BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048B04

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57281.1|  protein kinase family protein                          250   3e-79   Ipomoea nil [qian niu]
gb|EYU41453.1|  hypothetical protein MIMGU_mgv1a007874mg                244   4e-77   Erythranthe guttata [common monkey flower]
ref|XP_002300823.2|  hypothetical protein POPTR_0002s05060g             239   2e-76   
ref|XP_009802442.1|  PREDICTED: serine/threonine-protein kinase H...    243   3e-76   Nicotiana sylvestris
ref|XP_009628978.1|  PREDICTED: serine/threonine-protein kinase H...    243   3e-76   Nicotiana tomentosiformis
ref|XP_010932793.1|  PREDICTED: serine/threonine-protein kinase H...    242   3e-76   
ref|XP_006360755.1|  PREDICTED: serine/threonine-protein kinase H...    242   4e-76   
ref|XP_004247585.1|  PREDICTED: serine/threonine-protein kinase HT1     242   5e-76   Solanum lycopersicum
ref|XP_006360752.1|  PREDICTED: serine/threonine-protein kinase H...    242   5e-76   
ref|XP_010938227.1|  PREDICTED: serine/threonine-protein kinase H...    241   7e-76   Elaeis guineensis
ref|XP_008795684.1|  PREDICTED: serine/threonine-protein kinase H...    241   1e-75   Phoenix dactylifera
ref|XP_011032655.1|  PREDICTED: serine/threonine-protein kinase H...    240   2e-75   Populus euphratica
ref|XP_006298274.1|  hypothetical protein CARUB_v10014341mg             236   3e-75   
ref|XP_011462541.1|  PREDICTED: serine/threonine-protein kinase HT1     239   3e-75   Fragaria vesca subsp. vesca
gb|ACU23132.1|  unknown                                                 234   3e-75   Glycine max [soybeans]
ref|XP_010092417.1|  Serine/threonine-protein kinase HT1                239   3e-75   
gb|KJB46968.1|  hypothetical protein B456_008G003000                    239   4e-75   Gossypium raimondii
ref|XP_002307603.2|  kinase family protein                              239   4e-75   Populus trichocarpa [western balsam poplar]
gb|KDP40216.1|  hypothetical protein JCGZ_02214                         239   5e-75   Jatropha curcas
ref|XP_011090685.1|  PREDICTED: serine/threonine-protein kinase H...    239   6e-75   Sesamum indicum [beniseed]
gb|ABK25384.1|  unknown                                                 239   6e-75   Picea sitchensis
ref|XP_008804977.1|  PREDICTED: serine/threonine-protein kinase HT1     239   7e-75   Phoenix dactylifera
ref|XP_008813069.1|  PREDICTED: serine/threonine-protein kinase HT1     239   7e-75   Phoenix dactylifera
ref|XP_008390925.1|  PREDICTED: serine/threonine-protein kinase H...    239   9e-75   Malus domestica [apple tree]
gb|EPS58146.1|  hypothetical protein M569_16670                         238   9e-75   Genlisea aurea
gb|KHG26740.1|  Serine/threonine-protein kinase HT1                     238   1e-74   Gossypium arboreum [tree cotton]
gb|KDO68661.1|  hypothetical protein CISIN_1g0487241mg                  234   1e-74   Citrus sinensis [apfelsine]
ref|XP_006444022.1|  hypothetical protein CICLE_v10020502mg             238   2e-74   Citrus clementina [clementine]
emb|CDO99092.1|  unnamed protein product                                238   2e-74   Coffea canephora [robusta coffee]
ref|XP_006406131.1|  hypothetical protein EUTSA_v10020938mg             237   2e-74   
ref|XP_010917790.1|  PREDICTED: serine/threonine-protein kinase HT1     238   2e-74   Elaeis guineensis
gb|KFK39560.1|  hypothetical protein AALP_AA3G260100                    236   2e-74   Arabis alpina [alpine rockcress]
ref|XP_007223356.1|  hypothetical protein PRUPE_ppa007453mg             236   2e-74   
ref|XP_006489437.1|  PREDICTED: serine/threonine-protein kinase H...    237   2e-74   Citrus sinensis [apfelsine]
ref|XP_008348902.1|  PREDICTED: serine/threonine-protein kinase H...    237   3e-74   
ref|XP_009371960.1|  PREDICTED: serine/threonine-protein kinase H...    238   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_009335290.1|  PREDICTED: serine/threonine-protein kinase H...    238   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_006420001.1|  hypothetical protein CICLE_v10005137mg             237   3e-74   Citrus clementina [clementine]
ref|XP_007201088.1|  hypothetical protein PRUPE_ppa007037mg             237   3e-74   Prunus persica
ref|XP_009369877.1|  PREDICTED: serine/threonine-protein kinase H...    237   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_007050528.1|  Kinase superfamily protein isoform 1               238   4e-74   
ref|XP_002312543.2|  hypothetical protein POPTR_0008s15580g             236   5e-74   
ref|XP_003517568.1|  PREDICTED: serine/threonine-protein kinase H...    236   6e-74   Glycine max [soybeans]
ref|XP_010525217.1|  PREDICTED: serine/threonine-protein kinase H...    236   6e-74   Tarenaya hassleriana [spider flower]
ref|XP_002524739.1|  protein kinase atmrk1, putative                    238   6e-74   
ref|XP_007050529.1|  Kinase superfamily protein isoform 2               238   6e-74   
ref|XP_008386459.1|  PREDICTED: serine/threonine-protein kinase HT1     236   7e-74   Malus domestica [apple tree]
ref|XP_007034830.1|  Kinase superfamily protein                         239   7e-74   
ref|XP_009405934.1|  PREDICTED: serine/threonine-protein kinase H...    236   8e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010259112.1|  PREDICTED: serine/threonine-protein kinase H...    236   8e-74   Nelumbo nucifera [Indian lotus]
ref|XP_009367596.1|  PREDICTED: serine/threonine-protein kinase H...    236   8e-74   Pyrus x bretschneideri [bai li]
ref|XP_002885523.1|  hypothetical protein ARALYDRAFT_898756             236   9e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_006838998.1|  hypothetical protein AMTR_s00002p00271860          236   9e-74   
emb|CAN82019.1|  hypothetical protein VITISV_003418                     235   9e-74   Vitis vinifera
emb|CDY34236.1|  BnaA01g24530D                                          234   1e-73   Brassica napus [oilseed rape]
ref|XP_010651999.1|  PREDICTED: serine/threonine-protein kinase HT1     236   1e-73   Vitis vinifera
dbj|BAJ94876.1|  predicted protein                                      235   1e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI28728.3|  unnamed protein product                                236   1e-73   Vitis vinifera
gb|AGG38032.1|  mitogen activated protein kinase kinase kinase 27       235   1e-73   Oryza sativa Indica Group [Indian rice]
gb|EMT10391.1|  Serine/threonine-protein kinase HT1                     236   1e-73   
gb|ADP37972.1|  protein kinase-like protein                             233   1e-73   Brassica napus [oilseed rape]
ref|XP_010024234.1|  PREDICTED: serine/threonine-protein kinase HT1     235   1e-73   Eucalyptus grandis [rose gum]
ref|XP_008786039.1|  PREDICTED: serine/threonine-protein kinase HT1     235   1e-73   Phoenix dactylifera
ref|XP_010232261.1|  PREDICTED: serine/threonine-protein kinase H...    235   1e-73   Brachypodium distachyon [annual false brome]
gb|AAR01726.1|  putative protein kinase                                 235   1e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010923541.1|  PREDICTED: serine/threonine-protein kinase H...    235   2e-73   Elaeis guineensis
ref|XP_010679276.1|  PREDICTED: cysteine-rich receptor-like prote...    242   2e-73   
ref|XP_009108716.1|  PREDICTED: serine/threonine-protein kinase H...    235   2e-73   Brassica rapa
ref|XP_010511655.1|  PREDICTED: serine/threonine-protein kinase H...    235   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_008235378.1|  PREDICTED: serine/threonine-protein kinase HT1     235   2e-73   Prunus mume [ume]
ref|XP_006650329.1|  PREDICTED: serine/threonine-protein kinase H...    234   2e-73   Oryza brachyantha
ref|XP_003562048.1|  PREDICTED: serine/threonine-protein kinase H...    234   2e-73   Brachypodium distachyon [annual false brome]
gb|KJB23020.1|  hypothetical protein B456_004G077900                    230   2e-73   Gossypium raimondii
ref|XP_002283073.1|  PREDICTED: serine/threonine-protein kinase HT1     235   2e-73   Vitis vinifera
ref|XP_008224270.1|  PREDICTED: serine/threonine-protein kinase H...    236   3e-73   Prunus mume [ume]
ref|NP_566716.1|  protein kinase family protein                         234   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782437.1|  PREDICTED: serine/threonine-protein kinase H...    229   3e-73   
