            P A+SA+TS SY   SK
Sbjct  921  PKAESATTSASYEESSK  937



>emb|CDY19539.1| BnaC09g13640D [Brassica napus]
Length=938

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G++KGL YLH+L +PPIIHRDIK+NNILLDE LNAKVADFGLSK +G+ EK HVTTQVKG
Sbjct  738  GSSKGLAYLHELADPPIIHRDIKSNNILLDENLNAKVADFGLSKLVGDPEKNHVTTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI  GKY+V+EVK  MDK++++YD
Sbjct  798  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIVGGKYVVKEVKAKMDKSRNLYD  857

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++  + IA+S      EK+VD+ALRC++    +RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  858  LQELVATTIIANSENLNGFEKYVDLALRCVDGEGVKRPSMGEVVKEIENIMQLAGLNPYI  917

Query  216  DSASTSESYSGVSKGSEHPY  157
            DSA+ S +Y   SKGS  PY
Sbjct  918  DSATNSRTYQEASKGSGDPY  937



>emb|CAN68980.1| hypothetical protein VITISV_004150 [Vitis vinifera]
Length=798

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRDIK+NNILLDE LNAKV DFGL K L + EK HVTTQVKG
Sbjct  581  GSARGLAYLHELADPPIIHRDIKSNNILLDEHLNAKVGDFGLCKLLADSEKGHVTTQVKG  640

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYM+ QLTEKSDVYSFGV++LE+I+AR PIE+GKYIV+EVK AMDKTKD+Y+
Sbjct  641  TMGYMDPEYYMSQQLTEKSDVYSFGVLMLELISARKPIERGKYIVKEVKIAMDKTKDLYN  700

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LDP++ +++      KFVD+ALRC+E+  A RPTM EVVKEIE+IM++ GLNP  +
Sbjct  701  LQGLLDPTLGTTLG--GFNKFVDLALRCVEESGADRPTMGEVVKEIENIMQLAGLNPITE  758

Query  213  SASTSESYSGVSKG-SEHPYSDES  145
            S+S S SY   S G S HPY   S
Sbjct  759  SSSASASYEESSTGTSSHPYGSNS  782



>ref|XP_006470792.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Citrus sinensis]
Length=955

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 171/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSKS+ + EK H+TTQVKG
Sbjct  734  GAARGLSYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKSMSDSEKDHITTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++T R PIE+GKYIVRE++ AMDK K++Y+
Sbjct  794  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELLTGRRPIERGKYIVREIRTAMDKKKELYN  853

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ++DP+I  S T +  EK+VD+AL+C+++    RPTM EVVK+IE+I++  GLNP+A+
Sbjct  854  LYELIDPTIGLSTTLKGFEKYVDLALKCVQESGDDRPTMSEVVKDIENILQQAGLNPNAE  913

Query  213  SASTSESYSGVSKGS-EHPYSDE  148
            SAS+S SY   SKG+  HPY +E
Sbjct  914  SASSSASYEDASKGNFHHPYCNE  936



>ref|XP_010252247.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Nelumbo nucifera]
Length=851

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 4/207 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+G+ YLH+ VNPPIIHRDIK+ NILLD  LNAKV+DFGLSK + + EK HV+TQVKG
Sbjct  631  GSARGVAYLHEHVNPPIIHRDIKSTNILLDNHLNAKVSDFGLSKLMDDDEKGHVSTQVKG  690

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ITAR PIE GKYIVREVK  MDKTKD+Y 
Sbjct  691  TMGYLDPEYYMTQQLTEKSDVYSFGVIMLELITARKPIEHGKYIVREVKAIMDKTKDLYG  750

Query  393  LQSILDPSIAS-SVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + S S + +  E+FVD+A+RCL++  A RP M EVVKEIE IM+  GLN   
Sbjct  751  LHELLDPVLGSISTSLKGFEEFVDLAMRCLQESTADRPLMSEVVKEIEGIMKFSGLNTTD  810

Query  216  DSASTSESYSGVSKG--SEHPYSDESL  142
            D ASTSESY G + G  S +P+S E++
Sbjct  811  DFASTSESY-GETNGEHSGNPFSTETI  836



>ref|XP_010252245.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Nelumbo nucifera]
Length=859

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 4/207 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+G+ YLH+ VNPPIIHRDIK+ NILLD  LNAKV+DFGLSK + + EK HV+TQVKG
Sbjct  639  GSARGVAYLHEHVNPPIIHRDIKSTNILLDNHLNAKVSDFGLSKLMDDDEKGHVSTQVKG  698

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ITAR PIE GKYIVREVK  MDKTKD+Y 
Sbjct  699  TMGYLDPEYYMTQQLTEKSDVYSFGVIMLELITARKPIEHGKYIVREVKAIMDKTKDLYG  758

Query  393  LQSILDPSIAS-SVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + S S + +  E+FVD+A+RCL++  A RP M EVVKEIE IM+  GLN   
Sbjct  759  LHELLDPVLGSISTSLKGFEEFVDLAMRCLQESTADRPLMSEVVKEIEGIMKFSGLNTTD  818

Query  216  DSASTSESYSGVSKG--SEHPYSDESL  142
            D ASTSESY G + G  S +P+S E++
Sbjct  819  DFASTSESY-GETNGEHSGNPFSTETI  844



>emb|CAN68981.1| hypothetical protein VITISV_004151 [Vitis vinifera]
Length=763

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 165/203 (81%), Gaps = 3/203 (1%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            +A+GL YLH+L  PPIIHRDIK+NNILLDERLNAKVADFGL K L + EK HVTTQVKGT
Sbjct  547  SARGLAYLHELAEPPIIHRDIKSNNILLDERLNAKVADFGLCKLLADSEKGHVTTQVKGT  606

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYM+ QLTEKSDVYSFGV++LE+I+AR PIE+GKYIV+EVK  MDKTKD+Y+L
Sbjct  607  MGYLDPEYYMSQQLTEKSDVYSFGVLMLELISARKPIERGKYIVKEVKIEMDKTKDLYNL  666

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHADS  211
            Q +LDP++ +++      KFVD+ALRC+E+  A RP M EVVKEIE+IM++ GLNP  +S
Sbjct  667  QGLLDPTLGTTLG--GFNKFVDLALRCVEESGADRPRMGEVVKEIENIMQLAGLNPIIES  724

Query  210  ASTSESYSGVSKG-SEHPYSDES  145
            +S S SY   S G S HPY + S
Sbjct  725  SSASASYEESSTGTSSHPYGNNS  747



>ref|XP_010441081.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=952

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 166/213 (78%), Gaps = 7/213 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILLDE L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  738  GSGKGLAYLHELADPPIIHRDVKSNNILLDENLTAKVADFGLSKLVGDPEKAHVTTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G YIV+EVK+ M+K++ +YD
Sbjct  798  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYIVKEVKKKMNKSRTLYD  857

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IA+S      EK+VDVALRC+E     RP+M EVV+EIESI+ + GLNP+A
Sbjct  858  LQELLDTTIIANSGNIEGFEKYVDVALRCVEAEGVDRPSMSEVVQEIESIVRLAGLNPNA  917

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA+  E     + G   PY  +S   YTG+ P
Sbjct  918  DSATYEE-----ASGDHDPYGRDSFE-YTGIFP  944



>ref|XP_010482271.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
Length=954

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 167/213 (78%), Gaps = 7/213 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILLDE L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  739  GSGKGLAYLHELADPPIIHRDVKSNNILLDEHLTAKVADFGLSKLIGDPEKAHVTTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G Y+V+EVK+ MDK++ +YD
Sbjct  799  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKSRTLYD  858

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IA+S      EK+VDVALRC+E     RP+M EVV+EIESI+ + GLNP+A
Sbjct  859  LQELLDTTIIANSGNIEGFEKYVDVALRCVEAEGVDRPSMSEVVQEIESIVRLAGLNPNA  918

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA    +Y  VS G   PY  +S   YTG+ P
Sbjct  919  DSA----TYEEVS-GDHDPYGRDSFE-YTGIFP  945



>ref|XP_010252244.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Nelumbo nucifera]
Length=880

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 4/207 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+G+ YLH+ VNPPIIHRDIK+ NILLD  LNAKV+DFGLSK + + EK HV+TQVKG
Sbjct  660  GSARGVAYLHEHVNPPIIHRDIKSTNILLDNHLNAKVSDFGLSKLMDDDEKGHVSTQVKG  719

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ITAR PIE GKYIVREVK  MDKTKD+Y 
Sbjct  720  TMGYLDPEYYMTQQLTEKSDVYSFGVIMLELITARKPIEHGKYIVREVKAIMDKTKDLYG  779

Query  393  LQSILDPSIAS-SVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + S S + +  E+FVD+A+RCL++  A RP M EVVKEIE IM+  GLN   
Sbjct  780  LHELLDPVLGSISTSLKGFEEFVDLAMRCLQESTADRPLMSEVVKEIEGIMKFSGLNTTD  839

Query  216  DSASTSESYSGVSKG--SEHPYSDESL  142
            D ASTSESY G + G  S +P+S E++
Sbjct  840  DFASTSESY-GETNGEHSGNPFSTETI  865



>ref|XP_010482272.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=953

 Score =   276 bits (706),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 167/213 (78%), Gaps = 7/213 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILLDE L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  739  GSGKGLAYLHELADPPIIHRDVKSNNILLDEHLTAKVADFGLSKLIGDPEKAHVTTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G Y+V+EVK+ MDK++ +YD
Sbjct  799  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKSRTLYD  858

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IA+S      EK+VDVALRC+E     RP+M EVV+EIESI+ + GLNP+A
Sbjct  859  LQELLDTTIIANSGNIEGFEKYVDVALRCVEAEGVDRPSMSEVVQEIESIVRLAGLNPNA  918

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA    +Y  VS G   PY  +S   YTG+ P
Sbjct  919  DSA----TYEEVS-GDHDPYGRDSFE-YTGIFP  945



>gb|KDO40687.1| hypothetical protein CISIN_1g002189mg [Citrus sinensis]
Length=882

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSKS+ + EK H+TTQVKG
Sbjct  661  GAARGLSYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKSMSDSEKDHITTQVKG  720

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++T R PIE+GKYIVRE++  MDK K++Y+
Sbjct  721  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELLTGRRPIERGKYIVREIRTVMDKKKELYN  780

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ++DP+I  S T +  EK+VD+AL+C+++    RPTM EVVK+IE+I++  GLNP+A+
Sbjct  781  LYELIDPTIGLSTTLKGFEKYVDLALKCVQESGDDRPTMSEVVKDIENILQQAGLNPNAE  840

Query  213  SASTSESYSGVSKGS-EHPYSDE  148
            SAS+S SY   SKG+  HPY +E
Sbjct  841  SASSSASYEDASKGNFHHPYCNE  863



>ref|XP_010252243.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Nelumbo nucifera]
Length=905

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 164/207 (79%), Gaps = 4/207 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+G+ YLH+ VNPPIIHRDIK+ NILLD  LNAKV+DFGLSK + + EK HV+TQVKG
Sbjct  685  GSARGVAYLHEHVNPPIIHRDIKSTNILLDNHLNAKVSDFGLSKLMDDDEKGHVSTQVKG  744

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ITAR PIE GKYIVREVK  MDKTKD+Y 
Sbjct  745  TMGYLDPEYYMTQQLTEKSDVYSFGVIMLELITARKPIEHGKYIVREVKAIMDKTKDLYG  804

Query  393  LQSILDPSIAS-SVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + S S + +  E+FVD+A+RCL++  A RP M EVVKEIE IM+  GLN   
Sbjct  805  LHELLDPVLGSISTSLKGFEEFVDLAMRCLQESTADRPLMSEVVKEIEGIMKFSGLNTTD  864

Query  216  DSASTSESYSGVSKG--SEHPYSDESL  142
            D ASTSESY G + G  S +P+S E++
Sbjct  865  DFASTSESY-GETNGEHSGNPFSTETI  890



>ref|XP_010657900.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Vitis vinifera]
Length=980

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRDIK+NNILLDE LNAKV DFGL K L + EK HVTTQVKG
Sbjct  763  GSARGLAYLHELADPPIIHRDIKSNNILLDEHLNAKVGDFGLCKLLADSEKGHVTTQVKG  822

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYM+ QLTEKSDVYSFGV++LE+I+AR PIE+GKYIV+EVK AMDKTKD+Y+
Sbjct  823  TMGYMDPEYYMSQQLTEKSDVYSFGVLMLELISARKPIERGKYIVKEVKIAMDKTKDLYN  882

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LDP++ +++      KFVD+ALRC+E+  A RPTM EVVKEIE+IM++ GLNP  +
Sbjct  883  LQGLLDPTLGTTLG--GFNKFVDLALRCVEESGADRPTMGEVVKEIENIMQLAGLNPITE  940

Query  213  SASTSESYSGVSKG-SEHPYSDES  145
            S+S S SY   S G S HPY   S
Sbjct  941  SSSASASYEESSTGTSSHPYGSNS  964



>ref|NP_199788.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 sp|Q9LT96.1|Y5977_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein 
kinase At5g49770; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA98165.1| receptor protein kinase-like [Arabidopsis thaliana]
 gb|ACN59389.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95855.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=946

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 168/213 (79%), Gaps = 9/213 (4%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILLDE L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  738  GSGKGLAYLHELADPPIIHRDVKSNNILLDEHLTAKVADFGLSKLVGDPEKAHVTTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G Y+V+EVK+ MDK++++YD
Sbjct  798  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKSRNLYD  857

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + I +S   +  EK+VDVAL+C+E     RPTM EVV+E+ESI+ +VGLNP+A
Sbjct  858  LQELLDTTIIQNSGNLKGFEKYVDVALQCVEPEGVNRPTMSEVVQELESILRLVGLNPNA  917

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA+  E+       S  PY  +S   YTGV P
Sbjct  918  DSATYEEA-------SGDPYGRDSFE-YTGVFP  942



>ref|XP_006431373.1| hypothetical protein CICLE_v10000176mg [Citrus clementina]
 gb|ESR44613.1| hypothetical protein CICLE_v10000176mg [Citrus clementina]
Length=955

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSKS+ + EK H+TTQVKG
Sbjct  734  GAARGLSYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKSMSDSEKDHITTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++T R PIE+GKYIVRE++  MDK K++Y+
Sbjct  794  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELLTGRRPIERGKYIVREIRTVMDKKKELYN  853

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ++DP+I  S T +  EK+VD+AL+C+++    RPTM EVVK+IE+I++  GLNP+A+
Sbjct  854  LYELIDPTIGLSTTLKGFEKYVDLALKCVQESGDDRPTMSEVVKDIENILQQAGLNPNAE  913

Query  213  SASTSESYSGVSKGS-EHPYSDE  148
            SAS+S SY   SKG+  HPY +E
Sbjct  914  SASSSASYEDASKGNFHHPYCNE  936



>gb|KDO40686.1| hypothetical protein CISIN_1g002189mg [Citrus sinensis]
Length=955

 Score =   275 bits (704),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK++NILLDERLNAKVADFGLSKS+ + EK H+TTQVKG
Sbjct  734  GAARGLSYLHELANPPIIHRDIKSSNILLDERLNAKVADFGLSKSMSDSEKDHITTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++T R PIE+GKYIVRE++  MDK K++Y+
Sbjct  794  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELLTGRRPIERGKYIVREIRTVMDKKKELYN  853

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ++DP+I  S T +  EK+VD+AL+C+++    RPTM EVVK+IE+I++  GLNP+A+
Sbjct  854  LYELIDPTIGLSTTLKGFEKYVDLALKCVQESGDDRPTMSEVVKDIENILQQAGLNPNAE  913

Query  213  SASTSESYSGVSKGS-EHPYSDE  148
            SAS+S SY   SKG+  HPY +E
Sbjct  914  SASSSASYEDASKGNFHHPYCNE  936



>emb|CDY12939.1| BnaA09g13350D [Brassica napus]
Length=938

 Score =   275 bits (702),  Expect = 9e-82, Method: Composition-based stats.
 Identities = 130/200 (65%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G++KGL YLH+L +PPIIHRDIK+NNILLDE LNAKVADFGLSK +G+ EK HVTTQVKG
Sbjct  738  GSSKGLAYLHELADPPIIHRDIKSNNILLDENLNAKVADFGLSKLVGDPEKNHVTTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEK+DVY FGVV+LE++T + PI  GKY+V+EVK  MDK+K++YD
Sbjct  798  TMGYLDPEYYMTNQLTEKTDVYGFGVVMLELLTGKSPIVGGKYVVKEVKAKMDKSKNLYD  857

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++  + IA+S      EK+VD+ALRC++     RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  858  LQELVATTIIANSENLNGFEKYVDLALRCVDGEGVNRPSMGEVVKEIENIMQLAGLNPYI  917

Query  216  DSASTSESYSGVSKGSEHPY  157
            DSA+ S +Y   SKGS  PY
Sbjct  918  DSATNSRTYEEASKGSGDPY  937



>ref|XP_008802212.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=941

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 163/209 (78%), Gaps = 2/209 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+ L YLH+L NP I+HRDIK+NNILLD  LNAKV+DFGLSK +G+  K ++TTQVKG
Sbjct  725  GAARALTYLHELANPRIVHRDIKSNNILLDHHLNAKVSDFGLSKPIGDDNKGYITTQVKG  784

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE++TAR PIE+G++IVREV+ A+DK+K++  
Sbjct  785  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEMVTARRPIERGRHIVREVRAAIDKSKELCG  844

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ++DP I    TP    +F+D+A++C+E+ +A RP M EVVKEIE+IM + G+NPH  
Sbjct  845  LHELVDPIIGLGTTPAGFGRFIDLAIKCVEESSADRPLMSEVVKEIENIMLLAGMNPHGG  904

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            S STSES+  V++   HPYS  S   Y G
Sbjct  905  STSTSESF--VTRTRGHPYSSNSSFDYNG  931



>ref|XP_009113087.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brassica rapa]
Length=934

 Score =   273 bits (699),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 129/200 (65%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G++KGL YLH+L +PPIIHRDIK+NNILLDE LNAKVADFGLSK +G+ EK HVTTQVKG
Sbjct  734  GSSKGLAYLHELADPPIIHRDIKSNNILLDENLNAKVADFGLSKLVGDPEKNHVTTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEK+DVY FGVV+LE++T + PI  GKY+V+EVK  MDK++++YD
Sbjct  794  TMGYLDPEYYMTNQLTEKTDVYGFGVVMLELLTGKSPIVGGKYVVKEVKAKMDKSRNLYD  853

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ ++  + IA+S      EK+VD+ALRC++    +RP+M EVVKEIE+IM++ GLNP+ 
Sbjct  854  LQELVATTIIANSENLNGFEKYVDLALRCVDGEGVKRPSMGEVVKEIENIMQLAGLNPYI  913

Query  216  DSASTSESYSGVSKGSEHPY  157
            DSA+ S +Y   SKGS  PY
Sbjct  914  DSATNSRTYEEASKGSGDPY  933



>ref|XP_004486417.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cicer arietinum]
Length=953

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 164/202 (81%), Gaps = 1/202 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRD+K+ NILLDERLNAKV+DFGLSK LG+  K ++TTQVKG
Sbjct  742  GAARGLDYLHELANPPIIHRDVKSTNILLDERLNAKVSDFGLSKPLGDGAKGYITTQVKG  801

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++TAR PIE+GKYIV+ VK A+DKTK++Y 
Sbjct  802  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELVTARRPIERGKYIVKVVKNAIDKTKELYG  861

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ILDP I    +  S EKF+D+A++C+E+ ++ RP+M   +KEIE+++ + G NP+A+
Sbjct  862  LTEILDPVIDLRTSLNSFEKFMDLAMQCVEESSSNRPSMNYALKEIENMLLLAGSNPNAE  921

Query  213  SASTSESYSGVSKGSEHPYSDE  148
            SA TS SY+  S  S HPY +E
Sbjct  922  SAPTSSSYNA-SGNSMHPYDNE  942



>gb|AAX92929.1| At5g49760 [Oryza sativa Japonica Group]
 gb|ABA92396.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=897

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 165/212 (78%), Gaps = 3/212 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPI+HRDIK++NILLD  L+ KV+DFGLSK L +  +  VTTQVKG
Sbjct  681  GAAKGIAYLHELADPPIVHRDIKSSNILLDGNLHTKVSDFGLSKPLNQDGRGQVTTQVKG  740