ref|XP_010466567.1|  PREDICTED: serine/threonine-protein kinase H...    234   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006844952.1|  hypothetical protein AMTR_s00058p00169420          233   3e-73   Amborella trichopoda
ref|XP_002517090.1|  protein kinase atmrk1, putative                    234   4e-73   Ricinus communis
gb|EAY91142.1|  hypothetical protein OsI_12749                          235   4e-73   Oryza sativa Indica Group [Indian rice]
gb|EAZ27891.1|  hypothetical protein OsJ_11846                          235   4e-73   Oryza sativa Japonica Group [Japonica rice]
gb|KJB72260.1|  hypothetical protein B456_011G167400                    234   4e-73   Gossypium raimondii
ref|XP_003537586.1|  PREDICTED: serine/threonine-protein kinase H...    234   4e-73   Glycine max [soybeans]
gb|ABK06452.1|  flag-tagged protein kinase domain of putative mit...    234   4e-73   synthetic construct
gb|KJB23019.1|  hypothetical protein B456_004G077900                    231   5e-73   Gossypium raimondii
ref|XP_011026861.1|  PREDICTED: serine/threonine-protein kinase H...    234   5e-73   Populus euphratica
ref|XP_004511375.1|  PREDICTED: serine/threonine-protein kinase H...    234   6e-73   Cicer arietinum [garbanzo]
ref|XP_010242982.1|  PREDICTED: serine/threonine-protein kinase H...    233   7e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010251291.1|  PREDICTED: serine/threonine-protein kinase H...    232   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_008812495.1|  PREDICTED: serine/threonine-protein kinase H...    231   1e-72   Phoenix dactylifera
ref|XP_010532573.1|  PREDICTED: serine/threonine-protein kinase H...    233   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_006644420.1|  PREDICTED: serine/threonine-protein kinase H...    228   1e-72   Oryza brachyantha
ref|XP_011026124.1|  PREDICTED: serine/threonine-protein kinase HT1     233   1e-72   Populus euphratica
ref|XP_004963118.1|  PREDICTED: serine/threonine-protein kinase H...    232   1e-72   Setaria italica
tpg|DAA47443.1|  TPA: LOW QUALITY PROTEIN: putative protein kinas...    229   1e-72   
gb|EMS51637.1|  Serine/threonine-protein kinase HT1                     234   1e-72   Triticum urartu
gb|KJB53126.1|  hypothetical protein B456_008G294700                    228   1e-72   Gossypium raimondii
gb|KJB38187.1|  hypothetical protein B456_006G241500                    233   1e-72   Gossypium raimondii
gb|KJB53123.1|  hypothetical protein B456_008G294700                    228   2e-72   Gossypium raimondii
ref|XP_007157110.1|  hypothetical protein PHAVU_002G043600g             232   2e-72   Phaseolus vulgaris [French bean]
ref|XP_008782436.1|  PREDICTED: serine/threonine-protein kinase H...    231   2e-72   Phoenix dactylifera
gb|KJB23017.1|  hypothetical protein B456_004G077900                    232   2e-72   Gossypium raimondii
ref|XP_010925403.1|  PREDICTED: serine/threonine-protein kinase H...    231   2e-72   Elaeis guineensis
ref|XP_011073446.1|  PREDICTED: serine/threonine-protein kinase H...    233   3e-72   Sesamum indicum [beniseed]
ref|XP_008451641.1|  PREDICTED: serine/threonine-protein kinase HT1     228   3e-72   
ref|XP_011030650.1|  PREDICTED: serine/threonine-protein kinase HT1     232   3e-72   Populus euphratica
ref|XP_009788249.1|  PREDICTED: serine/threonine-protein kinase H...    227   3e-72   Nicotiana sylvestris
ref|XP_004290624.1|  PREDICTED: serine/threonine-protein kinase HT1     232   3e-72   Fragaria vesca subsp. vesca
gb|KCW84187.1|  hypothetical protein EUGRSUZ_B01052                     228   3e-72   Eucalyptus grandis [rose gum]
gb|KHG05976.1|  Serine/threonine-protein kinase HT1                     232   4e-72   Gossypium arboreum [tree cotton]
ref|XP_003610747.1|  Kinase-like protein                                232   4e-72   Medicago truncatula
ref|XP_010678745.1|  PREDICTED: serine/threonine-protein kinase H...    231   4e-72   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI26291.3|  unnamed protein product                                233   4e-72   Vitis vinifera
ref|XP_010496560.1|  PREDICTED: serine/threonine-protein kinase H...    228   4e-72   
emb|CDP02127.1|  unnamed protein product                                231   6e-72   Coffea canephora [robusta coffee]
ref|NP_001142326.1|  uncharacterized protein LOC100274496               231   6e-72   Zea mays [maize]
gb|EYU29919.1|  hypothetical protein MIMGU_mgv1a022188mg                230   6e-72   Erythranthe guttata [common monkey flower]
ref|XP_002278739.1|  PREDICTED: serine/threonine-protein kinase HT1     230   7e-72   Vitis vinifera
ref|XP_011079887.1|  PREDICTED: serine/threonine-protein kinase HT1     231   7e-72   Sesamum indicum [beniseed]
ref|XP_009145271.1|  PREDICTED: serine/threonine-protein kinase HT1     231   8e-72   Brassica rapa
ref|NP_001131428.2|  uncharacterized LOC100192758                       230   8e-72   Zea mays [maize]
gb|KJB40735.1|  hypothetical protein B456_007G076700                    228   8e-72   Gossypium raimondii
ref|XP_011087151.1|  PREDICTED: serine/threonine-protein kinase H...    230   1e-71   Sesamum indicum [beniseed]
ref|XP_010532275.1|  PREDICTED: serine/threonine-protein kinase H...    230   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_007151088.1|  hypothetical protein PHAVU_004G016900g             230   1e-71   Phaseolus vulgaris [French bean]
ref|XP_004138114.1|  PREDICTED: serine/threonine-protein kinase H...    230   1e-71   Cucumis sativus [cucumbers]
ref|XP_008453100.1|  PREDICTED: serine/threonine-protein kinase H...    230   1e-71   Cucumis melo [Oriental melon]
ref|XP_002314673.2|  hypothetical protein POPTR_0010s09360g             230   1e-71   Populus trichocarpa [western balsam poplar]
gb|KEH27357.1|  Serine/Threonine kinase family protein                  231   1e-71   Medicago truncatula
ref|XP_004982354.1|  PREDICTED: serine/threonine-protein kinase H...    230   1e-71   Setaria italica
gb|KHN23551.1|  Serine/threonine-protein kinase HT1                     228   2e-71   Glycine soja [wild soybean]
gb|KJB42143.1|  hypothetical protein B456_007G139200                    230   2e-71   Gossypium raimondii
gb|KJB40732.1|  hypothetical protein B456_007G076700                    229   2e-71   Gossypium raimondii
ref|XP_003527023.1|  PREDICTED: serine/threonine-protein kinase H...    230   2e-71   Glycine max [soybeans]
gb|EMT33153.1|  Serine/threonine-protein kinase HT1                     227   2e-71   
ref|XP_003525335.1|  PREDICTED: dual specificity protein kinase z...    230   2e-71   Glycine max [soybeans]
ref|XP_010936750.1|  PREDICTED: serine/threonine-protein kinase H...    229   2e-71   Elaeis guineensis
ref|XP_003523078.1|  PREDICTED: serine/threonine-protein kinase H...    230   2e-71   Glycine max [soybeans]
ref|NP_186798.1|  Protein kinase superfamily protein                    230   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043682.1|  Os01g0641000                                       230   2e-71   
gb|KHN18465.1|  Serine/threonine-protein kinase HT1                     230   2e-71   Glycine soja [wild soybean]
ref|XP_003549630.1|  PREDICTED: dual specificity protein kinase z...    230   2e-71   Glycine max [soybeans]
gb|KJB75695.1|  hypothetical protein B456_012G061300                    227   2e-71   Gossypium raimondii
gb|KJB11479.1|  hypothetical protein B456_001G261300                    229   2e-71   Gossypium raimondii
gb|KHG06519.1|  Serine/threonine-protein kinase HT1                     229   2e-71   Gossypium arboreum [tree cotton]
gb|KJB53127.1|  hypothetical protein B456_008G294700                    230   2e-71   Gossypium raimondii
gb|EEE55065.1|  hypothetical protein OsJ_02781                          229   2e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010028228.1|  PREDICTED: serine/threonine-protein kinase H...    231   2e-71   Eucalyptus grandis [rose gum]
ref|XP_006299114.1|  hypothetical protein CARUB_v10015255mg             230   2e-71   Capsella rubella
gb|KHG08462.1|  Serine/threonine-protein kinase HT1                     229   2e-71   Gossypium arboreum [tree cotton]
ref|XP_003542696.1|  PREDICTED: serine/threonine-protein kinase H...    229   2e-71   Glycine max [soybeans]