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITAR P+E+G+YIVREVK AMD+TKD+Y 
Sbjct  741  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEVITARKPLERGRYIVREVKGAMDRTKDLYG  800

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP +A + +    E +VD+AL+C+E+    RP+M EVV EIE IM+M G+NP  D
Sbjct  801  LHELLDPMLAPT-SLAGFELYVDLALKCVEEAGMDRPSMSEVVAEIEKIMKMAGVNPKVD  859

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            SAS S SY+  S+   HPYS ES   Y+G +P
Sbjct  860  SASNSMSYN--SRTPRHPYSGESQFDYSGGIP  889



>ref|XP_002269419.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Vitis vinifera]
Length=944

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 165/203 (81%), Gaps = 3/203 (1%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            +A+GL YLH+L  PPIIHRDIK+NNILLDERLNAKVADFGL K L + EK HVTTQVKGT
Sbjct  728  SARGLAYLHELAEPPIIHRDIKSNNILLDERLNAKVADFGLCKLLADSEKGHVTTQVKGT  787

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYM+ QLTEKSDVYSFGV++LE+I+AR PIE+GKYIV+EVK  MDKTKD+Y+L
Sbjct  788  MGYLDPEYYMSQQLTEKSDVYSFGVLMLELISARKPIERGKYIVKEVKIEMDKTKDLYNL  847

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHADS  211
            Q +LDP++ +++      KFVD+ALRC+E+  A RP M EVVKEIE+IM++ GLNP  +S
Sbjct  848  QGLLDPTLGTTLG--GFNKFVDLALRCVEESGADRPRMGEVVKEIENIMQLAGLNPIIES  905

Query  210  ASTSESYSGVSKG-SEHPYSDES  145
            +S S SY   S G S HPY + S
Sbjct  906  SSASASYEESSTGTSSHPYGNNS  928



>gb|EEC67947.1| hypothetical protein OsI_35675 [Oryza sativa Indica Group]
Length=954

 Score =   273 bits (699),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 9/215 (4%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPI+HRDIK++NILLD  L+ KV+DFGLSK L +  +  VTTQVKG
Sbjct  738  GAAKGIAYLHELADPPIVHRDIKSSNILLDGNLHTKVSDFGLSKPLNQDGRGQVTTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITAR P+E+G+YIVREVK AMD+TKD+Y 
Sbjct  798  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEVITARKPLERGRYIVREVKGAMDRTKDLYG  857

Query  393  LQSILDPSIASSVTPRSL---EKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            L  +LDP +A    P SL   E +VD+AL+C+E+    RP+M EVV EIE IM+M G+NP
Sbjct  858  LHELLDPMLA----PTSLAGFELYVDLALKCVEEAGMDRPSMSEVVAEIEKIMKMAGVNP  913

Query  222  HADSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
              DSAS S SY+  S+   HPYS ES   Y+G +P
Sbjct  914  KVDSASNSMSYN--SRTPRHPYSGESQFDYSGGIP  946



>ref|XP_010442445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
 ref|XP_010442446.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=950

 Score =   273 bits (698),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 167/213 (78%), Gaps = 9/213 (4%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILL+E L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  738  GSGKGLAYLHELADPPIIHRDVKSNNILLNEHLTAKVADFGLSKLVGDPEKAHVTTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G Y+V+EVK+ MDK++ +YD
Sbjct  798  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKSRTLYD  857

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IA+S   +  EK+VDVALRC+E     RP+M EVV+E+ESI+ + GLNP+A
Sbjct  858  LQELLDTTIIANSGNIKGFEKYVDVALRCVEAEGFDRPSMSEVVQELESIVRLAGLNPNA  917

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA+  E+       S  PY  +S   YTG+ P
Sbjct  918  DSATYEEA-------SGDPYGRDSFE-YTGIFP  942



>gb|EEE51910.1| hypothetical protein OsJ_33512 [Oryza sativa Japonica Group]
Length=968

 Score =   273 bits (698),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 9/215 (4%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPI+HRDIK++NILLD  L+ KV+DFGLSK L +  +  VTTQVKG
Sbjct  752  GAAKGIAYLHELADPPIVHRDIKSSNILLDGNLHTKVSDFGLSKPLNQDGRGQVTTQVKG  811

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITAR P+E+G+YIVREVK AMD+TKD+Y 
Sbjct  812  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEVITARKPLERGRYIVREVKGAMDRTKDLYG  871

Query  393  LQSILDPSIASSVTPRSL---EKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            L  +LDP +A    P SL   E +VD+AL+C+E+    RP+M EVV EIE IM+M G+NP
Sbjct  872  LHELLDPMLA----PTSLAGFELYVDLALKCVEEAGMDRPSMSEVVAEIEKIMKMAGVNP  927

Query  222  HADSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
              DSAS S SY+  S+   HPYS ES   Y+G +P
Sbjct  928  KVDSASNSMSYN--SRTPRHPYSGESQFDYSGGIP  960



>ref|XP_010482273.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Camelina sativa]
Length=950

 Score =   273 bits (697),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILLDE L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  739  GSGKGLAYLHELADPPIIHRDVKSNNILLDEHLTAKVADFGLSKLIGDPEKAHVTTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G Y+V+EVK+ MDK++ +YD
Sbjct  799  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKSRTLYD  858

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IA+S      EK+VDVALRC+E     RP+M EVV+EIESI+ + GLNP+A
Sbjct  859  LQELLDTTIIANSGNIEGFEKYVDVALRCVEAEGVDRPSMSEVVQEIESIVRLAGLNPNA  918

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVL  121
            DSA    +Y  VS G   PY  +S   YTG++
Sbjct  919  DSA----TYEEVS-GDHDPYGRDSFE-YTGLV  944



>ref|XP_010930348.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=952

 Score =   273 bits (697),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 170/213 (80%), Gaps = 1/213 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPI+HRDIK++NILLD+ LNAKV+DFGLSK +G+  K +VTTQVKG
Sbjct  733  GAARGLAYLHELANPPIVHRDIKSSNILLDDHLNAKVSDFGLSKPMGDDTKGYVTTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITA+ P+E+G+YIVREV+  MDKTKD+Y 
Sbjct  793  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLELITAKKPLERGRYIVREVRVMMDKTKDLYG  852

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP+I    T    EK+VD+A++C+ED    RP M +VVKEIE+IM++VG+NP+AD
Sbjct  853  LHELLDPAIGLGTTLGGFEKYVDLAIQCVEDSGNDRPAMSDVVKEIENIMQLVGMNPNAD  912

Query  213  SASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            SAS S SY   S+    HPYS+     Y+G +P
Sbjct  913  SASASLSYISSSRSPVRHPYSNVGNFDYSGGVP  945



>ref|XP_010930347.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Elaeis guineensis]
Length=827

 Score =   271 bits (692),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 165/209 (79%), Gaps = 2/209 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NP I+HRDIK+NNILLD  LNAKV+DFGLSK +G++ K ++TTQVKG
Sbjct  611  GAARGLTYLHELANPRIVHRDIKSNNILLDNHLNAKVSDFGLSKPIGDENKGYITTQVKG  670

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE++TAR PIE+G+++VREV+ A+DK+K++  
Sbjct  671  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLELVTARRPIERGRHVVREVRAAIDKSKELCG  730

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  ++DP I    TP    +F+D+A++C+E+ +  RP M EVVKEIE+I+ + G+N H  
Sbjct  731  LHDLVDPIIGLGTTPAGFGRFIDLAMKCVEESSVDRPLMSEVVKEIENIVPLTGMNLHVR  790

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTG  127
            S STSES+  V++  +HPYS  S   Y+G
Sbjct  791  STSTSESF--VTRTRDHPYSSNSSFDYSG  817



>gb|KEH37006.1| LRR receptor-like kinase [Medicago truncatula]
Length=942

 Score =   272 bits (695),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GA++GL YLH+  NPPIIHRD+K+ NILLDERLNAKV+DFGLSK LG+  K ++TTQVKG
Sbjct  731  GASRGLDYLHEHANPPIIHRDVKSTNILLDERLNAKVSDFGLSKPLGDGAKGYITTQVKG  790

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ITAR PIE+GKYIV+ +K AMDKTK++Y 
Sbjct  791  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELITARRPIERGKYIVKVIKNAMDKTKELYG  850

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ I+DP I    +  S EKF+D+A++C+ED ++ RP+M    KEIE+++ + G NP+A+
Sbjct  851  LKEIIDPVIDFKASLSSFEKFIDLAMKCVEDSSSSRPSMNYAFKEIENMLMLTGTNPNAE  910

Query  213  SASTSESYSGVSKGSEHPYSDE  148
            SA +S SY+  S  S HPY +E
Sbjct  911  SAPSSSSYNE-SGNSMHPYENE  931



>gb|AES64685.2| LRR receptor-like kinase [Medicago truncatula]
Length=954

 Score =   272 bits (695),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GA++GL YLH+  NPPIIHRD+K+ NILLDERLNAKV+DFGLSK LG+  K ++TTQVKG
Sbjct  743  GASRGLDYLHEHANPPIIHRDVKSTNILLDERLNAKVSDFGLSKPLGDGAKGYITTQVKG  802

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ITAR PIE+GKYIV+ +K AMDKTK++Y 
Sbjct  803  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELITARRPIERGKYIVKVIKNAMDKTKELYG  862

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ I+DP I    +  S EKF+D+A++C+ED ++ RP+M    KEIE+++ + G NP+A+
Sbjct  863  LKEIIDPVIDFKASLSSFEKFIDLAMKCVEDSSSSRPSMNYAFKEIENMLMLTGTNPNAE  922

Query  213  SASTSESYSGVSKGSEHPYSDE  148
            SA +S SY+  S  S HPY +E
Sbjct  923  SAPSSSSYNE-SGNSMHPYENE  943



>ref|XP_003594434.1| Somatic embryogenesis receptor-like kinase [Medicago truncatula]
Length=986

 Score =   272 bits (696),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GA++GL YLH+  NPPIIHRD+K+ NILLDERLNAKV+DFGLSK LG+  K ++TTQVKG
Sbjct  775  GASRGLDYLHEHANPPIIHRDVKSTNILLDERLNAKVSDFGLSKPLGDGAKGYITTQVKG  834

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ITAR PIE+GKYIV+ +K AMDKTK++Y 
Sbjct  835  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELITARRPIERGKYIVKVIKNAMDKTKELYG  894

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ I+DP I    +  S EKF+D+A++C+ED ++ RP+M    KEIE+++ + G NP+A+
Sbjct  895  LKEIIDPVIDFKASLSSFEKFIDLAMKCVEDSSSSRPSMNYAFKEIENMLMLTGTNPNAE  954

Query  213  SASTSESYSGVSKGSEHPYSDE  148
            SA +S SY+  S  S HPY +E
Sbjct  955  SAPSSSSYNE-SGNSMHPYENE  975



>emb|CBI29612.3| unnamed protein product [Vitis vinifera]
Length=2030

 Score =   276 bits (705),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRDIK+NNILLDE LNAKV DFGL K L + EK HVTTQVKG
Sbjct  737  GSARGLAYLHELADPPIIHRDIKSNNILLDEHLNAKVGDFGLCKLLADSEKGHVTTQVKG  796

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEYYM+ QLTEKSDVYSFGV++LE+I+AR PIE+GKYIV+EVK AMDKTKD+Y+
Sbjct  797  TMGYMDPEYYMSQQLTEKSDVYSFGVLMLELISARKPIERGKYIVKEVKIAMDKTKDLYN  856

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ +LDP++ +++      KFVD+ALRC+E+  A RPTM EVVKEIE+IM++ GLNP  +
Sbjct  857  LQGLLDPTLGTTLG--GFNKFVDLALRCVEESGADRPTMGEVVKEIENIMQLAGLNPITE  914

Query  213  SASTSESYSGVSKG-SEHPYSDES  145
            S+S S SY   S G S HPY   S
Sbjct  915  SSSASASYEESSTGTSSHPYGSNS  938


 Score =   273 bits (699),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 165/203 (81%), Gaps = 3/203 (1%)
 Frame = -1

Query  750   AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
             +A+GL YLH+L  PPIIHRDIK+NNILLDERLNAKVADFGL K L + EK HVTTQVKGT
Sbjct  1814  SARGLAYLHELAEPPIIHRDIKSNNILLDERLNAKVADFGLCKLLADSEKGHVTTQVKGT  1873

Query  570   MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
             MGYLDPEYYM+ QLTEKSDVYSFGV++LE+I+AR PIE+GKYIV+EVK  MDKTKD+Y+L
Sbjct  1874  MGYLDPEYYMSQQLTEKSDVYSFGVLMLELISARKPIERGKYIVKEVKIEMDKTKDLYNL  1933

Query  390   QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHADS  211
             Q +LDP++ +++      KFVD+ALRC+E+  A RP M EVVKEIE+IM++ GLNP  +S
Sbjct  1934  QGLLDPTLGTTLG--GFNKFVDLALRCVEESGADRPRMGEVVKEIENIMQLAGLNPIIES  1991

Query  210   ASTSESYSGVSKG-SEHPYSDES  145
             +S S SY   S G S HPY + S
Sbjct  1992  SSASASYEESSTGTSSHPYGNNS  2014



>ref|XP_010671953.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Beta vulgaris subsp. 
vulgaris]
Length=945

 Score =   270 bits (691),  Expect = 3e-80, Method: Composition-based stats.
 Identities = 127/193 (66%), Positives = 160/193 (83%), Gaps = 1/193 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GLQYLH+L +PPIIHRDIK+NNILLDE L AKV DFGLSK  G+ +K +V+TQVKG
Sbjct  738  GSARGLQYLHELADPPIIHRDIKSNNILLDEHLVAKVTDFGLSKLFGDSKKGYVSTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MTNQLTEKSD+YSFGVV+LE+ TAR PI++G YIV+ VK+ + +T+ +Y+
Sbjct  798  TMGYLDPEYFMTNQLTEKSDIYSFGVVMLEMATARRPIQQGTYIVKVVKEKIGRTRHLYN  857

Query  393  LQSILDPSIASSVTPR-SLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  I+DP + SS T     EKFVD+AL+C+EDV A RPTM EVVKEIE+I+ + G+NP+A
Sbjct  858  LTEIMDPVLLSSETMLVGFEKFVDLALKCVEDVRANRPTMGEVVKEIENIVLLAGMNPNA  917

Query  216  DSASTSESYSGVS  178
            DSAS S+SY G S
Sbjct  918  DSASVSQSYEGAS  930



>gb|KHN40213.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=944

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+LVNPPIIHRDIK+NNILLD+RLNAKVADFGLSKS+ + EK HVTTQVKG
Sbjct  722  GTARGLAYLHELVNPPIIHRDIKSNNILLDDRLNAKVADFGLSKSMVDSEKDHVTTQVKG  781

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYM+ QLTEKSDVYSFGV++LE+I+AR P+E+GKYIV+EV+ A+DKTK  Y 
Sbjct  782  TMGYLDPEYYMSQQLTEKSDVYSFGVLMLELISARRPLERGKYIVKEVRNALDKTKGSYG  841

Query  393  LQSILDPSI---ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            L  I+DP+I   ++++T    +KFVD+ + C+++  + RP M +VV+EIE+I++  G NP
Sbjct  842  LDEIIDPAIGLASTTLTLSGFDKFVDMTMTCVKESGSDRPKMSDVVREIENILKSAGANP  901

Query  222  HADSASTSESYSGVSKG-SEHPY-SDESLSVYTGV  124
              +S S S SY  VS+G S HPY S+++  +  G+
Sbjct  902  TEESPSISSSYEEVSRGSSSHPYNSNDTFDLSAGL  936



>gb|KFK31438.1| hypothetical protein AALP_AA6G111800 [Arabis alpina]
Length=930

 Score =   269 bits (688),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K+NNILLDE L AKVADFGLSK +G+ EKAHVTTQVKG
Sbjct  734  GSGKGLAYLHELADPPIIHRDVKSNNILLDEHLTAKVADFGLSKLVGDPEKAHVTTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PI++G Y+V+EVK+ MDK+K MYD
Sbjct  794  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPIDRGSYVVKEVKKKMDKSKIMYD  853

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD   IA+S      EK+VDVALRC+E     RPTM EVV++IESI+ + GLNP+A
Sbjct  854  LQEMLDTGIIANSGNLEGFEKYVDVALRCVEPEGVNRPTMGEVVQDIESILRLAGLNPNA  913

Query  216  DSASTSES  193
            DSA+  E+
Sbjct  914  DSATYEEA  921



>gb|EPS73566.1| hypothetical protein M569_01190 [Genlisea aurea]
Length=656

 Score =   264 bits (675),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 162/210 (77%), Gaps = 2/210 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+L +PPIIHRDIK++NILLD+RLNAKVADFGLSKSL      H+TTQVKG
Sbjct  442  GVARGLHYLHELADPPIIHRDIKSSNILLDDRLNAKVADFGLSKSLPALGNIHITTQVKG  501

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE++T R PIE+GKYIVREVK+AMD  K    
Sbjct  502  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLELLTGRSPIERGKYIVREVKEAMDANKPFCG  561

Query  393  LQSILDPSIAS--SVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
            LQ+++DP++ +  S +  S+E+FV VALRC+E+    RP M  VVKE+E IME +GL+P 
Sbjct  562  LQNLIDPNMGTVSSSSAASVERFVHVALRCVEEHRLNRPAMSAVVKEMEKIMETLGLDPA  621

Query  219  ADSASTSESYSGVSKGSEHPYSDESLSVYT  130
            A+S S+     G +    HPYS ESL+ ++
Sbjct  622  AESESSCSGEGGRTFPPVHPYSTESLASFS  651



>ref|XP_008227090.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Prunus mume]
Length=942

 Score =   269 bits (688),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  NP IIHRDIK NNILLD+ LNAKVADFGLSKS+ +    HVTTQVKG
Sbjct  739  GAARGLAYLHEHANPSIIHRDIKPNNILLDKDLNAKVADFGLSKSMVDSGTHHVTTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIE+GKY+VR V+ AMDKTKD+Y+
Sbjct  799  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARRPIERGKYVVRVVQMAMDKTKDLYN  858

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I      + LE FVD+A+ CLED+ A+RP M EVVKEIE+I+++  LN    
Sbjct  859  LQKILDPAIGLGRELKGLENFVDLAMLCLEDLQAKRPRMGEVVKEIENIIQLAALNTSDI  918

Query  213  SASTSESYSGVSK  175
            SASTS S   V+K
Sbjct  919  SASTSGSSENVNK  931



>ref|XP_004960772.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Setaria italica]
Length=962

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPI+HRDIK++N+LLDERLNAKV+DFGLSK LGE  +  VTTQVKG
Sbjct  744  GAAKGVAYLHELADPPIVHRDIKSSNVLLDERLNAKVSDFGLSKPLGEDGRGQVTTQVKG  803

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE++TAR P+E+ +YIVREVK A+D++KDMY 
Sbjct  804  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEVVTARKPLERNRYIVREVKAAVDRSKDMYG  863

Query  393  LQSILDPSIASSVTPRS-LEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  ++DP + ++ +  + LE+FVD+ALRC+E+  A RP+M EVV EIE +++M G  P  
Sbjct  864  LHELVDPVLGAAPSALAGLEQFVDLALRCVEEAGADRPSMGEVVGEIERMVKMAGGGPGH  923

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTG  127
            +SAS S SY+  S+   HPY  +S   Y+G
Sbjct  924  ESASESMSYA--SRTPRHPYGGDSPFDYSG  951



>ref|XP_006584125.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Glycine max]
Length=945

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+LVNPPIIHRDIK+NNILLD+RLNAKV+DFGLSKS+ + EK HVTTQVKG
Sbjct  723  GTARGLAYLHELVNPPIIHRDIKSNNILLDDRLNAKVSDFGLSKSMVDSEKDHVTTQVKG  782

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYM+ QLTEKSDVYSFGV++LE+I+AR P+E+GKYIV+EV+ A+DKTK  Y 
Sbjct  783  TMGYLDPEYYMSQQLTEKSDVYSFGVLMLELISARRPLERGKYIVKEVRNALDKTKGSYG  842

Query  393  LQSILDPSI---ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            L  I+DP+I   ++++T    +KFVD+ + C+++  + RP M +VV+EIE+I++  G NP
Sbjct  843  LDEIIDPAIGLASTTLTLSGFDKFVDMTMTCVKESGSDRPKMSDVVREIENILKSAGANP  902

Query  222  HADSASTSESYSGVSKG-SEHPY-SDESLSVYTGV  124
              +S S S SY  VS+G S HPY S+++  +  G+
Sbjct  903  TEESPSISSSYEEVSRGSSSHPYNSNDTFDLSAGL  937



>ref|XP_006584124.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Glycine max]
Length=960

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+LVNPPIIHRDIK+NNILLD+RLNAKV+DFGLSKS+ + EK HVTTQVKG
Sbjct  738  GTARGLAYLHELVNPPIIHRDIKSNNILLDDRLNAKVSDFGLSKSMVDSEKDHVTTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYM+ QLTEKSDVYSFGV++LE+I+AR P+E+GKYIV+EV+ A+DKTK  Y 
Sbjct  798  TMGYLDPEYYMSQQLTEKSDVYSFGVLMLELISARRPLERGKYIVKEVRNALDKTKGSYG  857

Query  393  LQSILDPSI---ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            L  I+DP+I   ++++T    +KFVD+ + C+++  + RP M +VV+EIE+I++  G NP
Sbjct  858  LDEIIDPAIGLASTTLTLSGFDKFVDMTMTCVKESGSDRPKMSDVVREIENILKSAGANP  917

Query  222  HADSASTSESYSGVSKG-SEHPY-SDESLSVYTGV  124
              +S S S SY  VS+G S HPY S+++  +  G+
Sbjct  918  TEESPSISSSYEEVSRGSSSHPYNSNDTFDLSAGL  952



>ref|XP_007213558.1| hypothetical protein PRUPE_ppa017796mg, partial [Prunus persica]
 gb|EMJ14757.1| hypothetical protein PRUPE_ppa017796mg, partial [Prunus persica]
Length=900

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  NP IIHRDIK NNILLD+ LNAKVADFGLSKS+ +    HVTTQV+G
Sbjct  704  GAARGLAYLHEHANPSIIHRDIKPNNILLDKDLNAKVADFGLSKSMVDSGTHHVTTQVRG  763

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIE+GKYIVR V+ AMDKTKD+Y+
Sbjct  764  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARRPIERGKYIVRVVQMAMDKTKDLYN  823

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            LQ ILDP+I      + LE FVD+A+ CLED+ A+RP M EVVKEIE+I+++  LN    
Sbjct  824  LQKILDPAIGLGRELKGLENFVDLAMLCLEDLQAKRPRMGEVVKEIENIIQLAALNTSDI  883

Query  213  SASTSESYSGVSK  175
            SASTS S   V+K
Sbjct  884  SASTSGSSEDVNK  896



>ref|XP_010682082.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Beta vulgaris subsp. vulgaris]
Length=966

 Score =   268 bits (684),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 163/213 (77%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L  PPIIHRDIK+NNILLDE LNAKV+DFGLSK L +  K H+TT+VKG
Sbjct  756  GAARGLAYLHELATPPIIHRDIKSNNILLDENLNAKVSDFGLSKPLIDVGKGHITTEVKG  815

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT +L EKSDVYSFGV++LE+IT + PI++G+YIVRE++  +D+T+D+Y 
Sbjct  816  TMGYLDPEYYMTQKLNEKSDVYSFGVLMLELITGKAPIDRGRYIVREMRNVIDRTQDLYG  875

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L   +DP I    T +  EK+VD+AL C+ +    RP M EVVKE+E I++M GLNP++D
Sbjct  876  LHEFMDPGIGLGTTLKGFEKYVDLALCCVGESGIDRPVMGEVVKELEEILQMAGLNPYSD  935

Query  213  SASTSESYSGVSKGSEHPYSDESLSVYTGVLPK  115
            SA++S +++   + +   Y DESL  Y+G  P+
Sbjct  936  SATSSGTFA--RRNTRDLYDDESLYSYSGQFPR  966



>ref|XP_006836951.1| hypothetical protein AMTR_s00099p00159710 [Amborella trichopoda]
 gb|ERM99804.1| hypothetical protein AMTR_s00099p00159710 [Amborella trichopoda]
Length=951

 Score =   267 bits (683),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 168/213 (79%), Gaps = 3/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+  +PPIIHRD+K NNILLDE LNAKVADFGLSK +G+++  HVTTQVKG
Sbjct  733  GSARGLAYLHEHADPPIIHRDVKPNNILLDENLNAKVADFGLSKPIGDRQ-CHVTTQVKG  791

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMT QLT KSDVYSFGV++LE+++ +PPIE+G+YIVREVK AMDKTKD+Y 
Sbjct  792  TLGYLDPEYYMTQQLTAKSDVYSFGVLMLEMLSGKPPIERGRYIVREVKLAMDKTKDLYG  851

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP++ +S +    E++VD+AL+C+ +    RP M EVV+E+E I+   GL+   +
Sbjct  852  LHELLDPTVMASPSLPGFERYVDLALKCVGESDKDRPNMSEVVREMEEIISEAGLSTTTN  911

Query  213  SASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            SA+TS +++G ++G+  HPY+D S   Y+G  P
Sbjct  912  SAATSATFAGSARGTPHHPYNDPSFD-YSGAFP  943



>ref|XP_009364692.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=534

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  NPPIIHRDIK+NNILLD+ L AKVADFGLSKS+ +    H++TQVKG
Sbjct  330  GAARGLAYLHEHANPPIIHRDIKSNNILLDKDLTAKVADFGLSKSMPDSGTDHISTQVKG  389

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIE+GKYIVR V+ AMD TK +Y+
Sbjct  390  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARRPIEQGKYIVRVVQMAMDNTKSLYN  449

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP++ S    + LE FVD+A+ C+E+   +RP M EVVKEIE+IM++ GLN    
Sbjct  450  LHQVLDPAMGSGTDLKGLEIFVDLAMLCVEEQQDKRPRMGEVVKEIENIMQLAGLNTGYQ  509

Query  213  SASTSESY  190
            SAS+S SY
Sbjct  510  SASSSPSY  517



>emb|CDM81495.1| unnamed protein product [Triticum aestivum]
Length=957

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 160/210 (76%), Gaps = 5/210 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G AKG+ YLH+L +PPI+HRDIK++N+LLDERLNAKV+DFGLSK LGE  +  VTTQVKG
Sbjct  741  GTAKGIAYLHELADPPIVHRDIKSSNVLLDERLNAKVSDFGLSKLLGEDGRGQVTTQVKG  800

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITA+ P+E+G+YIVREV  A+D++KD+Y 
Sbjct  801  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEMITAKKPLERGRYIVREVLAALDRSKDLYG  860

Query  393  LQSILDPSIASSVTP-RSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + +S T    LE++VD+ALRC+E+  A RP+M E V EIE I  M G  P  
Sbjct  861  LHDLLDPVLGASPTSLGGLEQYVDLALRCVEEAGADRPSMGEAVSEIERITRMAGGGPE-  919

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTG  127
               S SES S  S+   HPY  +S S Y+G
Sbjct  920  ---SASESMSYASRTPRHPYGGDSPSEYSG  946



>ref|XP_010441118.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=436

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 160/213 (75%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++NILLDE L AKVADFGLS+ + E EKA+VT QVKG
Sbjct  218  GSGKGLAYLHELADPPIIHRDVKSSNILLDESLAAKVADFGLSQLVEEAEKANVTAQVKG  277

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV++LE++T   PI  GKY+V+EVK  M+K+K +YD
Sbjct  278  TMGYLDPEYYMTNQLTEKSDVYGFGVMMLELLTGEIPIVNGKYVVKEVKMKMNKSKKLYD  337

Query  393  LQSILDPSIASSV-TPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD +I S+    +  EKFV++AL C++    +RP+M EVVKEIE IM+  GL P+ 
Sbjct  338  LQELLDTTIISTNENLKGFEKFVNLALICVDQEGVKRPSMNEVVKEIEYIMQHAGLYPNV  397

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S +Y   SKGS   Y + S   Y+   P
Sbjct  398  DSAASSRTYDEASKGSGDLYRNNSFE-YSASFP  429



>ref|XP_002441998.1| hypothetical protein SORBIDRAFT_08g006710 [Sorghum bicolor]
 gb|EES15836.1| hypothetical protein SORBIDRAFT_08g006710 [Sorghum bicolor]
Length=962

 Score =   265 bits (678),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 162/204 (79%), Gaps = 4/204 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPI+HRDIK++N+LLDERLNAKV+DFGLSK LG+  +  VTTQVKG
Sbjct  744  GAAKGVAYLHELADPPIVHRDIKSSNVLLDERLNAKVSDFGLSKPLGDDGRGQVTTQVKG  803

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ TAR P+E+G+YIVRE+K A+D+TKD+Y 
Sbjct  804  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLEVATARKPLERGRYIVREMKAALDRTKDLYG  863

Query  393  LQSILDPSI-ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + A+   P  +E++VD+ALRC+E+  A RP+M EVV EIE +++M G     
Sbjct  864  LHDLLDPVLCAAPSAPEGMEQYVDLALRCVEEAGADRPSMGEVVSEIERVLKMAG-GAGP  922

Query  216  DSASTSESYSGVSKGSEHPYSDES  145
            +SAS S SY+  S+   HPY  +S
Sbjct  923  ESASNSMSYA--SRTPRHPYGGDS  944



>ref|XP_010930467.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=970

 Score =   265 bits (677),  Expect = 3e-78, Method: Composition-based stats.
 Identities = 135/213 (63%), Positives = 166/213 (78%), Gaps = 1/213 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GA++GL YLH+L NPPI+HRDIK++NILLD  LNAKV+DFGLSK LG   K +VTTQVKG
Sbjct  751  GASRGLAYLHELANPPIVHRDIKSSNILLDCHLNAKVSDFGLSKPLGVDGKGYVTTQVKG  810

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITA+ P+E+G+YIVREV+  MDKTKD Y 
Sbjct  811  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLELITAKKPLERGRYIVREVRVVMDKTKDFYG  870

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP+I    T    EK+VD+A++C+E+    RPTM EVVKEIE+IM++ G+NP+A 
Sbjct  871  LHELLDPAIGLGTTLGGFEKYVDLAIQCVEESGNDRPTMSEVVKEIENIMQLAGMNPNAG  930

Query  213  SASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            SAS S SY   S+    HPYS+E    Y+G  P
Sbjct  931  SASASLSYVSSSRSPVRHPYSNEGNFDYSGGAP  963



>ref|XP_008366451.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Malus domestica]
Length=935

 Score =   263 bits (673),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  NPPIIHRDIK++NILLD+ L AKVADFGLSKS+ + E  H++TQVKG
Sbjct  731  GAARGLAYLHEHANPPIIHRDIKSSNILLDKDLTAKVADFGLSKSMSDSETDHISTQVKG  790

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIE+GKYIVR V+ AMDKTK +Y+
Sbjct  791  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARRPIEQGKYIVRVVQMAMDKTKSLYN  850

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP++ S    + LE FVD+A+ C+E+   +RP M EVVKEIE+IM++ GLN    
Sbjct  851  LHQVLDPAMGSGTDLKGLEIFVDLAMLCVEEQQDKRPRMGEVVKEIENIMQLAGLNTGDX  910

Query  213  SASTSESYSGVSKGSEHPYSDESLS  139
            SAS+S SY   S     P S +S S
Sbjct  911  SASSSPSYDYTSADDLLPSSRQSSS  935



>dbj|BAJ94480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   264 bits (674),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 159/210 (76%), Gaps = 5/210 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G AKG+ YLH+L +PPI+HRDIK++N+LLDERLNAKVADFGLSK LGE  +  VTTQVKG
Sbjct  741  GTAKGIAYLHELADPPIVHRDIKSSNVLLDERLNAKVADFGLSKLLGEDGRGQVTTQVKG  800

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITA+ P+E+G+YIVREV  A+D+ KD+Y 
Sbjct  801  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEMITAKKPLERGRYIVREVVAALDRGKDLYG  860

Query  393  LQSILDPSI-ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + AS  +   LE++VD+ALRC+E+  A RP+M E V EIE I  M G  P  
Sbjct  861  LHDLLDPVLGASPSSLGGLEQYVDLALRCVEEAGADRPSMGEAVSEIERITRMAGGVPE-  919

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTG  127
               S SES S  S+   HPY  +S S Y+G
Sbjct  920  ---SASESMSYASRTPRHPYGGDSPSEYSG  946



>dbj|BAJ89467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   264 bits (674),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 159/210 (76%), Gaps = 5/210 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G AKG+ YLH+L +PPI+HRDIK++N+LLDERLNAKVADFGLSK LGE  +  VTTQVKG
Sbjct  741  GTAKGIAYLHELADPPIVHRDIKSSNVLLDERLNAKVADFGLSKLLGEDGRGQVTTQVKG  800

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITA+ P+E+G+YIVREV  A+D+ KD+Y 
Sbjct  801  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEMITAKKPLERGRYIVREVVAALDRGKDLYG  860

Query  393  LQSILDPSI-ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + AS  +   LE++VD+ALRC+E+  A RP+M E V EIE I  M G  P  
Sbjct  861  LHDLLDPVLGASPSSLGGLEQYVDLALRCVEEAGADRPSMGEAVSEIERITRMAGGVPE-  919

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTG  127
               S SES S  S+   HPY  +S S Y+G
Sbjct  920  ---SASESMSYASRTPRHPYGGDSPSEYSG  946



>ref|XP_009403664.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=763

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 161/208 (77%), Gaps = 2/208 (1%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            AA+GL YLH+L NP IIHRD+K+NNILLD  LNAKV+DFGL K L +  K ++TTQVKGT
Sbjct  548  AARGLTYLHELANPRIIHRDVKSNNILLDHHLNAKVSDFGLCKPLNDDMKGYITTQVKGT  607

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGYLDPEYYMT  LTEKSDVYSFGV+LLE++TAR PIE+G++IVREV+ A++K+ D++DL
Sbjct  608  MGYLDPEYYMTQHLTEKSDVYSFGVLLLELVTARKPIERGRFIVREVRNAINKSPDLHDL  667

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHADS  211
            + +LDP++  + T   L++FV++A++C+ED +A RP M EV KEIE+IM + G+NP+  S
Sbjct  668  RELLDPAVCINSTLPGLDRFVELAMKCVEDSSADRPWMSEVAKEIENIMVLAGMNPYIAS  727

Query  210  ASTSESYSGVSKGSEHPYSDESLSVYTG  127
             S S S+ G  +   HPY  +    Y+G
Sbjct  728  ESNSASFGGERR--SHPYQSDVSFDYSG  753



>emb|CDM81501.1| unnamed protein product [Triticum aestivum]
Length=957

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 160/210 (76%), Gaps = 5/210 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G AKG+ YLH+L +PPI+HRDIK++N+LLDERLNAKV+DFGLSK LGE  +  VTTQVKG
Sbjct  741  GTAKGIAYLHELADPPIVHRDIKSSNVLLDERLNAKVSDFGLSKLLGEDGRGQVTTQVKG  800

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYY+T QLTEKSDVYSFGV+LLE+ITA+ P+E+G+YIVREV  A+D++KD+Y 
Sbjct  801  TMGYLDPEYYVTQQLTEKSDVYSFGVLLLEMITAKKPLERGRYIVREVLAALDRSKDLYG  860

Query  393  LQSILDPSIASSVTP-RSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + +S T    LE++VD+ALRC+E+  A RP+M E V EIE I  M G  P  
Sbjct  861  LHDLLDPVLGASPTSLGGLEQYVDLALRCVEEAGADRPSMGEAVSEIERITRMAGGAPE-  919

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTG  127
               S SES S  S+   HPY  +S S Y+G
Sbjct  920  ---SASESMSYASRTPRHPYGGDSPSEYSG  946



>ref|XP_007147542.1| hypothetical protein PHAVU_006G133400g [Phaseolus vulgaris]
 gb|ESW19536.1| hypothetical protein PHAVU_006G133400g [Phaseolus vulgaris]
Length=953

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLDERLNAKV+DFGLSK LG+  K ++TTQVKG
Sbjct  740  GAARGLDYLHELANPPIIHRDIKSTNILLDERLNAKVSDFGLSKPLGDGAKGYITTQVKG  799

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV++LE+ITAR PIE+GKYIV+ VK+A+DKTK    
Sbjct  800  TMGYLDPEYYMTQQLTEKSDVYSFGVLMLELITARRPIERGKYIVKVVKEAIDKTKGFCG  859

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP-HA  217
            L+ +LDP+I         EKFVD+AL+C+E+ ++ RPTM  VVKEIE+++++ G +P  +
Sbjct  860  LEEVLDPTIDFGTALNGFEKFVDIALQCVEESSSDRPTMNYVVKEIENMLQLAGSSPILS  919

Query  216  DSASTSESYSGVSKGSEHPYSDE  148
             SASTS SY+   K S HPY +E
Sbjct  920  ASASTSSSYNNPMKSSLHPYENE  942



>ref|XP_006282275.1| hypothetical protein CARUB_v10028556mg, partial [Capsella rubella]
 gb|EOA15173.1| hypothetical protein CARUB_v10028556mg, partial [Capsella rubella]
Length=892

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRDIK++NILLDE L AKVADFGLSK +GE E   VTTQVKG
Sbjct  697  GSGKGLAYLHELADPPIIHRDIKSHNILLDESLTAKVADFGLSKLVGEAENPQVTTQVKG  756

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLT KSDVY FGVV+ E++T + PI+ GK++VREVK  ++K+K +YD
Sbjct  757  TMGYLDPEYYMTNQLTAKSDVYGFGVVMFELLTGKTPIDNGKHVVREVKMKINKSKKLYD  816

Query  393  LQSILDPSIASSV-TPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD  I+SS      LEK+VD+ALRC++     RP+M EVVKEIE+IME  GLNP+ 
Sbjct  817  LQELLDTVISSSSENLEGLEKYVDLALRCVDQEGVNRPSMSEVVKEIENIMEQAGLNPNV  876

Query  216  DSASTSESYSGVSKGS  169
            DSA++S+++   +KGS
Sbjct  877  DSAASSKTFEEANKGS  892



>ref|XP_006371694.1| hypothetical protein POPTR_0018s002602g, partial [Populus trichocarpa]
 gb|ERP49491.1| hypothetical protein POPTR_0018s002602g, partial [Populus trichocarpa]
Length=224

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+LVNP IIHRD+K+ NILLDE LNAKVADFGLSK +   E    TTQVKG
Sbjct  17   GAARGLAYLHELVNPRIIHRDVKSANILLDESLNAKVADFGLSKPMDNSELILATTQVKG  76

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T GY+DPEY  T  LTEKSDVY FGVVLLE+++ R P+E+GKY+V EV  ++D+ KD+Y 
Sbjct  77   TRGYIDPEYQETLLLTEKSDVYGFGVVLLELVSGRKPLERGKYLVAEVSSSLDRKKDLYS  136

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDPSI     P  L+K VD+A++C+++  + RPTM EVVKEIE+I+ + GLNP+A+
Sbjct  137  LHELLDPSIGLDTKPEGLDKTVDLAMKCVQEKGSDRPTMGEVVKEIENILHLAGLNPNAE  196

Query  213  SASTSESYSGVSKGSEHPYS--DESLSV  136
            + STS S+   S+  E P S  +E LS+
Sbjct  197  AESTSASFEEASQ-DEFPPSLKEEELSL  223



>dbj|BAD93860.1| receptor protein kinase-like [Arabidopsis thaliana]
Length=835

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 164/214 (77%), Gaps = 3/214 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++N+LLDE L AKVADFGLS+ + + EKA+VT QVKG
Sbjct  616  GSGKGLAYLHELADPPIIHRDVKSSNVLLDESLTAKVADFGLSQLVEDAEKANVTAQVKG  675

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV++LE++T + PIE GKY+V+E+K  M+K+K++YD
Sbjct  676  TMGYLDPEYYMTNQLTEKSDVYGFGVMMLELLTGKIPIENGKYVVKEMKMKMNKSKNLYD  735