gb|KDO69703.1|  hypothetical protein CISIN_1g018489mg                   228   2e-71   Citrus sinensis [apfelsine]
ref|XP_006603815.1|  PREDICTED: serine/threonine-protein kinase HT1     229   2e-71   Glycine max [soybeans]
ref|XP_010034835.1|  PREDICTED: serine/threonine-protein kinase H...    229   3e-71   
ref|XP_011071834.1|  PREDICTED: serine/threonine-protein kinase H...    229   3e-71   Sesamum indicum [beniseed]
ref|XP_002300019.1|  kinase family protein                              229   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011007522.1|  PREDICTED: serine/threonine-protein kinase H...    229   3e-71   Populus euphratica
gb|KHN19315.1|  Serine/threonine-protein kinase HT1                     229   3e-71   Glycine soja [wild soybean]
gb|KHN30896.1|  Serine/threonine-protein kinase HT1                     230   3e-71   Glycine soja [wild soybean]
ref|XP_007155414.1|  hypothetical protein PHAVU_003G199400g             229   3e-71   Phaseolus vulgaris [French bean]
ref|XP_006439794.1|  hypothetical protein CICLE_v10020546mg             229   3e-71   Citrus clementina [clementine]
emb|CDP03662.1|  unnamed protein product                                229   4e-71   Coffea canephora [robusta coffee]
gb|KDP45365.1|  hypothetical protein JCGZ_09614                         229   4e-71   Jatropha curcas
ref|XP_006654831.1|  PREDICTED: serine/threonine-protein kinase H...    229   4e-71   Oryza brachyantha
ref|XP_004961129.1|  PREDICTED: serine/threonine-protein kinase H...    229   4e-71   Setaria italica
ref|XP_008443512.1|  PREDICTED: serine/threonine-protein kinase HT1     229   4e-71   Cucumis melo [Oriental melon]
ref|XP_004158316.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    229   4e-71   
ref|NP_001132838.1|  uncharacterized LOC100194330                       224   4e-71   
ref|XP_008787949.1|  PREDICTED: serine/threonine-protein kinase H...    228   4e-71   Phoenix dactylifera
ref|XP_002511419.1|  protein kinase atmrk1, putative                    229   4e-71   Ricinus communis
ref|XP_004141085.1|  PREDICTED: serine/threonine-protein kinase H...    229   4e-71   Cucumis sativus [cucumbers]
gb|ABK06450.1|  flag-tagged protein kinase domain of putative mit...    230   4e-71   synthetic construct
ref|XP_007036183.1|  Kinase superfamily protein isoform 1               229   4e-71   
ref|XP_010496308.1|  PREDICTED: serine/threonine-protein kinase HT1     229   5e-71   Camelina sativa [gold-of-pleasure]
gb|AES91171.2|  Serine/Threonine-kinase HT1-like protein                229   5e-71   Medicago truncatula
ref|XP_002441568.1|  hypothetical protein SORBIDRAFT_09g029440          228   5e-71   Sorghum bicolor [broomcorn]
ref|XP_008239746.1|  PREDICTED: serine/threonine-protein kinase H...    228   5e-71   Prunus mume [ume]
emb|CBI15048.3|  unnamed protein product                                227   6e-71   Vitis vinifera
ref|XP_009613289.1|  PREDICTED: serine/threonine-protein kinase H...    228   6e-71   Nicotiana tomentosiformis
ref|XP_010111765.1|  Serine/threonine-protein kinase HT1                228   6e-71   Morus notabilis
emb|CDP12370.1|  unnamed protein product                                229   6e-71   Coffea canephora [robusta coffee]
ref|XP_007210513.1|  hypothetical protein PRUPE_ppa007019mg             228   6e-71   Prunus persica
gb|EYU45671.1|  hypothetical protein MIMGU_mgv1a007529mg                229   6e-71   Erythranthe guttata [common monkey flower]
ref|XP_009609245.1|  PREDICTED: serine/threonine-protein kinase H...    227   7e-71   Nicotiana tomentosiformis
gb|KJB75694.1|  hypothetical protein B456_012G061300                    228   7e-71   Gossypium raimondii
ref|NP_001056408.1|  Os05g0577700                                       228   8e-71   
emb|CDY37517.1|  BnaA05g33820D                                          228   8e-71   Brassica napus [oilseed rape]
ref|XP_004508858.1|  PREDICTED: dual specificity protein kinase z...    228   8e-71   Cicer arietinum [garbanzo]
ref|XP_010533472.1|  PREDICTED: serine/threonine-protein kinase H...    228   8e-71   Tarenaya hassleriana [spider flower]
ref|XP_004252665.1|  PREDICTED: serine/threonine-protein kinase H...    228   8e-71   Solanum lycopersicum
ref|XP_008348029.1|  PREDICTED: serine/threonine-protein kinase H...    223   8e-71   
ref|XP_004241510.1|  PREDICTED: serine/threonine-protein kinase HT1     228   8e-71   Solanum lycopersicum
gb|AFK45479.1|  unknown                                                 228   8e-71   Lotus japonicus
gb|KFK37616.1|  hypothetical protein AALP_AA3G006100                    229   8e-71   Arabis alpina [alpine rockcress]
ref|XP_006341320.1|  PREDICTED: serine/threonine-protein kinase H...    228   9e-71   Solanum tuberosum [potatoes]
gb|AFK43156.1|  unknown                                                 228   9e-71   Lotus japonicus
emb|CDY49058.1|  BnaC05g48860D                                          228   9e-71   Brassica napus [oilseed rape]
ref|XP_009801079.1|  PREDICTED: serine/threonine-protein kinase H...    227   9e-71   Nicotiana sylvestris
ref|XP_002882179.1|  predicted protein                                  229   1e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_010524307.1|  PREDICTED: serine/threonine-protein kinase H...    228   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_004146993.1|  PREDICTED: serine/threonine-protein kinase H...    228   1e-70   Cucumis sativus [cucumbers]
ref|XP_002283021.1|  PREDICTED: serine/threonine-protein kinase H...    228   1e-70   Vitis vinifera
ref|XP_007031440.1|  Kinase superfamily protein isoform 2               228   1e-70   
emb|CAN64754.1|  hypothetical protein VITISV_010542                     228   1e-70   Vitis vinifera
ref|XP_008374458.1|  PREDICTED: serine/threonine-protein kinase H...    228   1e-70   Malus domestica [apple tree]
ref|XP_010449990.1|  PREDICTED: serine/threonine-protein kinase H...    227   1e-70   Camelina sativa [gold-of-pleasure]
ref|NP_001151897.1|  ATP binding protein                                228   1e-70   Zea mays [maize]
ref|XP_009147438.1|  PREDICTED: serine/threonine-protein kinase HT1     228   1e-70   Brassica rapa
gb|KDP31115.1|  hypothetical protein JCGZ_11491                         228   1e-70   Jatropha curcas
ref|XP_002318645.1|  kinase family protein                              227   1e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004298934.1|  PREDICTED: serine/threonine-protein kinase H...    228   1e-70   Fragaria vesca subsp. vesca
ref|XP_009398135.1|  PREDICTED: serine/threonine-protein kinase H...    226   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010094284.1|  Serine/threonine-protein kinase HT1                228   2e-70   Morus notabilis
emb|CAN60343.1|  hypothetical protein VITISV_017020                     225   2e-70   Vitis vinifera
ref|XP_004969282.1|  PREDICTED: serine/threonine-protein kinase H...    227   2e-70   Setaria italica
gb|KHN35167.1|  Pentatricopeptide repeat-containing protein, mito...    235   2e-70   Glycine soja [wild soybean]
gb|KHN47176.1|  Serine/threonine-protein kinase HT1                     228   2e-70   Glycine soja [wild soybean]
ref|XP_007216049.1|  hypothetical protein PRUPE_ppa017603mg             227   2e-70   Prunus persica
emb|CDM83508.1|  unnamed protein product                                227   2e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010435069.1|  PREDICTED: serine/threonine-protein kinase H...    226   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008230622.1|  PREDICTED: serine/threonine-protein kinase HT1     226   2e-70   Prunus mume [ume]
ref|XP_006414642.1|  hypothetical protein EUTSA_v10025537mg             226   3e-70   Eutrema salsugineum [saltwater cress]
gb|KEH24853.1|  Serine/Threonine-kinase HT1-like protein                226   3e-70   Medicago truncatula
ref|XP_003569430.1|  PREDICTED: serine/threonine-protein kinase H...    226   3e-70   Brachypodium distachyon [annual false brome]
ref|NP_193214.1|  protein kinase family protein                         226   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AES71542.2|  Serine/Threonine-kinase HT1-like protein                226   3e-70   Medicago truncatula
ref|XP_006280611.1|  hypothetical protein CARUB_v10026576mg             226   4e-70   Capsella rubella
ref|XP_004489293.1|  PREDICTED: serine/threonine-protein kinase H...    226   4e-70   Cicer arietinum [garbanzo]
ref|XP_004304609.1|  PREDICTED: serine/threonine-protein kinase HT1     226   4e-70   Fragaria vesca subsp. vesca
ref|NP_199811.1|  protein kinase                                        226   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865771.1|  hypothetical protein ARALYDRAFT_918001             226   4e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_010441391.1|  PREDICTED: serine/threonine-protein kinase H...    226   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010440392.1|  PREDICTED: serine/threonine-protein kinase H...    226   5e-70   Camelina sativa [gold-of-pleasure]
gb|EMS54076.1|  Serine/threonine-protein kinase HT1                     227   5e-70   Triticum urartu
ref|XP_010442480.1|  PREDICTED: serine/threonine-protein kinase HT1     226   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010029202.1|  PREDICTED: serine/threonine-protein kinase HT1     226   6e-70   Eucalyptus grandis [rose gum]
ref|XP_009134038.1|  PREDICTED: serine/threonine-protein kinase HT1     226   6e-70   Brassica rapa
gb|KFK26634.1|  hypothetical protein AALP_AA8G274000                    226   6e-70   Arabis alpina [alpine rockcress]
ref|XP_010695285.1|  PREDICTED: serine/threonine-protein kinase H...    225   6e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010482303.1|  PREDICTED: serine/threonine-protein kinase H...    226   6e-70   Camelina sativa [gold-of-pleasure]
ref|XP_004236113.1|  PREDICTED: serine/threonine-protein kinase H...    226   6e-70   Solanum lycopersicum
ref|XP_006402198.1|  hypothetical protein EUTSA_v10013816mg             226   6e-70   Eutrema salsugineum [saltwater cress]
emb|CDY21438.1|  BnaC03g27590D                                          226   6e-70   Brassica napus [oilseed rape]
gb|ABK06453.1|  flag-tagged protein kinase domain of putative mit...    225   7e-70   synthetic construct
gb|ABK06451.1|  flag-tagged protein kinase domain of putative mit...    226   7e-70   synthetic construct
ref|XP_010524023.1|  PREDICTED: serine/threonine-protein kinase H...    225   8e-70   
ref|XP_002322160.1|  kinase family protein                              225   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_009408505.1|  PREDICTED: serine/threonine-protein kinase H...    225   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008379254.1|  PREDICTED: serine/threonine-protein kinase H...    225   1e-69   Malus domestica [apple tree]
gb|KHG04358.1|  Serine/threonine-protein kinase HT1                     224   1e-69   Gossypium arboreum [tree cotton]
gb|EYU42556.1|  hypothetical protein MIMGU_mgv1a008245mg                225   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_007031439.1|  Kinase superfamily protein isoform 1               228   1e-69   
ref|XP_008672225.1|  PREDICTED: uncharacterized LOC100194330 isof...    224   2e-69   
ref|XP_002456035.1|  hypothetical protein SORBIDRAFT_03g029240          224   2e-69   Sorghum bicolor [broomcorn]
ref|XP_006408511.1|  hypothetical protein EUTSA_v10020819mg             225   2e-69   Eutrema salsugineum [saltwater cress]
gb|EPS67012.1|  hypothetical protein M569_07763                         221   2e-69   Genlisea aurea
ref|XP_010101194.1|  Serine/threonine-protein kinase HT1                224   2e-69   Morus notabilis
ref|XP_002517344.1|  protein kinase atmrk1, putative                    226   2e-69   
ref|XP_010932796.1|  PREDICTED: serine/threonine-protein kinase H...    223   2e-69   
ref|XP_004501940.1|  PREDICTED: serine/threonine-protein kinase H...    224   3e-69   Cicer arietinum [garbanzo]
ref|XP_009370793.1|  PREDICTED: serine/threonine-protein kinase H...    219   4e-69   Pyrus x bretschneideri [bai li]
ref|XP_006285018.1|  hypothetical protein CARUB_v10006325mg             223   5e-69   Capsella rubella
ref|XP_011098491.1|  PREDICTED: serine/threonine-protein kinase H...    223   5e-69   Sesamum indicum [beniseed]
gb|AAM62495.1|  protein kinase                                          223   5e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398980.1|  PREDICTED: serine/threonine-protein kinase H...    223   5e-69   
ref|XP_008438632.1|  PREDICTED: serine/threonine-protein kinase H...    223   6e-69   
ref|XP_004134436.1|  PREDICTED: serine/threonine-protein kinase H...    223   7e-69   Cucumis sativus [cucumbers]
gb|KJB28365.1|  hypothetical protein B456_005G044700                    223   8e-69   Gossypium raimondii
ref|XP_006446475.1|  hypothetical protein CICLE_v10015466mg             223   1e-68   Citrus clementina [clementine]
ref|XP_002324014.2|  kinase family protein                              223   1e-68   Populus trichocarpa [western balsam poplar]
gb|KDO66226.1|  hypothetical protein CISIN_1g015594mg                   223   1e-68   Citrus sinensis [apfelsine]
ref|XP_006470349.1|  PREDICTED: serine/threonine-protein kinase H...    223   1e-68   Citrus sinensis [apfelsine]
ref|XP_011012834.1|  PREDICTED: serine/threonine-protein kinase H...    222   1e-68   Populus euphratica
ref|NP_001167923.1|  uncharacterized LOC100381637                       222   1e-68   Zea mays [maize]
gb|KCW79810.1|  hypothetical protein EUGRSUZ_C01141                     219   2e-68   Eucalyptus grandis [rose gum]
gb|KDP21418.1|  hypothetical protein JCGZ_21889                         224   2e-68   Jatropha curcas
emb|CDY06483.1|  BnaC06g11610D                                          221   2e-68   
ref|XP_009144699.1|  PREDICTED: serine/threonine-protein kinase H...    221   3e-68   Brassica rapa
emb|CDY08298.1|  BnaA05g13210D                                          221   3e-68   
emb|CDY56447.1|  BnaA09g55660D                                          221   4e-68   
ref|XP_009116992.1|  PREDICTED: serine/threonine-protein kinase H...    221   5e-68   
ref|XP_003565864.1|  PREDICTED: serine/threonine-protein kinase H...    221   6e-68   
gb|KHG19559.1|  Serine/threonine-protein kinase HT1                     219   1e-67   
gb|EMS64705.1|  Serine/threonine-protein kinase HT1                     217   2e-67   
gb|KFK35486.1|  hypothetical protein AALP_AA5G290700                    219   2e-67   
ref|XP_009609063.1|  PREDICTED: serine/threonine-protein kinase H...    219   3e-67   
ref|XP_009784564.1|  PREDICTED: serine/threonine-protein kinase HT1     219   3e-67   
dbj|BAK01034.1|  predicted protein                                      218   4e-67   
ref|XP_002870283.1|  hypothetical protein ARALYDRAFT_915359             218   4e-67   
ref|XP_010551896.1|  PREDICTED: serine/threonine-protein kinase H...    219   4e-67   
ref|XP_009138650.1|  PREDICTED: serine/threonine-protein kinase HT1     218   4e-67   
ref|XP_006402293.1|  hypothetical protein EUTSA_v10006026mg             219   5e-67   
emb|CDY53719.1|  BnaAnng12600D                                          218   5e-67   
gb|EYU44737.1|  hypothetical protein MIMGU_mgv1a008252mg                218   6e-67   
emb|CDX93916.1|  BnaC04g20750D                                          218   7e-67   
ref|XP_006292989.1|  hypothetical protein CARUB_v10019267mg             218   7e-67   
ref|XP_008387432.1|  PREDICTED: dual specificity protein kinase s...    223   8e-67   
ref|XP_003608974.1|  Protein kinase                                     218   1e-66   
ref|XP_002878508.1|  hypothetical protein ARALYDRAFT_486830             218   1e-66   
ref|NP_191885.1|  protein kinase ATMRK1                                 217   2e-66   
gb|ABK06454.1|  flag-tagged protein kinase domain of putative mit...    217   3e-66   
ref|XP_004496695.1|  PREDICTED: serine/threonine-protein kinase H...    216   3e-66   
emb|CDX76692.1|  BnaC08g32780D                                          223   4e-66   
ref|XP_002979421.1|  hypothetical protein SELMODRAFT_177674             214   1e-65   
ref|XP_002977901.1|  hypothetical protein SELMODRAFT_271276             214   1e-65   
ref|XP_010512736.1|  PREDICTED: serine/threonine-protein kinase H...    215   1e-65   
ref|XP_010468868.1|  PREDICTED: serine/threonine-protein kinase H...    215   1e-65   
gb|AAM63482.1|  ATMRK1                                                  214   2e-65   