Query  393  LQSILDPSIA--SSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
            LQ  LD +I+  S+   +  EK+VDVALRC++    +RP+M EVVKEIE+IM+  GLNP+
Sbjct  736  LQDFLDTTISTTSNRNLKGFEKYVDVALRCVDPEGVKRPSMNEVVKEIENIMQYAGLNPN  795

Query  219  ADSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
             +S ++S +Y   SK S   Y + S   Y+   P
Sbjct  796  VESYASSRTYDEASKESGDLYGNNSFE-YSASFP  828



>ref|XP_009364675.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=937

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  NPPIIHRDIK+NNILLD+ L AKVADFGLSKS+ +    H++TQVKG
Sbjct  733  GAARGLAYLHEHANPPIIHRDIKSNNILLDKDLTAKVADFGLSKSMPDSGTDHISTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIE+GKYIVR V+ AMD TK +Y+
Sbjct  793  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARRPIEQGKYIVRVVQMAMDNTKSLYN  852

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP++ S    + LE FVD+A+ C+E+   +RP M EVVKEIE+IM++ GLN    
Sbjct  853  LHQVLDPAMGSGTDLKGLEIFVDLAMLCVEEQQDKRPRMGEVVKEIENIMQLAGLNTGYQ  912

Query  213  SASTSESY  190
            SAS+S SY
Sbjct  913  SASSSPSY  920



>gb|KHN40742.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=954

 Score =   259 bits (661),  Expect = 5e-76, Method: Composition-based stats.
 Identities = 135/216 (63%), Positives = 166/216 (77%), Gaps = 4/216 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+L NPPIIHRDIK+ NILLDERL AKV+DFGLSK LGE  K ++TTQVKG
Sbjct  739  GAARGLDYLHELANPPIIHRDIKSTNILLDERLIAKVSDFGLSKPLGEGAKGYITTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITAR PIE+GKYIV+ VK A+DKTK  Y 
Sbjct  799  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLELITARRPIERGKYIVKVVKGAIDKTKGFYG  858

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP---  223
            L+ ILDP+I         EKFVD+A++C+E+ +  RPTM  VVKEIE+++++ G +P   
Sbjct  859  LEEILDPTIDLGTALSGFEKFVDIAMQCVEESSFDRPTMNYVVKEIENMLQLAGSSPIFS  918

Query  222  HADSASTSESYSGVSKGSEHPYSDESLSVYTGVLPK  115
             + S STS SY+  +K S HPY++E       VLP+
Sbjct  919  ASASVSTSSSYNNATKISLHPYNNEYFDSSV-VLPR  953



>ref|NP_199789.5| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 gb|AED95856.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=857

 Score =   258 bits (658),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 164/214 (77%), Gaps = 3/214 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++N+LLDE L AKVADFGLS+ + + EKA+VT QVKG
Sbjct  638  GSGKGLAYLHELADPPIIHRDVKSSNVLLDESLTAKVADFGLSQLVEDAEKANVTAQVKG  697

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV++LE++T + PIE GKY+V+E+K  M+K+K++YD
Sbjct  698  TMGYLDPEYYMTNQLTEKSDVYGFGVMMLELLTGKIPIENGKYVVKEMKMKMNKSKNLYD  757

Query  393  LQSILDPSIA--SSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
            LQ  LD +I+  S+   +  EK+VDVALRC++    +RP+M EVVKEIE+IM+  GLNP+
Sbjct  758  LQDFLDTTISATSNRNLKGFEKYVDVALRCVDPEGVKRPSMNEVVKEIENIMQYAGLNPN  817

Query  219  ADSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
             +S ++S +Y   SK S   Y + S   Y+   P
Sbjct  818  VESYASSRTYDEASKESGDLYGNNSFE-YSASFP  850



>ref|XP_002864016.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40275.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=967

 Score =   258 bits (660),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 165/213 (77%), Gaps = 5/213 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++NILLDERLNAKVADFGLS+ + + EKA+VT QVKG
Sbjct  752  GSGKGLAYLHELADPPIIHRDVKSSNILLDERLNAKVADFGLSQLVEDAEKANVTAQVKG  811

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGVV+LE++T + PIE GKY+V+E+K  M+K+K++YD
Sbjct  812  TMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKIPIENGKYVVKEMKMKMNKSKNLYD  871

Query  393  LQSILDPSIAS-SVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD SI++ S   +  EK+VD+ALRC++    +RP+M E VKEIE+IM+  GL    
Sbjct  872  LQELLDTSISTASKNLKGFEKYVDLALRCVDPEGVKRPSMNEAVKEIENIMQHAGL---V  928

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DS+++S +Y   SKGS   Y + S   Y+   P
Sbjct  929  DSSASSRTYDEESKGSGDLYGNNSFE-YSASFP  960



>ref|XP_009335437.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=922

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  NPPIIHRDIK+NNILLD+ L AKVADFGLSKS+ +    H++TQV+G
Sbjct  718  GAARGLAYLHEHANPPIIHRDIKSNNILLDKDLTAKVADFGLSKSMSDSGTNHISTQVRG  777

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT  LTEKSDVYSFGVV+LE+ITAR PIE+GKYIVR V+ A+DKTK +Y+
Sbjct  778  TMGYLDPEYYMTQLLTEKSDVYSFGVVMLELITARRPIEQGKYIVRVVQMAIDKTKSLYN  837

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP++ S    + LE FVD+A+ C+E+   +RP M EVVKEIE+IM++ GLN    
Sbjct  838  LHQVLDPAMGSGTDLKGLEIFVDLAMLCVEEQQDKRPRMGEVVKEIENIMQLAGLNTGDQ  897

Query  213  SASTSESY  190
            SAS+S SY
Sbjct  898  SASSSPSY  905



>ref|XP_006662853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Oryza brachyantha]
Length=972

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 162/215 (75%), Gaps = 10/215 (5%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPI+HRDIK++NILLD  L+ KV+DFGLSK L +  +  VTTQVKG
Sbjct  757  GAAKGIAYLHELADPPIVHRDIKSSNILLDTNLHTKVSDFGLSKPLNQDARGQVTTQVKG  816

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGV+LLE+ITAR P+E+G+Y+VREVK   D++KD+  
Sbjct  817  TMGYLDPEYYMTQQLTEKSDVYSFGVLLLEVITARKPLERGRYVVREVKGTADRSKDLCG  876

Query  393  LQSILDPSIASSVTPRSL---EKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNP  223
            L  +LDP +     P SL   E++VD+ALRC+ +    RP M EVV EIE IM++ G+NP
Sbjct  877  LHELLDPMLG----PTSLAGFEQYVDLALRCVAEAGMDRPPMSEVVTEIEKIMKVAGMNP  932

Query  222  HADSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
             ADSAS S SY+  S+   HPY+ ES   Y+G +P
Sbjct  933  -ADSASNSLSYN--SRSPRHPYNGESQFDYSGGIP  964



>dbj|BAA98166.1| receptor protein kinase-like [Arabidopsis thaliana]
Length=1006

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 164/214 (77%), Gaps = 3/214 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++N+LLDE L AKVADFGLS+ + + EKA+VT QVKG
Sbjct  787  GSGKGLAYLHELADPPIIHRDVKSSNVLLDESLTAKVADFGLSQLVEDAEKANVTAQVKG  846

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV++LE++T + PIE GKY+V+E+K  M+K+K++YD
Sbjct  847  TMGYLDPEYYMTNQLTEKSDVYGFGVMMLELLTGKIPIENGKYVVKEMKMKMNKSKNLYD  906

Query  393  LQSILDPSIA--SSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
            LQ  LD +I+  S+   +  EK+VDVALRC++    +RP+M EVVKEIE+IM+  GLNP+
Sbjct  907  LQDFLDTTISATSNRNLKGFEKYVDVALRCVDPEGVKRPSMNEVVKEIENIMQYAGLNPN  966

Query  219  ADSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
             +S ++S +Y   SK S   Y + S   Y+   P
Sbjct  967  VESYASSRTYDEASKESGDLYGNNSFE-YSASFP  999



>ref|XP_003578779.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brachypodium distachyon]
Length=960

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 161/209 (77%), Gaps = 5/209 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G AKG+ YLH+L +PPI+HRDIK++N+LLDERLNAKV+DFGLSK LGE  +  VTTQVKG
Sbjct  744  GTAKGIAYLHELADPPIVHRDIKSSNVLLDERLNAKVSDFGLSKLLGEDGRGMVTTQVKG  803

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLT++SDVYSFGV+LLE+ITA+ P+E+G+YIVREV  A+D++KD+Y 
Sbjct  804  TMGYLDPEYYMTQQLTDRSDVYSFGVLLLEVITAKKPLERGRYIVREVHTALDRSKDLYG  863

Query  393  LQSILDPSI-ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + A+  +   LE++VD+ALRC+E+  A RP M EVV EIE I  M G    A
Sbjct  864  LHELLDPVLGAAPSSLGGLEQYVDLALRCVEEAGADRPPMGEVVAEIERITRMAG--GGA  921

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYT  130
            +SAS S SY   S+   HPY  +S + Y+
Sbjct  922  ESASESMSYP--SRTPRHPYGGDSPAEYS  948



>ref|XP_009406445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Musa acuminata subsp. malaccensis]
Length=955

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA GL YLH+L NPPIIHRDIK+NNILLD RLNAKV+DFGLS++L +  K H+TTQVKG
Sbjct  739  GAASGLAYLHELANPPIIHRDIKSNNILLDHRLNAKVSDFGLSRTLFDDAKHHITTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMT QLTEKSDVYSFGV+LLE++TAR PIE+G+Y+VR+VK A+DK K++ +
Sbjct  799  TVGYLDPEYYMTQQLTEKSDVYSFGVLLLELVTARKPIEEGQYVVRQVKDAIDKQKNLLN  858

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP+IA+    R LE F+D+A++C+ED +  RP+M EVVKEIE+IM++  +N  A+
Sbjct  859  LDELLDPTIATVSALRGLENFIDLAMKCVEDESRDRPSMSEVVKEIENIMQVADVNSTAE  918

Query  213  SASTSESYSGVSKG  172
            S STS  ++G S G
Sbjct  919  SGSTSPPFAGKSGG  932



>ref|XP_009406444.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Musa acuminata subsp. malaccensis]
Length=957

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA GL YLH+L NPPIIHRDIK+NNILLD RLNAKV+DFGLS++L +  K H+TTQVKG
Sbjct  741  GAASGLAYLHELANPPIIHRDIKSNNILLDHRLNAKVSDFGLSRTLFDDAKHHITTQVKG  800

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMT QLTEKSDVYSFGV+LLE++TAR PIE+G+Y+VR+VK A+DK K++ +
Sbjct  801  TVGYLDPEYYMTQQLTEKSDVYSFGVLLLELVTARKPIEEGQYVVRQVKDAIDKQKNLLN  860

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP+IA+    R LE F+D+A++C+ED +  RP+M EVVKEIE+IM++  +N  A+
Sbjct  861  LDELLDPTIATVSALRGLENFIDLAMKCVEDESRDRPSMSEVVKEIENIMQVADVNSTAE  920

Query  213  SASTSESYSGVSKG  172
            S STS  ++G S G
Sbjct  921  SGSTSPPFAGKSGG  934



>ref|XP_007207226.1| hypothetical protein PRUPE_ppa000992mg [Prunus persica]
 gb|EMJ08425.1| hypothetical protein PRUPE_ppa000992mg [Prunus persica]
Length=938

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  707  GSARGLAYLHELANPPIIHRDVKSTNILLDEHLTAKVADFGLSKLVADSGKGHVSTQVKG  766

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+  MDK  ++ Y
Sbjct  767  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARQPIEKGKYIVREVRLMMDKNDEEHY  826

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++D SI +S T     +F+++AL+C+E+ AA RPTM E+VK IE+I++  G+N ++
Sbjct  827  GLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAIETILQNDGMNTNS  886

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             SAS S +    SKG+ +HPY+D
Sbjct  887  TSASLSATEFAASKGAPKHPYND  909



>emb|CDP08081.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   256 bits (654),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 164/200 (82%), Gaps = 1/200 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRDIK+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  734  GSARGLTYLHELANPPIIHRDIKSTNILLDENLTAKVADFGLSKLVCDGSKGHVSTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE++TA+ PIEKGKYIVREV+ AMDK  ++ Y
Sbjct  794  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELVTAKQPIEKGKYIVREVRMAMDKNDEECY  853

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L +I+DPSI ++ T     +FVD+A+RC+E+ AA RPTM EVVKE+E+I++  GLN ++
Sbjct  854  GLGNIMDPSIRNTTTLIGFGRFVDLAMRCVEESAADRPTMSEVVKELETILQNDGLNTNS  913

Query  216  DSASTSESYSGVSKGSEHPY  157
             SAS+S +  G++KG++H Y
Sbjct  914  TSASSSATDFGMAKGAKHLY  933



>ref|XP_010482268.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Camelina sativa]
Length=795

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++NILLDE L AKVADFGLS+ + E EKA+ T QVKG
Sbjct  577  GSGKGLAYLHELADPPIIHRDVKSSNILLDESLAAKVADFGLSQLVEEAEKANATAQVKG  636

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV++LE++T   PI  GKY+V+EVK  M+K+K +YD
Sbjct  637  TMGYLDPEYYMTNQLTEKSDVYGFGVMMLELLTGEIPIVNGKYVVKEVKMKMNKSKKLYD  696

Query  393  LQSILDPSIASSV-TPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD +I S+       EKFVD+AL C++    +RP+M EVVKEIE IM+  GL P+ 
Sbjct  697  LQELLDTTIISTNENLNGFEKFVDLALICVDQEGVKRPSMNEVVKEIEYIMQHAGLYPNV  756

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S +Y   SKGS   Y + S   Y+   P
Sbjct  757  DSAASSRTYDEASKGSGDLYRNNSFE-YSASFP  788



>ref|XP_009387132.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   254 bits (649),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K+ NIL+DE LNAKVADFGLSK + +  K HV+TQVKG
Sbjct  737  GSARGLAYLHELADPPIIHRDVKSTNILVDESLNAKVADFGLSKLVSDTGKGHVSTQVKG  796

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+ITAR PIEKGKYIVRE++ A+D   ++ Y
Sbjct  797  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELITARQPIEKGKYIVREIRNAVDNYDEEYY  856

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DP I        L +FV +A+RC+E+ AA RPTM EVVKEIE+I++  GLN   
Sbjct  857  GLREMMDPVIRDVGNLTGLRRFVRLAIRCVEESAADRPTMNEVVKEIETILQSNGLNTQP  916

Query  216  DSASTSESYSGVSKGS-EHPYSDE  148
             SAS+S +  G + G+  HPY D 
Sbjct  917  SSASSSATEFGKAMGAPRHPYHDN  940



>ref|XP_010482267.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Camelina sativa]
Length=890

 Score =   253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++NILLDE L AKVADFGLS+ + E EKA+ T QVKG
Sbjct  672  GSGKGLAYLHELADPPIIHRDVKSSNILLDESLAAKVADFGLSQLVEEAEKANATAQVKG  731

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV++LE++T   PI  GKY+V+EVK  M+K+K +YD
Sbjct  732  TMGYLDPEYYMTNQLTEKSDVYGFGVMMLELLTGEIPIVNGKYVVKEVKMKMNKSKKLYD  791

Query  393  LQSILDPSIASSV-TPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD +I S+       EKFVD+AL C++    +RP+M EVVKEIE IM+  GL P+ 
Sbjct  792  LQELLDTTIISTNENLNGFEKFVDLALICVDQEGVKRPSMNEVVKEIEYIMQHAGLYPNV  851

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S +Y   SKGS   Y + S   Y+   P
Sbjct  852  DSAASSRTYDEASKGSGDLYRNNSFE-YSASFP  883



>ref|XP_006282197.1| hypothetical protein CARUB_v10028463mg [Capsella rubella]
 gb|EOA15095.1| hypothetical protein CARUB_v10028463mg [Capsella rubella]
Length=811

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 159/213 (75%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++NILLDE L AKVADFGLS+ + E EKA+VT  VKG
Sbjct  593  GSGKGLAYLHELADPPIIHRDVKSSNILLDESLAAKVADFGLSQLVEEAEKANVTAAVKG  652

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV++LE++T   PI  GKY+V+EVK  M+K+K +YD
Sbjct  653  TMGYLDPEYYMTNQLTEKSDVYGFGVMMLELLTGEIPIVNGKYVVKEVKMKMNKSKKLYD  712

Query  393  LQSILDPS-IASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD + IA++   +  EK+VD+AL C+E     RP+M EVVKEIE IM   G+NP+ 
Sbjct  713  LQELLDSTIIAANENLKGFEKYVDLALICVEPEGVNRPSMNEVVKEIEYIMYHAGINPNV  772

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S ++   SKGS   Y + S   Y+   P
Sbjct  773  DSAASSRTFDEASKGSGDLYRNNSFE-YSASFP  804



>ref|XP_010482266.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Camelina sativa]
Length=952

 Score =   253 bits (647),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++NILLDE L AKVADFGLS+ + E EKA+ T QVKG
Sbjct  734  GSGKGLAYLHELADPPIIHRDVKSSNILLDESLAAKVADFGLSQLVEEAEKANATAQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMTNQLTEKSDVY FGV++LE++T   PI  GKY+V+EVK  M+K+K +YD
Sbjct  794  TMGYLDPEYYMTNQLTEKSDVYGFGVMMLELLTGEIPIVNGKYVVKEVKMKMNKSKKLYD  853

Query  393  LQSILDPSIASSV-TPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD +I S+       EKFVD+AL C++    +RP+M EVVKEIE IM+  GL P+ 
Sbjct  854  LQELLDTTIISTNENLNGFEKFVDLALICVDQEGVKRPSMNEVVKEIEYIMQHAGLYPNV  913

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S +Y   SKGS   Y + S   Y+   P
Sbjct  914  DSAASSRTYDEASKGSGDLYRNNSFE-YSASFP  945



>ref|XP_007212514.1| hypothetical protein PRUPE_ppa017853mg, partial [Prunus persica]
 gb|EMJ13713.1| hypothetical protein PRUPE_ppa017853mg, partial [Prunus persica]
Length=899

 Score =   252 bits (644),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 148/188 (79%), Gaps = 3/188 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  NPPIIHRDIK+NNILLD+ L AKVADFGLSKS+ +    HVTTQVKG
Sbjct  698  GAARGLAYLHEHANPPIIHRDIKSNNILLDKDLTAKVADFGLSKSMADSGTDHVTTQVKG  757

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIE+GK+IVR V+ AMDKTKD+Y+
Sbjct  758  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARRPIEQGKFIVRVVQMAMDKTKDLYN  817

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ +LDP I      + LE FVD+A+ C+E+   +RP M EVVK IE+I ++  LN   +
Sbjct  818  LREVLDPHIGLGTELKGLEIFVDLAMSCVEESQDKRPRMGEVVKVIENITQLAALN---N  874

Query  213  SASTSESY  190
            S S S SY
Sbjct  875  STSNSASY  882



>ref|XP_006385117.1| hypothetical protein POPTR_0004s24080g [Populus trichocarpa]
 gb|ERP62914.1| hypothetical protein POPTR_0004s24080g [Populus trichocarpa]
Length=880

 Score =   252 bits (643),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 123/214 (57%), Positives = 164/214 (77%), Gaps = 4/214 (2%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            +A+G+ YLH+L NPPIIHRDIK+ NILLD++L AKVADFGLSK +   E  HV+T VKGT
Sbjct  660  SARGIAYLHELANPPIIHRDIKSTNILLDDQLIAKVADFGLSKPVDNNE-VHVSTGVKGT  718

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAM--DKTKDMY  397
            +GYLDPEY+M+ QLTEKSDVYSFGVV+LE++T R PIE G Y+VREVK AM   +TKD  
Sbjct  719  LGYLDPEYFMSGQLTEKSDVYSFGVVMLELVTGRKPIEHGSYVVREVKTAMGNQRTKDSS  778

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            +L +ILDP++      + LEKF+D+A+RC+E++AA RPTM EVVKE+E+I ++ G N +A
Sbjct  779  NLDAILDPALDPGKPLKGLEKFIDLAIRCVEELAANRPTMNEVVKELENIQQLAGFNGNA  838

Query  216  DSASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            +  STS++YS  ++GS  H Y+  +   Y+G  P
Sbjct  839  EMVSTSKTYSETTEGSFYHDYNKNAFFEYSGTFP  872