ref|XP_010413176.1|  PREDICTED: serine/threonine-protein kinase H...    213   4e-65   
gb|KCW60698.1|  hypothetical protein EUGRSUZ_H03426                     211   7e-65   
ref|XP_001780552.1|  predicted protein                                  211   1e-64   
ref|XP_001760569.1|  predicted protein                                  209   1e-64   
gb|AAO72572.1|  putative protein kinase                                 211   2e-64   
ref|XP_010436728.1|  PREDICTED: serine/threonine-protein kinase H...    210   2e-64   
ref|XP_011026870.1|  PREDICTED: serine/threonine-protein kinase H...    209   7e-64   
gb|KJB38188.1|  hypothetical protein B456_006G241500                    209   8e-64   
gb|KDO69704.1|  hypothetical protein CISIN_1g018489mg                   204   1e-62   
ref|XP_010695489.1|  PREDICTED: serine/threonine-protein kinase H...    207   2e-62   
gb|AFW81227.1|  putative protein kinase superfamily protein             204   2e-62   
ref|XP_003579176.1|  PREDICTED: serine/threonine-protein kinase H...    206   4e-62   
ref|XP_006664725.1|  PREDICTED: serine/threonine-protein kinase H...    206   4e-62   
ref|XP_011007524.1|  PREDICTED: serine/threonine-protein kinase H...    205   4e-62   
gb|KEH31851.1|  Serine/Threonine-kinase HT1-like protein                204   5e-62   
ref|XP_010695487.1|  PREDICTED: serine/threonine-protein kinase H...    206   7e-62   
ref|XP_006402197.1|  hypothetical protein EUTSA_v10013816mg             203   8e-62   
ref|XP_009367236.1|  PREDICTED: serine/threonine-protein kinase H...    203   1e-61   
ref|XP_009801080.1|  PREDICTED: serine/threonine-protein kinase H...    202   2e-61   
ref|NP_001067227.1|  Os12g0605900                                       204   3e-61   
gb|EAY83813.1|  hypothetical protein OsI_39030                          204   3e-61   
gb|KEH43838.1|  tyrosine kinase family protein                          202   9e-61   
ref|XP_008237834.1|  PREDICTED: serine/threonine-protein kinase H...    200   2e-60   
gb|EPS65163.1|  hypothetical protein M569_09615                         199   2e-60   
ref|XP_007199387.1|  hypothetical protein PRUPE_ppa025876mg             198   3e-60   
ref|XP_007224028.1|  hypothetical protein PRUPE_ppa015144mg             197   3e-59   
ref|XP_007224201.1|  hypothetical protein PRUPE_ppa017368mg             197   3e-59   
ref|XP_003555349.1|  PREDICTED: serine/threonine-protein kinase H...    198   3e-59   
ref|NP_974483.1|  protein kinase ATMRK1                                 197   4e-59   
ref|XP_008349491.1|  PREDICTED: serine/threonine-protein kinase H...    196   4e-59   
gb|KHN15740.1|  Serine/threonine-protein kinase HT1                     197   5e-59   
ref|XP_009389740.1|  PREDICTED: serine/threonine-protein kinase H...    194   9e-59   
ref|XP_008221867.1|  PREDICTED: serine/threonine-protein kinase H...    195   2e-58   
ref|XP_009389742.1|  PREDICTED: serine/threonine-protein kinase H...    193   5e-58   
gb|KDP26574.1|  hypothetical protein JCGZ_17732                         192   9e-58   
ref|XP_007143297.1|  hypothetical protein PHAVU_007G060400g             194   1e-57   
ref|XP_010102379.1|  Methylcrotonoyl-CoA carboxylase subunit alpha      203   1e-57   
ref|XP_004248828.1|  PREDICTED: serine/threonine-protein kinase H...    192   2e-57   
dbj|BAK07251.1|  predicted protein                                      194   2e-57   
ref|XP_010327514.1|  PREDICTED: serine/threonine-protein kinase H...    193   2e-57   
gb|EMT06750.1|  Serine/threonine-protein kinase HT1                     191   5e-57   
gb|EMT12165.1|  Serine/threonine-protein kinase HT1                     192   2e-56   
ref|XP_006655138.1|  PREDICTED: serine/threonine-protein kinase H...    190   4e-56   
ref|XP_004298582.1|  PREDICTED: serine/threonine-protein kinase H...    189   5e-56   
ref|XP_008345194.1|  PREDICTED: serine/threonine-protein kinase H...    182   6e-56   
gb|EMS66251.1|  Serine/threonine-protein kinase HT1                     194   1e-55   
ref|XP_008353113.1|  PREDICTED: serine/threonine-protein kinase H...    188   2e-55   
ref|XP_008342006.1|  PREDICTED: serine/threonine-protein kinase H...    188   2e-55   
gb|EMS55472.1|  Serine/threonine-protein kinase HT1                     185   6e-54   
dbj|BAJ93563.1|  predicted protein                                      184   9e-54   
dbj|BAK01060.1|  predicted protein                                      184   1e-53   
gb|EMT12243.1|  Serine/threonine-protein kinase HT1                     184   1e-53   
ref|XP_002466472.1|  hypothetical protein SORBIDRAFT_01g008340          182   9e-53   
ref|XP_004981804.1|  PREDICTED: serine/threonine-protein kinase H...    182   1e-52   
ref|XP_006651812.1|  PREDICTED: serine/threonine-protein kinase H...    180   4e-52   
ref|XP_008665404.1|  PREDICTED: serine/threonine-protein kinase H...    180   6e-52   
ref|XP_008646500.1|  PREDICTED: serine/threonine-protein kinase H...    178   3e-51   
ref|XP_006664565.1|  PREDICTED: serine/threonine-protein kinase H...    177   3e-51   
ref|XP_006655136.1|  PREDICTED: serine/threonine-protein kinase H...    176   3e-51   
ref|XP_003559434.2|  PREDICTED: serine/threonine-protein kinase H...    173   1e-50   
ref|XP_008349494.1|  PREDICTED: serine/threonine-protein kinase H...    172   2e-50   
ref|XP_006662364.1|  PREDICTED: serine/threonine-protein kinase H...    174   2e-50   
gb|EAY90862.1|  hypothetical protein OsI_12469                          174   6e-50   
ref|XP_004309026.2|  PREDICTED: serine/threonine-protein kinase H...    171   2e-49   
gb|AFW67648.1|  putative protein kinase superfamily protein             174   2e-49   
gb|AAK71566.1|AC087852_26  putative protein kinase                      172   7e-49   
ref|XP_006653214.1|  PREDICTED: serine/threonine-protein kinase H...    165   1e-48   
ref|XP_006663314.1|  PREDICTED: serine/threonine-protein kinase H...    167   5e-48   
ref|XP_006653213.1|  PREDICTED: serine/threonine-protein kinase H...    166   3e-47   
ref|XP_009589903.1|  PREDICTED: serine/threonine-protein kinase H...    164   3e-46   
ref|XP_007044614.1|  Kinase superfamily protein, putative               164   3e-46   
ref|XP_006341856.1|  PREDICTED: serine/threonine-protein kinase H...    163   4e-46   
ref|XP_006655137.1|  PREDICTED: serine/threonine-protein kinase H...    159   5e-45   
gb|AAU87883.1|  serine/threonine protein kinase 1                       155   7e-45   
ref|XP_006339295.1|  PREDICTED: serine/threonine-protein kinase H...    158   3e-44   
ref|XP_009799174.1|  PREDICTED: serine/threonine-protein kinase H...    160   7e-44   
ref|XP_004309028.1|  PREDICTED: serine/threonine-protein kinase H...    155   3e-43   
ref|XP_010319643.1|  PREDICTED: probable LIM domain-containing se...    155   1e-42   
gb|KGN63590.1|  hypothetical protein Csa_1G005510                       147   2e-42   
gb|EEC69302.1|  hypothetical protein OsI_38367                          152   5e-42   
gb|EEE53231.1|  hypothetical protein OsJ_36131                          150   5e-41   
gb|ABA98283.1|  ATMRK1, putative                                        150   6e-41   
ref|XP_002963737.1|  hypothetical protein SELMODRAFT_34528              145   5e-40   
ref|XP_001770041.1|  predicted protein                                  137   9e-36   
ref|XP_001697921.1|  hypothetical protein CHLREDRAFT_105918             137   2e-35   
gb|EEE59917.1|  hypothetical protein OsJ_12544                          135   2e-35   
ref|XP_006343130.1|  PREDICTED: dual specificity protein kinase z...    135   5e-35   
ref|XP_001764651.1|  predicted protein                                  134   7e-35   
ref|XP_006353824.1|  PREDICTED: serine/threonine-protein kinase H...    130   1e-34   
ref|XP_010319080.1|  PREDICTED: serine/threonine-protein kinase H...    131   4e-34   
ref|XP_001760542.1|  predicted protein                                  133   5e-34   
ref|XP_004169709.1|  PREDICTED: serine/threonine-protein kinase H...    130   5e-34   
ref|XP_010928730.1|  PREDICTED: serine/threonine-protein kinase H...    132   5e-34   
gb|KJB58024.1|  hypothetical protein B456_009G190600                    131   6e-34   
emb|CDP07336.1|  unnamed protein product                                133   7e-34   
ref|XP_001770798.1|  predicted protein                                  132   8e-34   
ref|XP_009588109.1|  PREDICTED: serine/threonine-protein kinase H...    132   9e-34   
ref|XP_002986767.1|  hypothetical protein SELMODRAFT_43546              129   9e-34   
ref|XP_009802640.1|  PREDICTED: serine/threonine-protein kinase H...    132   9e-34   
ref|XP_001758175.1|  predicted protein                                  132   9e-34   
gb|KJB58021.1|  hypothetical protein B456_009G190600                    131   1e-33   
gb|KJB58016.1|  hypothetical protein B456_009G190600                    131   1e-33   
ref|XP_009588108.1|  PREDICTED: serine/threonine-protein kinase E...    132   1e-33   
ref|XP_009802639.1|  PREDICTED: serine/threonine-protein kinase E...    132   1e-33   
ref|XP_002954493.1|  hypothetical protein VOLCADRAFT_64912              132   1e-33   
ref|XP_001755358.1|  predicted protein                                  132   2e-33   
ref|XP_002969519.1|  hypothetical protein SELMODRAFT_63609              128   2e-33   
gb|ACN41173.1|  unknown                                                 130   3e-33   
gb|KJB58019.1|  hypothetical protein B456_009G190600                    131   3e-33   
gb|KJB58023.1|  hypothetical protein B456_009G190600                    131   3e-33   
ref|XP_004231068.1|  PREDICTED: serine/threonine-protein kinase H...    131   3e-33   
emb|CBI18907.3|  unnamed protein product                                130   3e-33   
ref|XP_004231067.1|  PREDICTED: serine/threonine-protein kinase H...    131   3e-33   
ref|XP_006364514.1|  PREDICTED: serine/threonine-protein kinase C...    131   4e-33   
ref|XP_006404431.1|  hypothetical protein EUTSA_v10010300mg             130   4e-33   
ref|XP_010664108.1|  PREDICTED: serine/threonine-protein kinase T...    130   4e-33   
ref|XP_003589569.1|  Protein kinase like protein                        129   5e-33   
ref|XP_010664107.1|  PREDICTED: serine/threonine-protein kinase T...    130   5e-33   
ref|XP_006480980.1|  PREDICTED: probable serine/threonine-protein...    128   5e-33   
ref|XP_008809078.1|  PREDICTED: serine/threonine-protein kinase HT1     129   5e-33   
gb|KJB15878.1|  hypothetical protein B456_002G201200                    130   5e-33   
ref|XP_008221194.1|  PREDICTED: serine/threonine-protein kinase H...    130   5e-33   
gb|KJB15877.1|  hypothetical protein B456_002G201200                    130   6e-33   
gb|KDP26301.1|  hypothetical protein JCGZ_22286                         130   6e-33   
emb|CDY13414.1|  BnaA03g51320D                                          129   6e-33   
dbj|BAJ94760.1|  predicted protein                                      129   6e-33   
ref|XP_009137995.1|  PREDICTED: serine/threonine-protein kinase H...    129   6e-33   
ref|XP_011083413.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    130   6e-33   
ref|XP_003589570.1|  Protein kinase like protein                        129   6e-33   
gb|AES59818.2|  ACT-like tyrosine kinase family protein                 129   6e-33   
gb|KDO68201.1|  hypothetical protein CISIN_1g008171mg                   129   7e-33   
gb|AAK64576.1|  serine/threonine protein kinase                         129   7e-33   
ref|XP_003589568.1|  Protein kinase like protein                        129   8e-33   
emb|CBI35719.3|  unnamed protein product                                125   9e-33   
ref|XP_009355586.1|  PREDICTED: serine/threonine-protein kinase H...    130   9e-33   
ref|XP_006828865.1|  hypothetical protein AMTR_s00001p00169860          130   9e-33   
gb|KJB15879.1|  hypothetical protein B456_002G201200                    130   9e-33   
ref|XP_008348932.1|  PREDICTED: focal adhesion kinase 1-like            130   9e-33   
ref|XP_008789612.1|  PREDICTED: serine/threonine-protein kinase H...    129   9e-33   
ref|XP_007017926.1|  ACT-like protein tyrosine kinase family prot...    129   1e-32   
ref|XP_009334459.1|  PREDICTED: serine/threonine-protein kinase H...    130   1e-32   
gb|KJB15880.1|  hypothetical protein B456_002G201200                    129   1e-32   
ref|XP_008466449.1|  PREDICTED: ephrin type-B receptor 3-like iso...    129   1e-32   
ref|XP_003589567.1|  Protein kinase like protein                        129   1e-32   
ref|XP_010266065.1|  PREDICTED: serine/threonine-protein kinase E...    129   1e-32   
ref|XP_009401360.1|  PREDICTED: probable serine/threonine-protein...    130   1e-32   
ref|XP_009401368.1|  PREDICTED: probable serine/threonine-protein...    130   1e-32   
ref|XP_010932795.1|  PREDICTED: serine/threonine-protein kinase H...    127   1e-32   
ref|XP_011459090.1|  PREDICTED: serine/threonine-protein kinase H...    129   1e-32   
ref|XP_002510613.1|  protein kinase, putative                           131   1e-32   
ref|XP_008382083.1|  PREDICTED: dual specificity protein kinase zakA    129   1e-32   
ref|XP_008466450.1|  PREDICTED: serine/threonine-protein kinase H...    129   1e-32   
ref|XP_010927157.1|  PREDICTED: serine/threonine-protein kinase H...    128   1e-32   
ref|XP_009415599.1|  PREDICTED: serine/threonine-protein kinase S...    129   1e-32   
gb|ACN40743.1|  unknown                                                 129   1e-32   
ref|XP_011045600.1|  PREDICTED: tyrosine-protein kinase BTK-like ...    129   1e-32   
ref|XP_006379296.1|  hypothetical protein POPTR_0009s14130g             129   1e-32   
ref|XP_008466447.1|  PREDICTED: tyrosine-protein kinase Abl-like ...    129   1e-32   
gb|KDO68202.1|  hypothetical protein CISIN_1g008171mg                   129   2e-32   
ref|XP_005649669.1|  hypothetical protein COCSUDRAFT_35653              128   2e-32   
ref|XP_008466446.1|  PREDICTED: tyrosine-protein kinase Abl-like ...    129   2e-32   
ref|XP_006850997.1|  hypothetical protein AMTR_s00025p00215680          128   2e-32   
gb|AAO72550.1|  serine/thronine protein kinase-like protein             127   2e-32   
ref|NP_001061274.1|  Os08g0224100                                       128   2e-32   
ref|XP_009408070.1|  PREDICTED: serine/threonine-protein kinase H...    128   2e-32   
gb|KDO71371.1|  hypothetical protein CISIN_1g015868mg                   127   2e-32   
gb|AGA37223.1|  mitogen-activated protein kinase kinase kinase Ra...    128   2e-32   
gb|KDO71370.1|  hypothetical protein CISIN_1g015868mg                   127   2e-32   
ref|XP_010314846.1|  PREDICTED: serine/threonine-protein kinase H...    128   2e-32   
emb|CDX72296.1|  BnaC07g43180D                                          128   2e-32   
gb|KDO71369.1|  hypothetical protein CISIN_1g015868mg                   127   2e-32   
gb|KDO68200.1|  hypothetical protein CISIN_1g008171mg                   128   2e-32   
ref|XP_002306203.2|  hypothetical protein POPTR_0004s18550g             128   2e-32   
ref|XP_006422519.1|  hypothetical protein CICLE_v10028093mg             129   2e-32   
ref|XP_006659220.1|  PREDICTED: serine/threonine-protein kinase H...    128   2e-32   
ref|XP_011459088.1|  PREDICTED: probable serine/threonine-protein...    129   2e-32   
emb|CDY36453.1|  BnaC03g67730D                                          128   2e-32   
ref|XP_006486672.1|  PREDICTED: serine/threonine-protein kinase C...    129   2e-32   
emb|CDY23284.1|  BnaA08g12620D                                          127   2e-32   
ref|XP_008387894.1|  PREDICTED: serine/threonine-protein kinase H...    129   2e-32   
gb|KDO71372.1|  hypothetical protein CISIN_1g015868mg                   127   2e-32   
ref|XP_011459087.1|  PREDICTED: RGS domain-containing serine/thre...    129   2e-32   
ref|XP_006285418.1|  hypothetical protein CARUB_v10006831mg             127   2e-32   
ref|XP_010099737.1|  Serine/threonine-protein kinase HT1                124   2e-32   
ref|XP_002867311.1|  kinase family protein                              127   2e-32   
ref|XP_006412622.1|  hypothetical protein EUTSA_v10025332mg             127   2e-32   
ref|XP_010438071.1|  PREDICTED: serine/threonine-protein kinase H...    127   2e-32   
ref|XP_010447609.1|  PREDICTED: serine/threonine-protein kinase H...    127   2e-32   
ref|NP_194846.1|  protein kinase family protein                         127   2e-32   
gb|EYU17550.1|  hypothetical protein MIMGU_mgv1a004130mg                128   2e-32   
ref|XP_010101284.1|  Serine/threonine-protein kinase HT1                129   2e-32   