>ref|XP_010442449.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
 ref|XP_010442450.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Camelina sativa]
Length=861

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 159/213 (75%), Gaps = 2/213 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+ KGL YLH+L +PPIIHRD+K++NILLDE L AKVADFGLS+ + E EKA VT QVKG
Sbjct  643  GSGKGLAYLHELADPPIIHRDVKSSNILLDESLAAKVADFGLSQLVEEAEKASVTAQVKG  702

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MT+QLTEKSDVY FGV++LE++T   PI  GKY+V+EVK  M+K+K +YD
Sbjct  703  TMGYLDPEYFMTSQLTEKSDVYGFGVMMLELLTGEIPIVNGKYVVKEVKMKMNKSKKLYD  762

Query  393  LQSILDPSIASSV-TPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            LQ +LD +I S+    +  EKFVD+AL C++    +RP+M EVVKEIE IM+  GL P+ 
Sbjct  763  LQELLDTTIISTNENLKGFEKFVDLALICVDQEGVKRPSMNEVVKEIEYIMQHAGLYPNV  822

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            DSA++S +Y   SKGS   Y + S   Y+   P
Sbjct  823  DSAASSRTYDEASKGSGDLYRNNSFE-YSASFP  854



>ref|XP_008227086.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Prunus mume]
Length=934

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 148/188 (79%), Gaps = 3/188 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  NPPIIHRDIK+NNILLD+ L AKVADFGLSKS+ +    HVTTQVKG
Sbjct  733  GAARGLAYLHEHANPPIIHRDIKSNNILLDKDLTAKVADFGLSKSMADSGTDHVTTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIE+GKYIVR V+ AMDKTK++Y+
Sbjct  793  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARRPIERGKYIVRVVQMAMDKTKELYN  852

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ +LDP I      + LE FVD+A+ C+E+   +RP M EVVK IE+I ++  LN   +
Sbjct  853  LREVLDPYIGLGTELKGLEIFVDLAMSCVEESQDKRPRMGEVVKVIENITQLAALN---N  909

Query  213  SASTSESY  190
            S S S SY
Sbjct  910  STSNSASY  917



>ref|XP_004137665.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cucumis sativus]
 ref|XP_004160329.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Cucumis sativus]
 gb|KGN58673.1| hypothetical protein Csa_3G727910 [Cucumis sativus]
Length=966

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE LNAKVADFGLSK + + EK HV+TQVKG
Sbjct  735  GSARGLAYLHELANPPIIHRDVKSTNILLDEHLNAKVADFGLSKLVSDNEKGHVSTQVKG  794

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE++T + PIEKGKY+VREV+  M+K+ ++ Y
Sbjct  795  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTGKLPIEKGKYVVREVRMLMNKSEEEYY  854

Query  396  DLQSILDPSIASSVTP-RSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
             L+ I+D +I ++ T    L +F+++A+RC+E+ A  RPTM E+VK IESI++  G+N +
Sbjct  855  GLKQIMDVTILNNTTTIIGLGRFLELAMRCVEESAGDRPTMSEMVKAIESILQNDGINTN  914

Query  219  ADSASTSESYSGVSKGS-EHPYSD  151
              SAS+S +  G S+ +  HPY+D
Sbjct  915  TTSASSSATDFGASRNAPRHPYND  938



>gb|EEC69015.1| hypothetical protein OsI_37810 [Oryza sativa Indica Group]
Length=953

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 163/215 (76%), Gaps = 7/215 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPIIHRDIK++N+LLDERLNAKV+DFGLSK LGE  +  +TTQVKG
Sbjct  729  GAAKGIAYLHELADPPIIHRDIKSSNVLLDERLNAKVSDFGLSKLLGEDGRGQITTQVKG  788

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLT++SDVYSFGV+LLE+ITAR P+E+G+Y+VREVK+A+D+ KDMY 
Sbjct  789  TMGYLDPEYYMTQQLTDRSDVYSFGVLLLEVITARKPLERGRYVVREVKEAVDRRKDMYG  848

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP++ +S     LE +VD+ALRC+E+  A RP+M E V EIE I ++ G    A 
Sbjct  849  LHELLDPALGASSALAGLEPYVDLALRCVEESGADRPSMGEAVAEIERIAKVAGAGGAAA  908

Query  213  SASTSE---SYSGVSKGSEHPY---SDESLSVYTG  127
            + S +    SY+  S+   HPY     +S S Y+G
Sbjct  909  AESAASDSMSYA-ASRTPRHPYGGGGGDSASEYSG  942



>ref|XP_008804670.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
 ref|XP_008804671.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Phoenix dactylifera]
Length=951

 Score =   251 bits (640),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 121/203 (60%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE LNAKVADFGLSK + + +K HV+TQVKG
Sbjct  723  GSARGLAYLHELANPPIIHRDVKSTNILLDESLNAKVADFGLSKLVSDSQKGHVSTQVKG  782

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKD-MY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+ITA+ PIEKGKYIVREV+ A+D+  D  Y
Sbjct  783  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELITAKQPIEKGKYIVREVRTAIDRYDDEYY  842

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DP + ++       +FV++A++C+E+ AA RPTM +VVKEIE I++  GLN  +
Sbjct  843  GLKEMMDPVLQNTAILTGFRRFVELAMQCVEESAANRPTMSDVVKEIEMILQQDGLNTTS  902

Query  216  DSASTSESYSGVSKGSEHPYSDE  148
            +S S+S +  G +KG+ HPY ++
Sbjct  903  NSESSSATEFGNTKGTRHPYDNQ  925



>ref|XP_009387702.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=961

 Score =   251 bits (640),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 122/205 (60%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L+AKVADFGLSK + + +K HV+TQVKG
Sbjct  734  GSARGLAYLHELANPPIIHRDVKSTNILLDESLDAKVADFGLSKLVSDSKKGHVSTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAM-DKTKDMY  397
            T+GYLDPEYYMT QL+EKSD YSFGVV+LE+I+AR PIEKGKYIVREV+ A+ D  ++ Y
Sbjct  794  TLGYLDPEYYMTQQLSEKSDAYSFGVVMLELISARQPIEKGKYIVREVRMAINDYDEEWY  853

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DP++ ++   +   +FV++A+RC+E+ AA RPTM E VKEIE+I++  G N  A
Sbjct  854  GLKEMVDPAMRNTGNLKGFRRFVELAMRCVEESAANRPTMNEAVKEIETILQSNGFNTQA  913

Query  216  DSASTSESYSGVSKGS-EHPYSDES  145
             S+S+S +  G S GS  HPYSD +
Sbjct  914  SSSSSSTTDFGNSHGSPRHPYSDHT  938



>ref|XP_007156284.1| hypothetical protein PHAVU_003G273700g [Phaseolus vulgaris]
 gb|ESW28278.1| hypothetical protein PHAVU_003G273700g [Phaseolus vulgaris]
Length=965

 Score =   250 bits (639),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  733  GSARGLAYLHELANPPIIHRDVKSTNILLDENLTAKVADFGLSKLVSDSEKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+IT+R PIEKGKYIVREV+  M+K  ++ Y
Sbjct  793  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITSRQPIEKGKYIVREVRTLMNKNDEEHY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DP + ++ T     +F+++A++C+E+ AA RPTM EVVK +E+I++  G+N ++
Sbjct  853  GLRELMDPVVRNTPTLIGFGRFLELAMQCVEESAADRPTMSEVVKALETILQNDGMNTNS  912

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTG  127
             SAS+S +  GVSKG  HPY D S +   G
Sbjct  913  TSASSSATDFGVSKGMRHPYIDASFNKNNG  942



>ref|XP_008442305.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Cucumis melo]
Length=965

 Score =   249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE LNAKVADFGLSK + + EK HV+TQVKG
Sbjct  734  GSARGLAYLHELANPPIIHRDVKSTNILLDEHLNAKVADFGLSKLVSDNEKGHVSTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE++T + PIEKGKY+VREV+  M+K+ ++ Y
Sbjct  794  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELLTGKLPIEKGKYVVREVRMLMNKSEEEYY  853

Query  396  DLQSILDPSIASSVTP-RSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
             L+ ++D +I ++ T    L +F+++A++C+E+ A  RPTM EVVK IESI++  G+N +
Sbjct  854  GLKQLMDATILNNTTTIIGLGRFLELAMQCVEESAVDRPTMSEVVKAIESILQNDGINTN  913

Query  219  ADSASTSESYSGVSKGS-EHPYSD  151
              SAS+S +  G S+ +  HPY+D
Sbjct  914  TTSASSSATDFGASRTAHRHPYND  937



>ref|XP_009600216.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana tomentosiformis]
Length=964

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 160/206 (78%), Gaps = 2/206 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLD+ L AKVADFGLSK + +  K HV+TQVKG
Sbjct  733  GSARGLAYLHELANPPIIHRDVKSTNILLDQNLTAKVADFGLSKLVSDSSKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKD-MY  397
            T+GYLDPEYY+T QLTEKSDVYSFGVV+LE+ITA+ PIEKGKY+VREV+ A++K  D  Y
Sbjct  793  TLGYLDPEYYLTQQLTEKSDVYSFGVVMLEMITAKQPIEKGKYVVREVRAAINKNDDEHY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L  ++DP I S+    +  KFVD+A++C+E+ AA RPTM EVVK +E+I++  GL  ++
Sbjct  853  GLSDMIDPVIRSAPNLIAFTKFVDLAMQCVEESAADRPTMSEVVKMLETILQNDGLETNS  912

Query  216  DSASTSESYSGVS-KGSEHPYSDESL  142
             SAS+S +  G +   S HPY+ ++L
Sbjct  913  TSASSSITDFGTAIAASRHPYNKDAL  938



>ref|NP_001066400.1| Os12g0210400 [Oryza sativa Japonica Group]
 gb|ABA96703.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29419.1| Os12g0210400 [Oryza sativa Japonica Group]
 dbj|BAG91081.1| unnamed protein product [Oryza sativa Japonica Group]
Length=967

 Score =   249 bits (636),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 126/215 (59%), Positives = 163/215 (76%), Gaps = 7/215 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPIIHRDIK++N+LLDERLNAKV+DFGLSK LGE  +  +TTQVKG
Sbjct  743  GAAKGIAYLHELADPPIIHRDIKSSNVLLDERLNAKVSDFGLSKLLGEDGRGQITTQVKG  802

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLT++SDVYSFGV+LLE+ITAR P+E+G+Y+VREVK+A+D+ KDMY 
Sbjct  803  TMGYLDPEYYMTQQLTDRSDVYSFGVLLLEVITARKPLERGRYVVREVKEAVDRRKDMYG  862

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP++ +S     LE +VD+ALRC+E+  A RP+M E V EIE I ++ G    A 
Sbjct  863  LHELLDPALGASSALAGLEPYVDLALRCVEESGADRPSMGEAVAEIERIAKVAGAGGAAA  922

Query  213  SASTSE---SYSGVSKGSEHPY---SDESLSVYTG  127
            + S +    SY+  S+   HPY     +S S Y+G
Sbjct  923  AESAASDSMSYAA-SRTPRHPYGGGGGDSASEYSG  956



>ref|XP_009761326.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nicotiana sylvestris]
Length=961

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 160/205 (78%), Gaps = 3/205 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLD+ L AKVADFGLSK + +  K HV+TQVKG
Sbjct  733  GSARGLAYLHELANPPIIHRDVKSTNILLDQNLTAKVADFGLSKLVSDSSKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKD-MY  397
            T+GYLDPEYY+T QLTEKSDVYSFGVV+LE+ITA+ PIEKGKY+VREV+ A++K  D  Y
Sbjct  793  TLGYLDPEYYLTQQLTEKSDVYSFGVVMLEMITAKQPIEKGKYVVREVRAAINKNDDEHY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L  ++DP I S+    +  KFVD+A++C+E+ AA RPTM EVVK +E+I++  GL  ++
Sbjct  853  GLSDMIDPIIRSAPNLIAFTKFVDLAMQCVEESAADRPTMSEVVKMLETILQNDGLETNS  912

Query  216  DSASTSESYSGVSKGSEHPYSDESL  142
             SAS+S +  G + G  HPY+ ++L
Sbjct  913  TSASSSITDFGTAIG--HPYNKDAL  935



>ref|XP_008245810.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770, partial [Prunus mume]
Length=423

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV++QVKG
Sbjct  192  GSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVADFGLSKLVADSGKGHVSSQVKG  251

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T GYLDPEYY T+QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+  MDK  ++ Y
Sbjct  252  TPGYLDPEYYTTHQLTEKSDVYSFGVVMLELITARQPIEKGKYIVREVRLMMDKNDEEHY  311

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++D SI +S T     +F+++AL+C+E+ AA RPTM E+VK IE+I++  G+N ++
Sbjct  312  GLRELMDRSIQNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAIETILQNDGMNTNS  371

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             SAS+S +    SKG+ +HPY+D
Sbjct  372  TSASSSATEFAASKGAPKHPYND  394



>ref|XP_006852584.1| hypothetical protein AMTR_s00021p00213800 [Amborella trichopoda]
 gb|ERN14051.1| hypothetical protein AMTR_s00021p00213800 [Amborella trichopoda]
Length=962

 Score =   248 bits (634),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 126/208 (61%), Positives = 163/208 (78%), Gaps = 3/208 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE LNAKVADFGLSK + +  K HV+TQVKG
Sbjct  731  GSARGLAYLHELANPPIIHRDVKSTNILLDENLNAKVADFGLSKLVADTGKGHVSTQVKG  790

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK--TKDM  400
            T+GYLDPEYYMT QLT+KSDVYSFGVV+LE++TAR PIEKGKYIVREV+ AM+     ++
Sbjct  791  TLGYLDPEYYMTQQLTDKSDVYSFGVVMLELLTARQPIEKGKYIVREVRMAMENAGADEL  850

Query  399  YDLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
            Y L+ ILDP++  S       +FV++A++C+E+ A+ RPTM EVVKEIESI++  GLN +
Sbjct  851  YGLRQILDPNLGISGGLMGFRRFVELAMKCVEESASDRPTMSEVVKEIESILQNDGLNTN  910

Query  219  ADSASTSESYSGVSKGS-EHPYSDESLS  139
            + SAS+S +  G+ KG+  HPY    +S
Sbjct  911  STSASSSATDFGIGKGAPRHPYDGTIMS  938



>ref|XP_011461103.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011461104.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
 ref|XP_011461105.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Fragaria vesca subsp. vesca]
Length=939

 Score =   248 bits (633),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKGL YLH+  NP IIHRDIK+NNILLD  L AKVADFGL KS+ + EK ++TTQVKG
Sbjct  725  GAAKGLAYLHEYANPVIIHRDIKSNNILLDNDLEAKVADFGLCKSMADSEKDYITTQVKG  784

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEYYMT QLTEKSDVYSFGVVLLE+ITAR PIE+GKYIVR V+ A+DK+KD Y+
Sbjct  785  TMGYLDPEYYMTQQLTEKSDVYSFGVVLLELITARRPIERGKYIVRVVQSAIDKSKDSYN  844

Query  393  LQSILDPSI-ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVG--LNP  223
            L+ +LDP+I   +   + LE FVD+A+ C++++ A+RP M  VVKEIE+I+++     N 
Sbjct  845  LREVLDPNIDLGNDQLKGLEMFVDLAMLCVDELRAKRPRMGAVVKEIENIIQISAAKWNA  904

Query  222  HADSASTSESY  190
             A+SA+TS SY
Sbjct  905  GANSAATSASY  915



>ref|XP_006338928.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Solanum tuberosum]
Length=964

 Score =   248 bits (633),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 159/206 (77%), Gaps = 2/206 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLD+ L AKV DFGLSK + +  K HV+TQVKG
Sbjct  733  GSARGLAYLHELANPPIIHRDVKSTNILLDQNLTAKVGDFGLSKLVSDSSKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITA+ PIEKGKY+VRE++ A++K  ++ Y
Sbjct  793  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITAKQPIEKGKYVVREMRTAINKNDEEHY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L +++DP I +        +FVDVA++C+E+ AA RPTM EVVK +ESI++  GL  ++
Sbjct  853  GLSNMIDPVIRNMPNLIGFTRFVDVAMQCVEEAAADRPTMSEVVKMLESILQNDGLETNS  912

Query  216  DSASTSESYSGVS-KGSEHPYSDESL  142
             SAS+S +  G +   S HPY+ E+L
Sbjct  913  TSASSSITDFGTAIAASRHPYNKEAL  938



>ref|XP_010275979.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Nelumbo nucifera]
Length=964

 Score =   248 bits (632),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 158/203 (78%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLHDL NPPIIHRD+K++NILLDE L AKVADFGLSK + +  K H++TQVKG
Sbjct  734  GSARGLAYLHDLANPPIIHRDVKSSNILLDENLTAKVADFGLSKLVSDSTKEHISTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T+GYLDPEYYMT QLT+KSDVYSFGVV+LEIITA+ PIEKGKYIVREVK  +DK  + Y 
Sbjct  794  TLGYLDPEYYMTQQLTQKSDVYSFGVVMLEIITAKQPIEKGKYIVREVKLEIDKNDEHYG  853

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ ++DP+I S   P     FV++A+ C+E+ A  RPTM +VVKEIESI+   GLN ++ 
Sbjct  854  LKDLIDPNIGSVANPICFANFVELAMHCVEESAVDRPTMSDVVKEIESILRNDGLNTNST  913

Query  213  SASTSESYSGVSKGS--EHPYSD  151
            SAS+S +    SKG+   HPY++
Sbjct  914  SASSSATDFVFSKGTIPRHPYNE  936



>gb|KCW47574.1| hypothetical protein EUGRSUZ_K01321 [Eucalyptus grandis]
Length=955

 Score =   248 bits (632),  Expect = 6e-72, Method: Composition-based stats.
 Identities = 129/203 (64%), Positives = 159/203 (78%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+G+ YLHDL NPPIIHRDIK+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  723  GSARGIAYLHDLANPPIIHRDIKSTNILLDENLMAKVADFGLSKLVSDSEKGHVSTQVKG  782

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMD-KTKDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+ AMD K  + Y
Sbjct  783  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARQPIEKGKYIVREVRTAMDAKDDEYY  842

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+  +DPSI +         F+++A+RC+E+ A  RPTM EVVK IESI++  G+N ++
Sbjct  843  GLREKIDPSIRNPGYLVGFAIFLELAMRCVEESALDRPTMSEVVKTIESILQHDGVNTNS  902

Query  216  DSASTSESYSGVSKG-SEHPYSD  151
             SAS+S +  G SKG  +HPY+D
Sbjct  903  TSASSSTTEFGASKGPPKHPYND  925



>ref|XP_010038738.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=959

 Score =   248 bits (632),  Expect = 6e-72, Method: Composition-based stats.
 Identities = 129/203 (64%), Positives = 159/203 (78%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+G+ YLHDL NPPIIHRDIK+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  727  GSARGIAYLHDLANPPIIHRDIKSTNILLDENLMAKVADFGLSKLVSDSEKGHVSTQVKG  786

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMD-KTKDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+ AMD K  + Y
Sbjct  787  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARQPIEKGKYIVREVRTAMDAKDDEYY  846

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+  +DPSI +         F+++A+RC+E+ A  RPTM EVVK IESI++  G+N ++
Sbjct  847  GLREKIDPSIRNPGYLVGFAIFLELAMRCVEESALDRPTMSEVVKTIESILQHDGVNTNS  906

Query  216  DSASTSESYSGVSKG-SEHPYSD  151
             SAS+S +  G SKG  +HPY+D
Sbjct  907  TSASSSTTEFGASKGPPKHPYND  929



>ref|XP_011077100.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=963

 Score =   247 bits (631),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 158/203 (78%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  733  GSARGLAYLHELAHPPIIHRDVKSTNILLDENLTAKVADFGLSKLVSDSTKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDM-Y  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+IT+R PIEKGKYIVREV+ AMDK  +  Y
Sbjct  793  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITSRQPIEKGKYIVREVRIAMDKDDETHY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ I+DP+I  +       +F+++A++C+E+ A+ RPTM E+VK +E+I++  G+N + 
Sbjct  853  GLREIMDPAIRDTPNLIGFPRFLELAMQCVEESASDRPTMSEIVKALETILQDDGINTNT  912