>dbj|BAO57281.1| protein kinase family protein [Ipomoea nil]
Length=401

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  229  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  288

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIP  CPSSLA
Sbjct  289  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPRCCPSSLA  348

Query  5    S  3
            S
Sbjct  349  S  349



>gb|EYU41453.1| hypothetical protein MIMGU_mgv1a007874mg [Erythranthe guttata]
 gb|EYU41454.1| hypothetical protein MIMGU_mgv1a007874mg [Erythranthe guttata]
Length=392

 Score =   244 bits (624),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDT R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSKKIVHRDVKAENMLLDTQRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPY+RKCDVYSFG+CLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIP  CPSSLA
Sbjct  280  VLDGKPYDRKCDVYSFGICLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPRCCPSSLA  339

Query  5    S  3
            S
Sbjct  340  S  340



>ref|XP_002300823.2| hypothetical protein POPTR_0002s05060g [Populus trichocarpa]
 gb|EEE80096.2| hypothetical protein POPTR_0002s05060g [Populus trichocarpa]
Length=291

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  119  RGLSYLHSKKIVHRDVKTENMLLDATRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  178

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEVSSAVVRQ+LRPEIP  CPSSLA
Sbjct  179  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEVSSAVVRQHLRPEIPRCCPSSLA  238

Query  5    S  3
            S
Sbjct  239  S  239



>ref|XP_009802442.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
 ref|XP_009802443.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
 ref|XP_009802444.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
 ref|XP_009802445.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
 ref|XP_009802446.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
Length=404

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDT+R LKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  232  RGLSYLHSKKIVHRDVKAENMLLDTNRTLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  291

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCDLPYPDLSFAEVSSAVVRQNLRP+IP  CPSSL+
Sbjct  292  VLDGKPYNRKCDVYSFGICLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPDIPRCCPSSLS  351



>ref|XP_009628978.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628979.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628980.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628981.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628983.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628984.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=405

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDT+R LKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  233  RGLSYLHSKKIVHRDVKAENMLLDTNRTLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  292

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCDLPYPDLSFAEVSSAVVRQNLRP+IP  CPSSL+
Sbjct  293  VLDGKPYNRKCDVYSFGICLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPDIPRCCPSSLS  352



>ref|XP_010932793.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010932794.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Elaeis 
guineensis]
Length=390

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSF EVSSAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLEGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFVEVSSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_006360755.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X4 
[Solanum tuberosum]
Length=393

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEVSSAVVRQNLRP IP  CPSS++
Sbjct  280  VLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVS  339

Query  5    S  3
            +
Sbjct  340  N  340



>ref|XP_004247585.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
 ref|XP_010326681.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
 ref|XP_010326682.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
 ref|XP_010326683.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
 ref|XP_010326684.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
Length=395

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEVSSAVVRQNLRP IP  CPSS++
Sbjct  280  VLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPNIPKCCPSSVS  339

Query  5    S  3
            +
Sbjct  340  N  340



>ref|XP_006360752.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Solanum tuberosum]
 ref|XP_006360753.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Solanum tuberosum]
 ref|XP_006360754.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X3 
[Solanum tuberosum]
Length=395

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEVSSAVVRQNLRP IP  CPSS++
Sbjct  280  VLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVS  339

Query  5    S  3
            +
Sbjct  340  N  340



>ref|XP_010938227.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=386

 Score =   241 bits (615),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSRKIVHRDVKTENMLLDAHRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEVSSAVVRQNLRPEIP  CPS+LA
Sbjct  275  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEVSSAVVRQNLRPEIPRCCPSALA  334

Query  5    S  3
            +
Sbjct  335  N  335



>ref|XP_008795684.1| PREDICTED: serine/threonine-protein kinase HT1-like [Phoenix 
dactylifera]
Length=386

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENM+LD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSRKIVHRDVKTENMILDAHRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEVSSAVVRQNLRPEIP  CPS+LA
Sbjct  275  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEVSSAVVRQNLRPEIPRCCPSALA  334

Query  5    S  3
            +
Sbjct  335  N  335



>ref|XP_011032655.1| PREDICTED: serine/threonine-protein kinase HT1-like [Populus 
euphratica]
Length=399

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD SR LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  227  RGLSYLHSKKIVHRDVKTENMLLDASRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  286

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFAEVSSAVVRQ+LRPEIP  CPSSLA
Sbjct  287  VLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFAEVSSAVVRQHLRPEIPRCCPSSLA  346

Query  5    S  3
            S
Sbjct  347  S  347



>ref|XP_006298274.1| hypothetical protein CARUB_v10014341mg [Capsella rubella]
 gb|EOA31172.1| hypothetical protein CARUB_v10014341mg [Capsella rubella]
Length=281

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  109  RGLSYLHSKKIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  168

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP++P  CP+SLA
Sbjct  169  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDMPRCCPTSLA  228

Query  5    S  3
            +
Sbjct  229  T  229



>ref|XP_011462541.1| PREDICTED: serine/threonine-protein kinase HT1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462542.1| PREDICTED: serine/threonine-protein kinase HT1 [Fragaria vesca 
subsp. vesca]
Length=390

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDIDRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWE+YCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLDGKPYNRRCDVYSFGICLWEMYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            S
Sbjct  338  S  338



>gb|ACU23132.1| unknown [Glycine max]
Length=223

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHSKKIVHRDVK ENMLLDTSRNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  51   RGLNYLHSKKIVHRDVKTENMLLDTSRNLKIADFGVARVEAMNPSDMTGETGTLGYMAPE  110

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CPS+LA
Sbjct  111  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPSALA  170

Query  5    S  3
            +
Sbjct  171  N  171



>ref|XP_010092417.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB51135.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=384

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  212  RGLSYLHSKKIVHRDVKTENMLLDAHRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  271

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA++SSAVVRQNLRPEIP  CPSSLA
Sbjct  272  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADISSAVVRQNLRPEIPRCCPSSLA  331

Query  5    S  3
            +
Sbjct  332  N  332



>gb|KJB46968.1| hypothetical protein B456_008G003000 [Gossypium raimondii]
Length=390

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSKKIVHRDVKTENMLLDTRRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DL+FAEVSSAVVRQNLRPEIP  CP SLA
Sbjct  279  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLTFAEVSSAVVRQNLRPEIPRCCPGSLA  338

Query  5    S  3
            S
Sbjct  339  S  339



>ref|XP_002307603.2| kinase family protein [Populus trichocarpa]
 gb|EEE94599.2| kinase family protein [Populus trichocarpa]
Length=399

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  227  RGLSYLHSKKIVHRDVKTENMLLDATRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  286

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFAEVSSAVVRQ+LRPEIP  CPSSLA
Sbjct  287  VLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFAEVSSAVVRQHLRPEIPRCCPSSLA  346

Query  5    S  3
            S
Sbjct  347  S  347



>gb|KDP40216.1| hypothetical protein JCGZ_02214 [Jatropha curcas]
Length=387

 Score =   239 bits (609),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  274  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSSLA  333

Query  5    S  3
            S
Sbjct  334  S  334



>ref|XP_011090685.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
 ref|XP_011090686.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
 ref|XP_011090687.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=407

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDT R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  235  RGLSYLHSKKIVHRDVKAENMLLDTQRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  294

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEVSSAVV QNLRPEIP  CPSSLA
Sbjct  295  VLDGKPYNRKCDVYSFGICLWEIYCCDLPYTDLSFAEVSSAVVSQNLRPEIPRCCPSSLA  354