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             S S+S +  G + G+  HPY+D
Sbjct  913  TSESSSATEFGAANGAPRHPYND  935



>ref|XP_010044547.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=984

 Score =   247 bits (631),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  754  GSAKGLAYLHELANPPIIHRDVKSTNILLDENLVAKVADFGLSKMVADSEKGHVSTQVKG  813

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT  LT+KSDVYSFGVV+LE+ITA+PP+ KGKYIVREV+ AMDK  +D Y
Sbjct  814  TLGYLDPEYYMTQLLTDKSDVYSFGVVMLELITAKPPLNKGKYIVREVRMAMDKNDQDCY  873

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DPS+ +         FV++A+RCLED++  RP M EVVKEIE I++  G+    
Sbjct  874  GLRQVMDPSLLNVGCLAGFTGFVELAMRCLEDLSMNRPRMNEVVKEIEVILQAEGIATST  933

Query  216  DSASTSESYSGVSKGSEHPYSDESLS  139
             SA+     S     +   Y+D SLS
Sbjct  934  TSAARDVRASHYGAPTHPFYTDVSLS  959



>ref|XP_007147540.1| hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris]
 gb|ESW19534.1| hypothetical protein PHAVU_006G133200g [Phaseolus vulgaris]
Length=944

 Score =   247 bits (630),  Expect = 8e-72, Method: Composition-based stats.
 Identities = 122/207 (59%), Positives = 157/207 (76%), Gaps = 5/207 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  +PPIIHRDIK+NNILLD+  NAKV+DFGLSKS+ + +K HVTTQVKG
Sbjct  722  GAARGLAYLHEHADPPIIHRDIKSNNILLDKNYNAKVSDFGLSKSILDDDKDHVTTQVKG  781

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDP+YY + +LTEKSDVYSFGV++LE+ITA+ PIE+GKYIV+ V+  +DKTKD+Y 
Sbjct  782  TMGYLDPDYYTSQRLTEKSDVYSFGVLMLELITAKKPIERGKYIVKVVRNTIDKTKDLYG  841

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  I+DPSI S  T    E FVD+A+ CL++    RPTM EVV EIE ++  VGLN  ++
Sbjct  842  LHEIIDPSICSGSTLEGFENFVDLAMECLKESGVDRPTMSEVVTEIEDMLRSVGLNLTSE  901

Query  213  SASTSE-----SYSGVSKGSEHPYSDE  148
            S +++        S VS   +HPYS+E
Sbjct  902  SVASTSSSHRFEVSIVSSQQDHPYSNE  928



>gb|KCW88500.1| hypothetical protein EUGRSUZ_A00886 [Eucalyptus grandis]
Length=975

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  745  GSAKGLAYLHELANPPIIHRDVKSTNILLDENLVAKVADFGLSKMVADSEKGHVSTQVKG  804

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT  LT+KSDVYSFGVV+LE+ITA+PP+ KGKYIVREV+ AMDK  +D Y
Sbjct  805  TLGYLDPEYYMTQLLTDKSDVYSFGVVMLELITAKPPLNKGKYIVREVRMAMDKNDQDCY  864

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DPS+ +         FV++A+RCLED++  RP M EVVKEIE I++  G+    
Sbjct  865  GLRQVMDPSLLNVGCLAGFTGFVELAMRCLEDLSMNRPRMNEVVKEIEVILQAEGIATST  924

Query  216  DSASTSESYSGVSKGSEHPYSDESLS  139
             SA+     S     +   Y+D SLS
Sbjct  925  TSAARDVRASHYGAPTHPFYTDVSLS  950



>ref|XP_010088707.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXB36888.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=663

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 143/185 (77%), Gaps = 1/185 (1%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
             A+GL YLH+L +PP+IHRDIK+ N+LLD  LNAKVA+FGLSK +G+ EK HVTTQVKGT
Sbjct  361  TARGLAYLHELADPPVIHRDIKSTNVLLDNHLNAKVANFGLSKLVGDSEKDHVTTQVKGT  420

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            MGY+DPEYY T +LTE+SDVYSFGV++LE+ITAR PIE+GKYIVREV+  +DKTKD+Y+L
Sbjct  421  MGYIDPEYYTTQRLTERSDVYSFGVLMLELITARRPIERGKYIVREVRTTLDKTKDLYNL  480

Query  390  QSILDPSIASSVTP-RSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
             ++LD  I    T     E FVD+A+RC+ED    RPTM EV KEIE+I +    N   +
Sbjct  481  HTVLDLGIVGFATRLDGFESFVDLAMRCVEDEGVDRPTMSEVAKEIETIAQHPSSNLDKE  540

Query  213  SASTS  199
            S STS
Sbjct  541  STSTS  545


 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  624  KSLGEQEKAHVTTQVKGTMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKY  445
            +++ +   +++  +   T GY+DPEYY T +LTE+SDVYSFGV++LE+ITAR PIE+GKY
Sbjct  527  ETIAQHPSSNLDKESTSTSGYIDPEYYTTQRLTERSDVYSFGVLMLELITARRPIERGKY  586

Query  444  IVREVKQAMDKTKDMYDLQSILDPSIASSVTP-RSLEKFVDVALRCLEDVAAQRPTMREV  268
            IVREV+  +DKTKD+Y+L ++LD  I    T     E+FVD+A+RC+ D    RPTM EV
Sbjct  587  IVREVRTTLDKTKDLYNLHTVLDLGIVGFATRLDGFERFVDLAMRCVGDEGVDRPTMSEV  646

Query  267  VKEIESIMEMVGLN  226
             KEIE+I +   LN
Sbjct  647  AKEIETIAQHPSLN  660



>ref|XP_004249557.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Solanum lycopersicum]
Length=964

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 158/206 (77%), Gaps = 2/206 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLD+ L AKV DFGLSK + +  K HV+TQVKG
Sbjct  733  GSARGLAYLHELANPPIIHRDVKSTNILLDQNLTAKVGDFGLSKLVSDSSKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITA+ PIEKGKY+VRE++ A+ K  ++ Y
Sbjct  793  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITAKQPIEKGKYVVREMRTAIHKNDEEHY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L +++DP I +        +FVDVA++C+E+ AA RPTM EVVK +ESI++  GL  ++
Sbjct  853  GLTNMIDPVIRNMPNLIGFTRFVDVAMQCVEEAAADRPTMSEVVKMLESILQNDGLETNS  912

Query  216  DSASTSESYSGVS-KGSEHPYSDESL  142
             SAS+S +  G +   S HPY+ E+L
Sbjct  913  TSASSSITDFGTAIAASRHPYNKEAL  938



>ref|XP_004961711.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X1 [Setaria italica]
Length=977

 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 158/209 (76%), Gaps = 4/209 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K+ NILLD+ L AKVADFGLSK + + +K HV+TQVKG
Sbjct  749  GSARGLAYLHELADPPIIHRDVKSTNILLDDHLKAKVADFGLSKLVADTQKGHVSTQVKG  808

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+++ R PIE GKYIVREV+ A+D   +D Y
Sbjct  809  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIESGKYIVREVRLAIDPNDRDYY  868

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIM--EMVGLNP  223
             L+++LDP+I  S       +FV +A+RC+++ AA RP M EVVKEIE+++  E+ G + 
Sbjct  869  GLRALLDPAIRDSARTAGFRRFVQLAMRCVDESAAARPAMGEVVKEIEAMLQNEVSGADG  928

Query  222  HADSASTSESYSGVSKGSE-HPYSDESLS  139
             + + S++  + G   G+  HPYSD  ++
Sbjct  929  ASSAGSSATEFDGAGGGARAHPYSDTEIT  957



>ref|XP_004961712.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like isoform X2 [Setaria italica]
Length=977

 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 158/209 (76%), Gaps = 4/209 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K+ NILLD+ L AKVADFGLSK + + +K HV+TQVKG
Sbjct  749  GSARGLAYLHELADPPIIHRDVKSTNILLDDHLKAKVADFGLSKLVADTQKGHVSTQVKG  808

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+++ R PIE GKYIVREV+ A+D   +D Y
Sbjct  809  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIESGKYIVREVRLAIDPNDRDYY  868

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIM--EMVGLNP  223
             L+++LDP+I  S       +FV +A+RC+++ AA RP M EVVKEIE+++  E+ G + 
Sbjct  869  GLRALLDPAIRDSARTAGFRRFVQLAMRCVDESAAARPAMGEVVKEIEAMLQNEVSGADG  928

Query  222  HADSASTSESYSGVSKGSE-HPYSDESLS  139
             + + S++  + G   G+  HPYSD  ++
Sbjct  929  ASSAGSSATEFDGAGGGARAHPYSDTEIT  957



>gb|KJB29747.1| hypothetical protein B456_005G116800 [Gossypium raimondii]
Length=965

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRDIK+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  732  GSARGLAYLHELANPPIIHRDIKSTNILLDENLTAKVADFGLSKLVSDSSKGHVSTQVKG  791

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMD-KTKDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITA+ PIEKGKY+VREV+  MD K  + Y
Sbjct  792  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITAKQPIEKGKYVVREVRSVMDMKDDEHY  851

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DPSI SS       KF+++A++C+ED A  RPTM +VVK IE+I++  G+N ++
Sbjct  852  GLRELMDPSIRSSGNLLGFGKFLELAMQCVEDSATDRPTMSDVVKAIETILQNDGMNTNS  911

Query  216  DSASTSESYS-GVSKGS-EHPYSD  151
             ++++S +   GV+KGS  HPY+D
Sbjct  912  TTSASSSATDFGVAKGSLRHPYAD  935



>ref|XP_010044564.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
Length=983

 Score =   246 bits (627),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 121/209 (58%), Positives = 158/209 (76%), Gaps = 4/209 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L NPPIIHRD+K+ NILLD+ L AKVADFGLSK + + EK HV+TQVKG
Sbjct  750  GSAKGLAYLHELANPPIIHRDVKSTNILLDDNLVAKVADFGLSKMVADSEKGHVSTQVKG  809

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLT++SDVYSFGVV+LE+IT++PPIEKGKYIVRE++ AMDK  +D Y
Sbjct  810  TLGYLDPEYYMTQQLTDRSDVYSFGVVMLELITSKPPIEKGKYIVREIRTAMDKNDRDYY  869

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L  ++DPS+  +       +F+++A+RC+E+ +  RP M EVVKEIE+I++M G     
Sbjct  870  GLAQVMDPSLRKAGRLAGFAQFLELAMRCVEESSTNRPRMNEVVKEIETILQMDGTVTGL  929

Query  216  DSASTSESYSGVSK--GSEHP-YSDESLS  139
             SAS+S +  G     G   P Y+D SL+
Sbjct  930  TSASSSATDFGGPNIGGPRQPLYTDVSLN  958



>ref|XP_010044506.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 ref|XP_010044514.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Eucalyptus grandis]
 gb|KCW88495.1| hypothetical protein EUGRSUZ_A00882 [Eucalyptus grandis]
Length=968

 Score =   246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 162/203 (80%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  738  GSARGLAYLHELANPPIIHRDVKSTNILLDEHLTAKVADFGLSKLVSDSGKGHVSTQVKG  797

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYM+ QLTEKSDVYSFGVV+LE+ITA+ PIEKGKY+VRE++ AMDK  +D Y
Sbjct  798  TLGYLDPEYYMSQQLTEKSDVYSFGVVMLELITAKQPIEKGKYVVREIRTAMDKNDQDYY  857

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             ++ ++DPS+ S        +F+D+A+RC+E+ AA RPTM EVVK IE++++  G++ ++
Sbjct  858  GVREMMDPSMRSMGYLVGFSRFLDLAMRCVEESAADRPTMSEVVKAIETMLQNDGIHTNS  917

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             SAS+S +  G +KG+  HPY+D
Sbjct  918  TSASSSATDFGSTKGAPRHPYND  940



>gb|EMT33703.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=915

 Score =   244 bits (624),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 158/205 (77%), Gaps = 5/205 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRDIK+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  686  GSARGLAYLHELADPPIIHRDIKSTNILLDENLKAKVADFGLSKLVADTEKGHVSTQVKG  745

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+++ R PIEKGKY+VREV+QA+D   +D Y
Sbjct  746  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIEKGKYVVREVRQAIDPADRDYY  805

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIM--EMVGLNP  223
             L++I+DP+I  +       +FV +A++C+++ AA RPTM  VVKE+E+++  E  G   
Sbjct  806  GLRAIVDPAIRDAARTPGFRRFVQLAMQCVDESAAARPTMGTVVKEVEAMLLNEPDGEGS  865

Query  222  HADSASTSESYSGVSKGS-EHPYSD  151
            ++  +S +E + G  +G+  HPYSD
Sbjct  866  NSAGSSATE-FDGAGRGAPSHPYSD  889



>emb|CDO97683.1| unnamed protein product [Coffea canephora]
Length=946

 Score =   244 bits (624),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 117/213 (55%), Positives = 156/213 (73%), Gaps = 3/213 (1%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            AA+GL YLH+L +PPIIHRD+K+NNILLD+  NAKVADFGLSK L +++K +V+TQVKGT
Sbjct  725  AARGLTYLHELASPPIIHRDVKSNNILLDDHFNAKVADFGLSKLLSDEDKGYVSTQVKGT  784

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYDL  391
            +GY+DPEYYMT QLT+KSDVYSFGVV+LE++TAR PIE+G++IVR V+ A++  K+ +  
Sbjct  785  LGYMDPEYYMTQQLTDKSDVYSFGVVMLELMTARAPIERGRHIVRVVQDAVNNPKEAFLS  844

Query  390  QSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGL--NPHA  217
              ILDP IA       LEKF+D+A+RC+++  A RPTM EVV+EIE+IM++  L  +P A
Sbjct  845  HEILDPKIAPGGKLGGLEKFLDLAMRCVQESGADRPTMGEVVREIENIMQLASLKKSPEA  904

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTGVLP  118
            D  +T  S        +H Y  +      G LP
Sbjct  905  D-VTTFISKDSTDTSDQHSYGSKDFDYSIGSLP  936



>ref|XP_003566120.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Brachypodium distachyon]
Length=971

 Score =   244 bits (624),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 156/205 (76%), Gaps = 4/205 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K+ NILLD+ L AKVADFGLSK + + EK HV+TQVKG
Sbjct  740  GSARGLAYLHELADPPIIHRDVKSTNILLDDNLKAKVADFGLSKLVADTEKGHVSTQVKG  799

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+++ R PIEKGKYIVREV+QA+D   +D Y
Sbjct  800  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIEKGKYIVREVRQAIDPADRDHY  859

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIM--EMVGLNP  223
             L++I+DP+I  +       +FV +A++C+++ AA RP M  VVKE+E+++  E  G   
Sbjct  860  GLRAIVDPAIRDAARTAGFRRFVQLAMQCVDESAAARPAMGTVVKEVEAMLLNEPAGDGG  919

Query  222  HADSASTSESYSGVSKGS-EHPYSD  151
             + + S++  + G  +G+  HPYSD
Sbjct  920  VSSAGSSATEFEGAGRGAPAHPYSD  944



>gb|KHN40741.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=945

 Score =   244 bits (624),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 158/210 (75%), Gaps = 6/210 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  +PPIIHRDIK+NNILL+E   AKV+DFGLSKS+ + EK +V+TQVKG
Sbjct  722  GAARGLAYLHEHADPPIIHRDIKSNNILLNENYTAKVSDFGLSKSILDDEKDYVSTQVKG  781

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDP+YY + +LTEKSDVYSFGV++LE+ITAR PIE+GKYIV+ V+  +DKTKD+Y 
Sbjct  782  TMGYLDPDYYTSQKLTEKSDVYSFGVLILELITARKPIERGKYIVKVVRSTIDKTKDLYG  841

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLN---P  223
            L  I+DP+I S  T    EKFVD+A+ C+ED  A RP M +VVKEIE +++ VG++    
Sbjct  842  LHKIIDPAICSGSTLEGFEKFVDLAMECVEDSGADRPAMSDVVKEIEDMLQSVGMHLTSE  901

Query  222  HADSASTSESYSGVSKGSEH---PYSDESL  142
               S ++S  Y  VS  S H   PYS+ES 
Sbjct  902  SVTSTTSSHRYQEVSIVSFHLDQPYSNESF  931



>ref|XP_003535032.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Glycine max]
Length=945

 Score =   244 bits (624),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 158/210 (75%), Gaps = 6/210 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+  +PPIIHRDIK+NNILL+E   AKV+DFGLSKS+ + EK +V+TQVKG
Sbjct  722  GAARGLAYLHEHADPPIIHRDIKSNNILLNENYTAKVSDFGLSKSILDDEKDYVSTQVKG  781

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDP+YY + +LTEKSDVYSFGV++LE+ITAR PIE+GKYIV+ V+  +DKTKD+Y 
Sbjct  782  TMGYLDPDYYTSQKLTEKSDVYSFGVLILELITARKPIERGKYIVKVVRSTIDKTKDLYG  841

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLN---P  223
            L  I+DP+I S  T    EKFVD+A+ C+ED  A RP M +VVKEIE +++ VG++    
Sbjct  842  LHKIIDPAICSGSTLEGFEKFVDLAMECVEDSGADRPAMSDVVKEIEDMLQSVGMHLTSE  901

Query  222  HADSASTSESYSGVSKGSEH---PYSDESL  142
               S ++S  Y  VS  S H   PYS+ES 
Sbjct  902  SVTSTTSSHRYQEVSIVSFHLDQPYSNESF  931



>ref|XP_008465343.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Cucumis melo]
 ref|XP_008465344.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Cucumis melo]
Length=883

 Score =   244 bits (622),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 162/206 (79%), Gaps = 3/206 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE LNAKVADFGLSK + +  K HV+TQVKG
Sbjct  668  GSARGLTYLHELANPPIIHRDVKSTNILLDECLNAKVADFGLSKLVSDSVKGHVSTQVKG  727

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            TMGYLDPEYYM+ QLTEKSDVYSFGVV+LE++TA+ PIEKGKYIVREV+ +M+K  ++ Y
Sbjct  728  TMGYLDPEYYMSQQLTEKSDVYSFGVVMLELLTAKLPIEKGKYIVREVRMSMNKNDEEYY  787

Query  396  DLQSILDPSIA-SSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
             L+ ILDP+I  ++       KF+++A++C+E+VAA RPTM EVVK IE I++  G+N  
Sbjct  788  GLKHILDPTIFDNTANLIGFGKFLELAMQCVEEVAANRPTMSEVVKAIEKILQNDGINTS  847

Query  219  ADSASTSESYSGVSK-GSEHPYSDES  145
            + SAS+S +    SK  S HPY+D S
Sbjct  848  STSASSSATDFVTSKTSSRHPYNDAS  873



>ref|XP_010922852.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=962

 Score =   244 bits (622),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 123/214 (57%), Positives = 166/214 (78%), Gaps = 7/214 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE LNAKVADFGLSK + + +K HV+TQVKG
Sbjct  734  GSARGLAYLHELANPPIIHRDVKSTNILLDENLNAKVADFGLSKLVSDSQKGHVSTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+IT + PIEKGKYIVREV+ A+D+  ++ Y
Sbjct  794  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELITCKQPIEKGKYIVREVRMAIDRYDEEYY  853

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ I+DP + ++      ++FV++A++C+E+ AA RPTM +VVKEIE +++  GLN  +
Sbjct  854  GLKEIMDPVLQNTANLMGFKRFVELAMQCVEESAANRPTMSDVVKEIEIMLQQDGLNTTS  913

Query  216  DSASTSESYSGVSKGSEHPYS------DESLSVY  133
            +SAS+S +  G +K + HPY       DES S +
Sbjct  914  NSASSSATDFGNTKVTRHPYDGQLSRRDESSSAF  947



>ref|XP_010113026.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXC35197.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=964

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  731  GSARGLAYLHELANPPIIHRDVKSTNILLDENLGAKVADFGLSKLVSDSAKGHVSTQVKG  790

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITA+ PIEKGKYIVREV+ AM++  +++Y
Sbjct  791  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITAKQPIEKGKYIVREVRLAMNRNEEELY  850

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DPSI ++       +F+++A++C+E+ AA RPTM EVVK IE+I++  G+N ++
Sbjct  851  GLRDMMDPSIRNTPNLIGFGRFLELAMQCVEESAADRPTMSEVVKAIETILQNDGINTNS  910

Query  216  DSASTSESYSGVSKGS--EHPYSD  151
             SAS+S +  G SKG+   HPY D
Sbjct  911  TSASSSATDFGSSKGAALRHPYID  934



>ref|XP_006385111.1| hypothetical protein POPTR_0004s24020g [Populus trichocarpa]
 gb|ERP62908.1| hypothetical protein POPTR_0004s24020g [Populus trichocarpa]
Length=911

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+LVNP IIHRD+K+ NILLDE LNAKVADFGLSK +   E    TTQVKG
Sbjct  704  GAARGLAYLHELVNPRIIHRDVKSANILLDESLNAKVADFGLSKPMDNSELILATTQVKG  763

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGY+DPEY  T  LTEKSDVY FGVVLLE+++ R P+E+GKY+V EV  ++D+ KD+Y 
Sbjct  764  TMGYIDPEYQKTLLLTEKSDVYGFGVVLLELVSGRKPLERGKYLVAEVSSSLDRKKDLYS  823

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDPSI     P+ L+K VD+A++C+++  + RPTM EVVKEIE+I+ + G NP+A+
Sbjct  824  LHELLDPSIGLDTKPKGLDKIVDLAMKCVQEKGSDRPTMGEVVKEIENILHLAGSNPNAE  883

Query  213  SASTSESYSGVSKGSEHPYS--DESLSV  136
            + STS S+   S+  E P S  +E LS+
Sbjct  884  AESTSASFEEASQ-DEFPPSLKEEELSL  910



>emb|CDM84720.1| unnamed protein product [Triticum aestivum]
Length=924

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 153/195 (78%), Gaps = 2/195 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L NPPIIHRDIK+ NILLDE L AKVADFGLSK + + +K HV+TQVKG
Sbjct  698  GSAKGLAYLHELANPPIIHRDIKSTNILLDESLTAKVADFGLSKLVSDTQKGHVSTQVKG  757

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE++T+R PIEKGKYIVRE++ A+D+  ++ Y
Sbjct  758  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELLTSRQPIEKGKYIVREIRTAIDQYDQEYY  817

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+S++DP+I  S       +FV +A+ C+E+ AA RPTM +VVKE+E+I++  G  P  
Sbjct  818  GLKSLIDPAIRDSAKLVGFRRFVQLAMECVEESAADRPTMNDVVKELETILQNEG-GPLL  876

Query  216  DSASTSESYSGVSKG  172
            +SAS S  + G + G
Sbjct  877  NSASLSTEHFGDATG  891



>ref|XP_006385110.1| hypothetical protein POPTR_0004s24010g [Populus trichocarpa]
 gb|ERP62907.1| hypothetical protein POPTR_0004s24010g [Populus trichocarpa]
Length=901

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 157/208 (75%), Gaps = 3/208 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAA+GL YLH+LVNP IIHRD+K+ NILLDE LNAKVADFGLSK +   E    TTQVKG
Sbjct  694  GAARGLAYLHELVNPRIIHRDVKSANILLDESLNAKVADFGLSKPMDNSELILATTQVKG  753

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            T GY+DPEY  T  LTEKSDVY FGVVLLE+++ R P+E+GKY+V EV  ++D+ KD+Y+
Sbjct  754  TRGYIDPEYQETLLLTEKSDVYGFGVVLLELVSGRKPLERGKYLVAEVSSSLDRKKDLYN  813

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDPSI     P+ L+K +D+A++C+++  + RPTM EVVKEIE+I+ + GLNP+A+
Sbjct  814  LHELLDPSIGLDTKPKGLDKILDLAMKCVQEKGSDRPTMGEVVKEIENILHLAGLNPNAE  873

Query  213  SASTSESYSGVSKGSEHPYS--DESLSV  136
            + STS S+   S+  E P S  +E LS+
Sbjct  874  AESTSASFEEASQ-DEFPPSLKEEELSL  900



>ref|XP_009391654.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 164/213 (77%), Gaps = 4/213 (2%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            +A+GL YLH+L  PPIIHRD+K+ NILLD+ L+AKVADFGLS  + + +  HV+T VKGT
Sbjct  704  SARGLAYLHELAKPPIIHRDVKSTNILLDDNLSAKVADFGLSTLILDSDHGHVSTNVKGT  763

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMYD  394
            +GYLDPEY+MT QLT KSDVYSFGVV+LE+ITAR PIEKGKYIVREVK AMDK+ K+ Y 
Sbjct  764  LGYLDPEYFMTQQLTTKSDVYSFGVVMLELITARLPIEKGKYIVREVKMAMDKSDKEYYG  823

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ I+DP+I +  +    ++FV++AL+CLED +  RPTM ++VKEIE +++   L  ++ 
Sbjct  824  LRDIIDPAILNVGSLIGFQRFVELALQCLEDTSEDRPTMNDIVKEIEILLKDNRLETNSI  883

Query  213  SASTSESYSGVSKG-SEHPYSDESLS--VYTGV  124
            SAS+S +Y G ++G SE PY +  +S  V +GV
Sbjct  884  SASSSATYFGNARGASEQPYDEMPISSEVNSGV  916



>gb|KCW88501.1| hypothetical protein EUGRSUZ_A00887 [Eucalyptus grandis]
Length=904

 Score =   243 bits (620),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 120/206 (58%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  674  GSAKGLAYLHELANPPIIHRDVKSTNILLDENLVAKVADFGLSKMVADSEKGHVSTQVKG  733

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT  LT+KSDVYSFGVV+LE+ITA+PP+ KGKYIVREV+ AMDK  +D Y
Sbjct  734  TLGYLDPEYYMTQLLTDKSDVYSFGVVMLELITAKPPLNKGKYIVREVRMAMDKNDQDYY  793

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DPS+ +         FV++A+RCLE+++  RP M  VVKEIE I++  G+    
Sbjct  794  GLRQVMDPSLLNVGRLAGFTGFVELAMRCLEELSMNRPRMNGVVKEIEVILQAEGIATST  853

Query  216  DSASTSESYSGVSKGSEHPYSDESLS  139
             SA+T    S     +   Y+D SLS
Sbjct  854  TSAATDVRASHYGAPTHPLYTDVSLS  879



>ref|XP_008465342.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Cucumis melo]
Length=941

 Score =   243 bits (620),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 126/206 (61%), Positives = 162/206 (79%), Gaps = 3/206 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE LNAKVADFGLSK + +  K HV+TQVKG
Sbjct  726  GSARGLTYLHELANPPIIHRDVKSTNILLDECLNAKVADFGLSKLVSDSVKGHVSTQVKG  785

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            TMGYLDPEYYM+ QLTEKSDVYSFGVV+LE++TA+ PIEKGKYIVREV+ +M+K  ++ Y
Sbjct  786  TMGYLDPEYYMSQQLTEKSDVYSFGVVMLELLTAKLPIEKGKYIVREVRMSMNKNDEEYY  845

Query  396  DLQSILDPSI-ASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPH  220
             L+ ILDP+I  ++       KF+++A++C+E+VAA RPTM EVVK IE I++  G+N  
Sbjct  846  GLKHILDPTIFDNTANLIGFGKFLELAMQCVEEVAANRPTMSEVVKAIEKILQNDGINTS  905

Query  219  ADSASTSESYSGVSK-GSEHPYSDES  145
            + SAS+S +    SK  S HPY+D S
Sbjct  906  STSASSSATDFVTSKTSSRHPYNDAS  931



>ref|XP_010044526.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Eucalyptus grandis]
Length=985

 Score =   243 bits (620),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 120/206 (58%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  755  GSAKGLAYLHELANPPIIHRDVKSTNILLDENLVAKVADFGLSKMVADSEKGHVSTQVKG  814

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT  LT+KSDVYSFGVV+LE+ITA+PP+ KGKYIVREV+ AMDK  +D Y
Sbjct  815  TLGYLDPEYYMTQLLTDKSDVYSFGVVMLELITAKPPLNKGKYIVREVRMAMDKNDQDYY  874

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DPS+ +         FV++A+RCLE+++  RP M  VVKEIE I++  G+    
Sbjct  875  GLRQVMDPSLLNVGRLAGFTGFVELAMRCLEELSMNRPRMNGVVKEIEVILQAEGIATST  934

Query  216  DSASTSESYSGVSKGSEHPYSDESLS  139
             SA+T    S     +   Y+D SLS
Sbjct  935  TSAATDVRASHYGAPTHPLYTDVSLS  960



>gb|EEE52938.1| hypothetical protein OsJ_35570 [Oryza sativa Japonica Group]
Length=967

 Score =   243 bits (620),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 124/215 (58%), Positives = 161/215 (75%), Gaps = 7/215 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            GAAKG+ YLH+L +PPIIHRDIK++N+LLDERLNAKV+DFGLSK LGE  +  +TTQVKG
Sbjct  743  GAAKGIAYLHELADPPIIHRDIKSSNVLLDERLNAKVSDFGLSKLLGEDGRGQITTQVKG  802

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDP  YMT QLT++SDVYSFGV+LLE+ITAR P+E+G+Y+VREVK+A+D+ KDMY 
Sbjct  803  TMGYLDPGSYMTQQLTDRSDVYSFGVLLLEVITARKPLERGRYVVREVKEAVDRRKDMYG  862

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L  +LDP++ +S     LE +VD+ALRC+E+  A RP+M E V EIE I ++ G    A 
Sbjct  863  LHELLDPALGASSALAGLEPYVDLALRCVEESGADRPSMGEAVAEIERIAKVAGAGGAAA  922

Query  213  SASTSE---SYSGVSKGSEHPY---SDESLSVYTG  127
            + S +    SY+  S+   HPY     +S S Y+G
Sbjct  923  AESAASDSMSYAA-SRTPRHPYGGGGGDSASEYSG  956



>ref|XP_010044534.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Eucalyptus grandis]
Length=969

 Score =   243 bits (620),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 120/206 (58%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + + EK HV+TQVKG
Sbjct  739  GSAKGLAYLHELANPPIIHRDVKSTNILLDENLVAKVADFGLSKMVADSEKGHVSTQVKG  798

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT  LT+KSDVYSFGVV+LE+ITA+PP+ KGKYIVREV+ AMDK  +D Y
Sbjct  799  TLGYLDPEYYMTQLLTDKSDVYSFGVVMLELITAKPPLNKGKYIVREVRMAMDKNDQDYY  858

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DPS+ +         FV++A+RCLE+++  RP M  VVKEIE I++  G+    
Sbjct  859  GLRQVMDPSLLNVGRLAGFTGFVELAMRCLEELSMNRPRMNGVVKEIEVILQAEGIATST  918

Query  216  DSASTSESYSGVSKGSEHPYSDESLS  139
             SA+T    S     +   Y+D SLS
Sbjct  919  TSAATDVRASHYGAPTHPLYTDVSLS  944



>ref|XP_007208371.1| hypothetical protein PRUPE_ppa000921mg [Prunus persica]
 gb|EMJ09570.1| hypothetical protein PRUPE_ppa000921mg [Prunus persica]
Length=961

 Score =   243 bits (619),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 162/203 (80%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  730  GSARGLAYLHELANPPIIHRDVKSTNILLDEHLTAKVADFGLSKLVADGGKGHVSTQVKG  789

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+  MDK  ++ Y
Sbjct  790  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARQPIEKGKYIVREVRLMMDKNDEEHY  849

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++D SI +S T     +F+++AL+C+E+ AA RPTM E+VK IE+I++  G+N ++
Sbjct  850  GLRELMDRSIRNSGTLIGFGRFLELALQCVEESAADRPTMSELVKAIETILQNDGMNTNS  909

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             SAS+S +    SKG+ +HPY+D
Sbjct  910  TSASSSATEFAASKGAPKHPYND  932



>gb|KDP21809.1| hypothetical protein JCGZ_00596 [Jatropha curcas]
Length=610

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 163/204 (80%), Gaps = 2/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K++NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  379  GSARGLTYLHELADPPIIHRDVKSSNILLDENLTAKVADFGLSKLVSDSTKGHVSTQVKG  438

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE++TA+ PIE+GKYIVREV+ AMDK  ++ Y
Sbjct  439  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELVTAKQPIERGKYIVREVRTAMDKDDEEYY  498

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ I+D +I +S       +F+++A++C+E+ AA+RPTM EVVK IE+I++  G+N ++
Sbjct  499  GLREIMDSAIKNSGHLVGFGRFLELAMQCVEESAAERPTMSEVVKAIETILQNDGMNTNS  558

Query  216  DSASTSESYSGVSKG-SEHPYSDE  148
             SAS+S +  G S+G   HPY ++
Sbjct  559  TSASSSATDFGASRGVPRHPYHND  582



>ref|XP_011461109.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X5 [Fragaria vesca subsp. vesca]
Length=818

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+   PPIIHRDIK NNILLD+ LNAKVADFGLS+S+   ++ HVTTQVKG
Sbjct  612  GTARGLAYLHEHATPPIIHRDIKPNNILLDKDLNAKVADFGLSRSMAGSDRDHVTTQVKG  671

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MT +LTEKSDVYSFGVV+LE+ITAR PIE G+YIVR V+  MDKTK +Y+
Sbjct  672  TMGYLDPEYFMTQELTEKSDVYSFGVVMLELITARRPIEHGQYIVRVVQMRMDKTKVLYN  731

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ ILDP+I        LE FVD+A+ C++D+  +RP M +VVKEIE+I+ +   +  A+
Sbjct  732  LRDILDPAIGLVTELIGLEMFVDLAMLCVKDIRDRRPRMGQVVKEIENIINVASFDAAAN  791

Query  213  SASTSESYSGVSK-GSEHP  160
            S S S  Y  VSK GSE P
Sbjct  792  SPSASAGYEDVSKVGSEDP  810



>ref|XP_011461107.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Fragaria vesca subsp. vesca]
Length=881

 Score =   241 bits (615),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+   PPIIHRDIK NNILLD+ LNAKVADFGLS+S+   ++ HVTTQVKG
Sbjct  675  GTARGLAYLHEHATPPIIHRDIKPNNILLDKDLNAKVADFGLSRSMAGSDRDHVTTQVKG  734

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MT +LTEKSDVYSFGVV+LE+ITAR PIE G+YIVR V+  MDKTK +Y+
Sbjct  735  TMGYLDPEYFMTQELTEKSDVYSFGVVMLELITARRPIEHGQYIVRVVQMRMDKTKVLYN  794

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ ILDP+I        LE FVD+A+ C++D+  +RP M +VVKEIE+I+ +   +  A+
Sbjct  795  LRDILDPAIGLVTELIGLEMFVDLAMLCVKDIRDRRPRMGQVVKEIENIINVASFDAAAN  854

Query  213  SASTSESYSGVSK-GSEHP  160
            S S S  Y  VSK GSE P
Sbjct  855  SPSASAGYEDVSKVGSEDP  873



>ref|XP_011461106.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Fragaria vesca subsp. vesca]
Length=925

 Score =   241 bits (616),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+   PPIIHRDIK NNILLD+ LNAKVADFGLS+S+   ++ HVTTQVKG
Sbjct  719  GTARGLAYLHEHATPPIIHRDIKPNNILLDKDLNAKVADFGLSRSMAGSDRDHVTTQVKG  778

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MT +LTEKSDVYSFGVV+LE+ITAR PIE G+YIVR V+  MDKTK +Y+
Sbjct  779  TMGYLDPEYFMTQELTEKSDVYSFGVVMLELITARRPIEHGQYIVRVVQMRMDKTKVLYN  838

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ ILDP+I        LE FVD+A+ C++D+  +RP M +VVKEIE+I+ +   +  A+
Sbjct  839  LRDILDPAIGLVTELIGLEMFVDLAMLCVKDIRDRRPRMGQVVKEIENIINVASFDAAAN  898

Query  213  SASTSESYSGVSK-GSEHP  160
            S S S  Y  VSK GSE P
Sbjct  899  SPSASAGYEDVSKVGSEDP  917



>gb|EMT20930.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=971

 Score =   242 bits (617),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 153/195 (78%), Gaps = 2/195 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L NPPIIHRDIK+ NILLDE L AKVADFGLSK + + +K HV+TQVKG
Sbjct  745  GSAKGLAYLHELANPPIIHRDIKSTNILLDESLTAKVADFGLSKLVSDTQKGHVSTQVKG  804

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE++T+R PIEKGKYIVRE++ A+D+  ++ Y
Sbjct  805  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELLTSRQPIEKGKYIVREIRTAIDQYDQEYY  864

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+S++DP+I  S       +FV +A+ C+E+ AA RP+M +VVKE+E+I++  G  P  
Sbjct  865  GLKSLIDPAIRDSAKLVGFRRFVQLAMECVEESAADRPSMNDVVKELETILQNEG-GPLL  923

Query  216  DSASTSESYSGVSKG  172
            +SAS S  + G + G
Sbjct  924  NSASLSTEHFGDATG  938



>ref|XP_011461108.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Fragaria vesca subsp. vesca]
Length=874

 Score =   241 bits (615),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+   PPIIHRDIK NNILLD+ LNAKVADFGLS+S+   ++ HVTTQVKG
Sbjct  668  GTARGLAYLHEHATPPIIHRDIKPNNILLDKDLNAKVADFGLSRSMAGSDRDHVTTQVKG  727

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MT +LTEKSDVYSFGVV+LE+ITAR PIE G+YIVR V+  MDKTK +Y+
Sbjct  728  TMGYLDPEYFMTQELTEKSDVYSFGVVMLELITARRPIEHGQYIVRVVQMRMDKTKVLYN  787

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ ILDP+I        LE FVD+A+ C++D+  +RP M +VVKEIE+I+ +   +  A+
Sbjct  788  LRDILDPAIGLVTELIGLEMFVDLAMLCVKDIRDRRPRMGQVVKEIENIINVASFDAAAN  847

Query  213  SASTSESYSGVSK-GSEHP  160
            S S S  Y  VSK GSE P
Sbjct  848  SPSASAGYEDVSKVGSEDP  866



>ref|XP_004295860.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Fragaria vesca subsp. vesca]
Length=926

 Score =   241 bits (616),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G A+GL YLH+   PPIIHRDIK NNILLD+ LNAKVADFGLS+S+   ++ HVTTQVKG
Sbjct  720  GTARGLAYLHEHATPPIIHRDIKPNNILLDKDLNAKVADFGLSRSMAGSDRDHVTTQVKG  779

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
            TMGYLDPEY+MT +LTEKSDVYSFGVV+LE+ITAR PIE G+YIVR V+  MDKTK +Y+
Sbjct  780  TMGYLDPEYFMTQELTEKSDVYSFGVVMLELITARRPIEHGQYIVRVVQMRMDKTKVLYN  839

Query  393  LQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHAD  214
            L+ ILDP+I        LE FVD+A+ C++D+  +RP M +VVKEIE+I+ +   +  A+
Sbjct  840  LRDILDPAIGLVTELIGLEMFVDLAMLCVKDIRDRRPRMGQVVKEIENIINVASFDAAAN  899

Query  213  SASTSESYSGVSK-GSEHP  160
            S S S  Y  VSK GSE P
Sbjct  900  SPSASAGYEDVSKVGSEDP  918



>gb|EAZ13939.1| hypothetical protein OsJ_03866 [Oryza sativa Japonica Group]
Length=961

 Score =   241 bits (616),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L +PPIIHRDIK+ NILLDE LNAKVADFGLSK + + +K HV+TQVKG
Sbjct  733  GSAKGLAYLHELADPPIIHRDIKSTNILLDESLNAKVADFGLSKLVSDTKKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+IT+R PIEKG YIVRE++ A+D+  ++ Y
Sbjct  793  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELITSRQPIEKGTYIVREIRTAIDQYDQEYY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+S++DP+I  S       +FV +A+ C+E+ AA RPTM +VVKE+E I++  G     
Sbjct  853  GLKSLIDPTIRDSAKMVGFRRFVQLAMECVEESAADRPTMNDVVKELEIIIQNEGAQ-LL  911

Query  216  DSASTSESYSGVSKGSE-HPYSD  151
            +SAS S    G +KG +  PY D
Sbjct  912  NSASLSAQQFGYAKGRDPDPYGD  934



>ref|XP_011084699.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Sesamum indicum]
Length=953

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 164/213 (77%), Gaps = 5/213 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRDIK+ NILLD+ L AKVADFGLSK + +  K HV+TQVKG
Sbjct  733  GSARGLAYLHELANPPIIHRDIKSTNILLDDNLTAKVADFGLSKLVSDTSKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDM-Y  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE+ITA+ PIE+GKYIVREV+ AMD+  +  Y
Sbjct  793  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELITAKQPIERGKYIVREVRVAMDRNDETHY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L  ++DP+I ++       +F+++A++C+E+ A+ RPTM EVVK +E+I++  GLN ++
Sbjct  853  GLSGMIDPAIRNTPCLIGFPRFLELAIQCVEESASDRPTMSEVVKSLETILQNDGLNTNS  912

Query  216  DSASTSESYSGVSKGS-EHPYSDE---SLSVYT  130
             SAS+S +  G  KG+  HPYSD    S  +YT
Sbjct  913  TSASSSATEFGGGKGALRHPYSDAFDYSGGIYT  945



>dbj|BAD82283.1| putative receptor-like protein kinase 2 [Oryza sativa Japonica 
Group]
Length=1083

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L +PPIIHRDIK+ NILLDE LNAKVADFGLSK + + +K HV+TQVKG
Sbjct  708  GSAKGLAYLHELADPPIIHRDIKSTNILLDESLNAKVADFGLSKLVSDTKKGHVSTQVKG  767

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+IT+R PIEKG YIVRE++ A+D+  ++ Y
Sbjct  768  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELITSRQPIEKGTYIVREIRTAIDQYDQEYY  827

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+S++DP+I  S       +FV +A+ C+E+ AA RPTM +VVKE+E I++  G     
Sbjct  828  GLKSLIDPTIRDSAKMVGFRRFVQLAMECVEESAADRPTMNDVVKELEIIIQNEGAQ-LL  886

Query  216  DSASTSESYSGVSKGSE-HPYSD  151
            +SAS S    G +KG +  PY D
Sbjct  887  NSASLSAQQFGYAKGRDPDPYGD  909


 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 78/122 (64%), Gaps = 19/122 (16%)
 Frame = -1

Query  729   LHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGTMGYLDPE  550
             +H+L N PIIHRD K+ NILLD+ L AKVADFGLSK + + +K                 
Sbjct  971   IHELTNLPIIHRDAKSTNILLDDNLKAKVADFGLSKLVADTKKD----------------  1014

Query  549   YYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTK-DMYDLQSILDP  373
               MT Q ++KS++YSFG V+LE+++ R P+ KG++I RE + A+D +  D Y LQ I+D 
Sbjct  1015  --MTQQFSQKSELYSFGSVMLELLSRRLPLAKGRFIDREFRMAIDASNYDYYGLQCIIDL  1072

Query  372   SI  367
             +I
Sbjct  1073  AI  1074



>ref|XP_009417852.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X3 [Musa acuminata subsp. malaccensis]
Length=928

 Score =   241 bits (614),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 121/201 (60%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K++NILLDE LNAKVADFGLSK   + EK HV+TQVKG
Sbjct  700  GSARGLAYLHELADPPIIHRDVKSSNILLDENLNAKVADFGLSKLASDNEKGHVSTQVKG  759

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLT+KSDVYSFGVV+LE+ITAR PIEKGKYIVREVK  ++   +++Y
Sbjct  760  TLGYLDPEYYMTQQLTDKSDVYSFGVVMLELITARQPIEKGKYIVREVKMTINANDEELY  819

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DP I +S+   + +KF ++ALRCLE+ A  RPTM ++VKEIE ++    L+ ++
Sbjct  820  GLKELMDPVIQNSIHLIAFKKFTELALRCLEESAGDRPTMSDIVKEIEMMLHADDLSTNS  879

Query  216  DSASTSESYSGVSKG-SEHPY  157
             SAS+S +  G +KG   HPY
Sbjct  880  HSASSSATDFGTAKGVPHHPY  900



>ref|XP_009417853.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X4 [Musa acuminata subsp. malaccensis]
Length=841

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K++NILLDE LNAKVADFGLSK   + EK HV+TQVKG
Sbjct  613  GSARGLAYLHELADPPIIHRDVKSSNILLDENLNAKVADFGLSKLASDNEKGHVSTQVKG  672

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLT+KSDVYSFGVV+LE+ITAR PIEKGKYIVREVK  ++   +++Y
Sbjct  673  TLGYLDPEYYMTQQLTDKSDVYSFGVVMLELITARQPIEKGKYIVREVKMTINANDEELY  732

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DP I +S+   + +KF ++ALRCLE+ A  RPTM ++VKEIE ++    L+ ++
Sbjct  733  GLKELMDPVIQNSIHLIAFKKFTELALRCLEESAGDRPTMSDIVKEIEMMLHADDLSTNS  792

Query  216  DSASTSESYSGVSKG-SEHPY  157
             SAS+S +  G +KG   HPY
Sbjct  793  HSASSSATDFGTAKGVPHHPY  813



>ref|XP_009365989.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Pyrus x bretschneideri]
Length=962

 Score =   241 bits (615),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 124/203 (61%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  731  GSARGLAYLHELANPPIIHRDVKSTNILLDEHLTAKVADFGLSKLINDSGKGHVSTQVKG  790

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+  MDK  ++ Y
Sbjct  791  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARQPIEKGKYIVREVRLVMDKNDEEHY  850

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++D +I +S T     +F+++A++C+E+ +A RP M EVVK IE+I++  GLN ++
Sbjct  851  GLRELIDRNIRNSGTLIGFGRFLELAMQCVEESSADRPPMSEVVKAIETILQNDGLNTNS  910

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             SAS+S +    SKG+ +HPY+D
Sbjct  911  TSASSSATEFAASKGAPKHPYND  933



>gb|AFW78432.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=680

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 154/206 (75%), Gaps = 5/206 (2%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K+ NILLD+ L AKVADFGLSK + + +K HV+TQVKG
Sbjct  451  GSARGLAYLHELADPPIIHRDVKSTNILLDDHLKAKVADFGLSKLVADTQKGHVSTQVKG  510

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+++ R PIE GKYIVREVK A+D   +D Y
Sbjct  511  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIESGKYIVREVKLAIDPNDRDHY  570

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIM--EMVGLNP  223
             L+ +LDP+I  +       +FV +A+ C+++ AA RP M EVVK+IE+++  E+ G + 
Sbjct  571  GLRGLLDPAIRDNARTAGFRRFVQLAMLCVDESAAARPAMGEVVKDIEAMLQNEVSGPDG  630

Query  222  HADSA-STSESYSGVSKGSE-HPYSD  151
               SA S++  + G   G+  HPYSD
Sbjct  631  ATSSAGSSANDFDGAGGGARSHPYSD  656



>ref|XP_011028445.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Populus euphratica]
Length=952

 Score =   241 bits (614),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 124/214 (58%), Positives = 163/214 (76%), Gaps = 4/214 (2%)
 Frame = -1

Query  750  AAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKGT  571
            +AKG+ YLH+L NPPIIHRDIK+ NILLD++L AKVADFGLSK +   E  HV+T VKGT
Sbjct  732  SAKGIAYLHELANPPIIHRDIKSTNILLDDQLIAKVADFGLSKPVDNNE-VHVSTGVKGT  790

Query  570  MGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAM--DKTKDMY  397
            MGYLDPEY+M+ QLTEKSDVYSFGVV+LE++T R PIE G Y+VREVK AM   +TKD  
Sbjct  791  MGYLDPEYFMSGQLTEKSDVYSFGVVMLELVTGRKPIEHGSYVVREVKTAMGNQRTKDSS  850

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            +L +ILDP++      + LE F+D+A+RC+E++AA RPTM EVVKE+E+I ++ G N +A
Sbjct  851  NLDAILDPALDPGKPLKGLEMFIDLAIRCVEELAANRPTMNEVVKELENIQQLAGFNGNA  910

Query  216  DSASTSESYSGVSKGS-EHPYSDESLSVYTGVLP  118
            +  STS +YS  ++GS  H Y+ ++   Y+G  P
Sbjct  911  EMVSTSTTYSETTEGSFYHDYNKKAFFEYSGTFP  944



>ref|XP_009365992.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=997

 Score =   241 bits (614),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 124/203 (61%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  766  GSARGLAYLHELANPPIIHRDVKSTNILLDEHLTAKVADFGLSKLVNDSGKGHVSTQVKG  825

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+  MDK  ++ Y
Sbjct  826  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARHPIEKGKYIVREVQLVMDKNDEEHY  885

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++D +I +S T     +F+++A++C+E+ AA RP M EVVK IE+I++  G+N ++
Sbjct  886  GLRELIDRNIRNSGTFIGFGRFLELAMQCVEESAADRPMMSEVVKAIETILQNDGMNTNS  945

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             SAS+S +    SKG+ +HPY+D
Sbjct  946  TSASSSATGFAASKGAPKHPYND  968



>ref|XP_009417849.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Musa acuminata subsp. malaccensis]
Length=958

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K++NILLDE LNAKVADFGLSK   + EK HV+TQVKG
Sbjct  730  GSARGLAYLHELADPPIIHRDVKSSNILLDENLNAKVADFGLSKLASDNEKGHVSTQVKG  789

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLT+KSDVYSFGVV+LE+ITAR PIEKGKYIVREVK  ++   +++Y
Sbjct  790  TLGYLDPEYYMTQQLTDKSDVYSFGVVMLELITARQPIEKGKYIVREVKMTINANDEELY  849

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DP I +S+   + +KF ++ALRCLE+ A  RPTM ++VKEIE ++    L+ ++
Sbjct  850  GLKELMDPVIQNSIHLIAFKKFTELALRCLEESAGDRPTMSDIVKEIEMMLHADDLSTNS  909

Query  216  DSASTSESYSGVSKG-SEHPY  157
             SAS+S +  G +KG   HPY
Sbjct  910  HSASSSATDFGTAKGVPHHPY  930



>ref|XP_009365988.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X1 [Pyrus x bretschneideri]
Length=959

 Score =   240 bits (613),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 124/203 (61%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  728  GSARGLAYLHELANPPIIHRDVKSTNILLDEHLTAKVADFGLSKLINDSGKGHVSTQVKG  787

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+  MDK  ++ Y
Sbjct  788  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARQPIEKGKYIVREVRLVMDKNDEEHY  847

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++D +I +S T     +F+++A++C+E+ +A RP M EVVK IE+I++  GLN ++
Sbjct  848  GLRELIDRNIRNSGTLIGFGRFLELAMQCVEESSADRPPMSEVVKAIETILQNDGLNTNS  907

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             SAS+S +    SKG+ +HPY+D
Sbjct  908  TSASSSATEFAASKGAPKHPYND  930



>ref|XP_009417851.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 isoform X2 [Musa acuminata subsp. malaccensis]
Length=933

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K++NILLDE LNAKVADFGLSK   + EK HV+TQVKG
Sbjct  705  GSARGLAYLHELADPPIIHRDVKSSNILLDENLNAKVADFGLSKLASDNEKGHVSTQVKG  764

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLT+KSDVYSFGVV+LE+ITAR PIEKGKYIVREVK  ++   +++Y
Sbjct  765  TLGYLDPEYYMTQQLTDKSDVYSFGVVMLELITARQPIEKGKYIVREVKMTINANDEELY  824

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ ++DP I +S+   + +KF ++ALRCLE+ A  RPTM ++VKEIE ++    L+ ++
Sbjct  825  GLKELMDPVIQNSIHLIAFKKFTELALRCLEESAGDRPTMSDIVKEIEMMLHADDLSTNS  884

Query  216  DSASTSESYSGVSKG-SEHPY  157
             SAS+S +  G +KG   HPY
Sbjct  885  HSASSSATDFGTAKGVPHHPY  905



>ref|XP_009337850.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
 ref|XP_009337851.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Pyrus x bretschneideri]
Length=963

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRD+K++NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  732  GSARGLAYLHELANPPIIHRDVKSSNILLDEHLTAKVADFGLSKLISDSGKGHVSTQVKG  791

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMY-  397
            T+GYLDPEYYMT QLTEKSDVYSFGVV+LE++TAR PIEKGKYIVREV+  MDK  + + 
Sbjct  792  TLGYLDPEYYMTQQLTEKSDVYSFGVVMLELVTARQPIEKGKYIVREVRLVMDKNDEEHC  851

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L  ++D SI +S T     +F+++A++C+ED AA RPTM E+VK IE+I++  G+N ++
Sbjct  852  GLGDLIDRSIRNSGTLIGFGRFLELAMQCVEDSAADRPTMSELVKAIETILQNDGMNTNS  911

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
             SAS+S +    SKG+ +HPY+D
Sbjct  912  TSASSSATEFAASKGAPKHPYND  934



>gb|EMT14100.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=902

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 151/210 (72%), Gaps = 14/210 (7%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G AKG+ YLH+L +PPI+HRDIK++N+LLDERLNAKV+DFGLSK LGE  +         
Sbjct  695  GTAKGIAYLHELADPPIVHRDIKSSNVLLDERLNAKVSDFGLSKLLGEDGRGQ-------  747

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKTKDMYD  394
              GYLDPEYYMT QLTEKSDVYSFGV+LLE+ITA+ P+E+G+YIVREV  A+D++KD+Y 
Sbjct  748  --GYLDPEYYMTQQLTEKSDVYSFGVLLLEMITAKKPLERGRYIVREVLAALDRSKDLYG  805

Query  393  LQSILDPSIASSVTP-RSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
            L  +LDP + +S T    LE++VD+ALRC+E+  A RP+M E V EIE I  M G  P  
Sbjct  806  LHDLLDPVLGASPTSLGGLEQYVDLALRCVEEAGADRPSMGEAVSEIERITRMAGGAPE-  864

Query  216  DSASTSESYSGVSKGSEHPYSDESLSVYTG  127
               S SES S  S+   HPY  +S S Y+G
Sbjct  865  ---SASESMSYASRTPRHPYGGDSPSEYSG  891



>ref|XP_008345657.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Malus domestica]
Length=1223

 Score =   242 bits (617),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 162/203 (80%), Gaps = 2/203 (1%)
 Frame = -1

Query  753   GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
             G+A+GL YLH+L NPPIIHRD+K+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  992   GSARGLAYLHELANPPIIHRDVKSTNILLDEHLTAKVADFGLSKLVNDSGKGHVSTQVKG  1051

Query  573   TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
             TMGYLDPEYYMT QLTEKSDVYSFGVV+LE+ITAR PIEKGKYIVREV+  M+K  ++ Y
Sbjct  1052  TMGYLDPEYYMTQQLTEKSDVYSFGVVMLELITARQPIEKGKYIVREVRLVMNKNDEEHY  1111

Query  396   DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
              L+ ++D +I +S T     +F+++A++C+E+ AA RPTM EVVK IE+I++  G+N ++
Sbjct  1112  GLRELIDRNIRNSGTLIGFGRFLELAMQCVEESAADRPTMSEVVKAIETILQNDGMNTNS  1171

Query  216   DSASTSESYSGVSKGS-EHPYSD  151
              SAS+S +    SKG+ +HPY+D
Sbjct  1172  TSASSSATEFAASKGAPKHPYND  1194



>gb|EAY76270.1| hypothetical protein OsI_04206 [Oryza sativa Indica Group]
Length=961

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 154/203 (76%), Gaps = 3/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L +PPIIHRDIK+ NILLDE LNAKVADFGLSK + + +K HV+TQVKG
Sbjct  733  GSAKGLAYLHELADPPIIHRDIKSTNILLDESLNAKVADFGLSKLVSDTKKGHVSTQVKG  792

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+IT+R PIEKG YIVRE++ A+D+  ++ Y
Sbjct  793  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELITSRQPIEKGTYIVREIRTAIDQYDQEYY  852

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
              +S++DP+I  S       +FV +A+ C+E+ AA RPTM +VVKE+E I++  G     
Sbjct  853  GWKSLIDPTIRDSAKMVGFRRFVQLAMECVEESAADRPTMNDVVKELEIIIQNEGAQ-LL  911

Query  216  DSASTSESYSGVSKGSE-HPYSD  151
            +SAS S    G +KG +  PY D
Sbjct  912  NSASLSAQQFGYAKGRDPDPYGD  934



>ref|XP_006644901.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770-like [Oryza brachyantha]
Length=960

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 158/211 (75%), Gaps = 7/211 (3%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+AKGL YLH+L +PPIIHRDIK+ NILLDE LNAKVADFGLSK + + +K HV+TQVKG
Sbjct  734  GSAKGLAYLHELADPPIIHRDIKSTNILLDESLNAKVADFGLSKLVSDTQKGHVSTQVKG  793

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDK-TKDMY  397
            T+GYLDPEYYMT QL+EKSDVYSFGVV+LE+IT+R PIEKG YIVRE++ AMD+  ++ Y
Sbjct  794  TLGYLDPEYYMTQQLSEKSDVYSFGVVMLELITSRQPIEKGTYIVREIRTAMDQYDQEYY  853

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+S++DP+I  S       +FV +A+ C+E+ AA RP+M +VVKE+E I++  G     
Sbjct  854  GLESLIDPTIRDSAKMVGFRRFVQLAMECVEESAADRPSMNDVVKELEVIIQNEGAQ-LL  912

Query  216  DSASTSESYSGVSKG----SEH-PYSDESLS  139
            +SAS S    G  KG     +H P +D+S S
Sbjct  913  NSASQSAEKFGYEKGRDLYGDHLPMNDDSSS  943



>ref|XP_010938089.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g49770 [Elaeis guineensis]
Length=986

 Score =   239 bits (611),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 163/203 (80%), Gaps = 2/203 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L +PPIIHRD+K++NILLDE LNAKVADFGLSK + + EK HV+TQVKG
Sbjct  757  GSARGLAYLHELADPPIIHRDVKSSNILLDENLNAKVADFGLSKLVSDCEKGHVSTQVKG  816

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMD-KTKDMY  397
            TMGYLDPEYY+T QL++KSDVYSFGVV+LE++TAR PI+K  YIVREVK A++ K ++ Y
Sbjct  817  TMGYLDPEYYLTQQLSDKSDVYSFGVVMLELLTARQPIKKSNYIVREVKTAINMKDEEYY  876

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ I+DP I ++    +  +F+++A+RC+E+ AA RPTM  VVKEIE+++   G++ ++
Sbjct  877  GLKEIMDPIIQNTTHLIAFRRFIELAMRCVEESAADRPTMSNVVKEIETMLHNTGMDTNS  936

Query  216  DSASTSESYSGVSKGS-EHPYSD  151
            +SAS+S +  G +KG   HPYSD
Sbjct  937  NSASSSATDFGNTKGDLHHPYSD  959



>emb|CAQ58615.1| ATP binding / kinase/ protein serine / threonine kinase [Vitis 
vinifera]
Length=946

 Score =   239 bits (611),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 160/204 (78%), Gaps = 3/204 (1%)
 Frame = -1

Query  753  GAAKGLQYLHDLVNPPIIHRDIKTNNILLDERLNAKVADFGLSKSLGEQEKAHVTTQVKG  574
            G+A+GL YLH+L NPPIIHRDIK+ NILLDE L AKVADFGLSK + +  K HV+TQVKG
Sbjct  715  GSARGLAYLHELANPPIIHRDIKSTNILLDENLTAKVADFGLSKLVSDSAKGHVSTQVKG  774

Query  573  TMGYLDPEYYMTNQLTEKSDVYSFGVVLLEIITARPPIEKGKYIVREVKQAMDKT-KDMY  397
            T+GYLDPEYYMT QLTEKSDVYS+GVV+LE+++AR PIEKGKYIVREV+ AMDK  ++ Y
Sbjct  775  TLGYLDPEYYMTQQLTEKSDVYSYGVVMLELVSARQPIEKGKYIVREVRMAMDKNDEEHY  834

Query  396  DLQSILDPSIASSVTPRSLEKFVDVALRCLEDVAAQRPTMREVVKEIESIMEMVGLNPHA  217
             L+ I+DP+I +        KF+++A++C+E+ A  RPTM +VVK IE++++  G+N ++
Sbjct  835  GLREIMDPAIRNVTNLIGFRKFLELAMQCVEESAGDRPTMSDVVKTIETVLQNDGMNTNS  894

Query  216  DSASTSESYS-GVSKG-SEHPYSD  151
             ++++S +   G SKG   HPY+D
Sbjct  895  TTSASSSATEFGASKGVPRHPYND  918



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050