Query  5    S  3
            +
Sbjct  355  N  355



>gb|ABK25384.1| unknown [Picea sitchensis]
Length=390

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVARVEAQNPKDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCC++PYPDLSFAE++SAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLDGKPYNRKCDVYSFGICLWEIYCCEMPYPDLSFAELTSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_008804977.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
 ref|XP_008804978.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
 ref|XP_008804979.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
 ref|XP_008804980.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
Length=390

 Score =   239 bits (609),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDT RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPQDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYN +CDVYSFG+CLWEIYCCD+PYPDLSF EVSSAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLEGKPYNHRCDVYSFGICLWEIYCCDMPYPDLSFVEVSSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_008813069.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
 ref|XP_008813072.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
Length=390

 Score =   239 bits (609),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYN KCDVYSFG+CLWEIYCCD+PYPDLSF EVSSAVVRQNLRPEIP  CP+SLA
Sbjct  278  VLEGKPYNHKCDVYSFGICLWEIYCCDMPYPDLSFVEVSSAVVRQNLRPEIPRCCPNSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_008390925.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Malus 
domestica]
Length=406

 Score =   239 bits (609),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  234  RGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  293

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  294  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPKCCPSSLA  353

Query  5    S  3
            S
Sbjct  354  S  354



>gb|EPS58146.1| hypothetical protein M569_16670, partial [Genlisea aurea]
Length=377

 Score =   238 bits (607),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  205  RGLSYLHSKKIVHRDVKAENMLLDQHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  264

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCDLPYPDLSFAE+SSAVVRQNLRP IP  CPSSL 
Sbjct  265  VLDGKPYNRKCDVYSFGICLWEIYCCDLPYPDLSFAEISSAVVRQNLRPGIPRCCPSSLG  324

Query  5    S  3
            S
Sbjct  325  S  325



>gb|KHG26740.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=390

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSKKIVHRDVKTENMLLDARRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DLSFAEVSSAVVRQNLRPEIP  CP SLA
Sbjct  279  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLSFAEVSSAVVRQNLRPEIPRCCPGSLA  338

Query  5    S  3
            S
Sbjct  339  S  339



>gb|KDO68661.1| hypothetical protein CISIN_1g0487241mg, partial [Citrus sinensis]
Length=281

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSK IVHRDVK ENMLLD +R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  109  RGLSYLHSKTIVHRDVKTENMLLDANRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  168

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSF +VSSAVVRQNLRP+IP  CPSSLA
Sbjct  169  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFTDVSSAVVRQNLRPDIPRCCPSSLA  228

Query  5    S  3
            S
Sbjct  229  S  229



>ref|XP_006444022.1| hypothetical protein CICLE_v10020502mg [Citrus clementina]
 ref|XP_006479679.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
 gb|ESR57262.1| hypothetical protein CICLE_v10020502mg [Citrus clementina]
Length=394

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  222  RGLSYLHSKKIVHRDVKTENMLLDANRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  281

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSF +VSSAVVRQNLRP+IP  CPSSLA
Sbjct  282  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFTDVSSAVVRQNLRPDIPRCCPSSLA  341

Query  5    S  3
            S
Sbjct  342  S  342



>emb|CDO99092.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLDT R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  232  RGLSYLHSKKIVHRDVKAENMLLDTYRTLKIADFGVARVEAQNPQDMTGETGTLGYMAPE  291

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCDLPY DLSFAEVSSAVVRQNLRPEIP  CPS LA
Sbjct  292  VLDGKPYNRKCDVYSFGICLWEIYCCDLPYTDLSFAEVSSAVVRQNLRPEIPRCCPSPLA  351

Query  5    S  3
            +
Sbjct  352  N  352



>ref|XP_006406131.1| hypothetical protein EUTSA_v10020938mg [Eutrema salsugineum]
 ref|XP_006406132.1| hypothetical protein EUTSA_v10020938mg [Eutrema salsugineum]
 gb|ESQ47584.1| hypothetical protein EUTSA_v10020938mg [Eutrema salsugineum]
 gb|ESQ47585.1| hypothetical protein EUTSA_v10020938mg [Eutrema salsugineum]
Length=378

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  206  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CP+SL+
Sbjct  266  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPTSLS  325

Query  5    S  3
            S
Sbjct  326  S  326



>ref|XP_010917790.1| PREDICTED: serine/threonine-protein kinase HT1 [Elaeis guineensis]
Length=390

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDT +NLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDTQQNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYN +CDVYSFG+CLWEIYCCD+PYPDLSF EVSSAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLEGKPYNHRCDVYSFGICLWEIYCCDMPYPDLSFVEVSSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>gb|KFK39560.1| hypothetical protein AALP_AA3G260100 [Arabis alpina]
Length=350

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  178  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  237

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CP+SL+
Sbjct  238  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPTSLS  297

Query  5    S  3
            S
Sbjct  298  S  298



>ref|XP_007223356.1| hypothetical protein PRUPE_ppa007453mg [Prunus persica]
 gb|EMJ24555.1| hypothetical protein PRUPE_ppa007453mg [Prunus persica]
Length=367

 Score =   236 bits (603),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  195  RGLSYLHSQKIVHRDVKTENMLLDTRRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  254

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWE+YCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSS +
Sbjct  255  VLDGKPYNRRCDVYSFGICLWEVYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSSFS  314

Query  5    S  3
            +
Sbjct  315  N  315



>ref|XP_006489437.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
 gb|KDO74495.1| hypothetical protein CISIN_1g036382mg [Citrus sinensis]
Length=390

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD+ R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDSQRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL GKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLQGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_008348902.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=382

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  210  RGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  269

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  270  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPKCCPSSLA  329

Query  5    S  3
            +
Sbjct  330  N  330



>ref|XP_009371960.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=406

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  234  RGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  293

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  294  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPKCCPSSLA  353

Query  5    S  3
            +
Sbjct  354  N  354



>ref|XP_009335290.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=406

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  234  RGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  293

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  294  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPKCCPSSLA  353

Query  5    S  3
            +
Sbjct  354  N  354



>ref|XP_006420001.1| hypothetical protein CICLE_v10005137mg [Citrus clementina]
 gb|ESR33241.1| hypothetical protein CICLE_v10005137mg [Citrus clementina]
Length=390

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD+ R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDSQRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL GKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLQGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_007201088.1| hypothetical protein PRUPE_ppa007037mg [Prunus persica]
 gb|EMJ02287.1| hypothetical protein PRUPE_ppa007037mg [Prunus persica]
Length=385

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            +GLSYLHSKKIVHRDVK ENMLLDT R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  213  KGLSYLHSKKIVHRDVKTENMLLDTHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+VSSAVVRQNLRPEIP  CP++LA
Sbjct  273  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADVSSAVVRQNLRPEIPRCCPTALA  332

Query  5    S  3
            S
Sbjct  333  S  333



>ref|XP_009369877.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=406

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT  NLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  234  RGLSYLHSQKIVHRDVKTENMLLDTRINLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  293

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  294  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPKCCPSSLA  353

Query  5    S  3
            +
Sbjct  354  N  354



>ref|XP_007050528.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94685.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=424

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  253  RGLSYLHSKKIVHRDVKTENMLLDPRRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  312

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PY DLSFAEVSSAVVRQNLRPEIP  CPSSLA
Sbjct  313  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYADLSFAEVSSAVVRQNLRPEIPRCCPSSLA  372

Query  5    S  3
            S
Sbjct  373  S  373



>ref|XP_002312543.2| hypothetical protein POPTR_0008s15580g [Populus trichocarpa]
 gb|EEE89910.2| hypothetical protein POPTR_0008s15580g [Populus trichocarpa]
Length=390

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD+ RNLKIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDSHRNLKIADFGVARVEAQNPCDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYP+LSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPNLSFADVSSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_003517568.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Glycine 
max]
 ref|XP_006573871.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Glycine 
max]
 ref|XP_006573872.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X3 [Glycine 
max]
 ref|XP_006573873.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X4 [Glycine 
max]
 gb|KHN34113.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=387

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHSKKIVHRDVK ENMLLDTSRNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  215  RGLNYLHSKKIVHRDVKTENMLLDTSRNLKIADFGVARVEAMNPSDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CPS+LA
Sbjct  275  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPSALA  334

Query  5    S  3
            +
Sbjct  335  N  335



>ref|XP_010525217.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
 ref|XP_010525218.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=394

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  222  RGLSYLHSKKIVHRDVKTENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  281

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DLSF +VSSAVVRQNLRP+IP  CP++LA
Sbjct  282  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLSFVQVSSAVVRQNLRPDIPRCCPTALA  341

Query  5    S  3
            +
Sbjct  342  N  342



>ref|XP_002524739.1| protein kinase atmrk1, putative [Ricinus communis]
 gb|EEF37582.1| protein kinase atmrk1, putative [Ricinus communis]
Length=444

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  225  RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  284

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEVSS VVRQNLRPEIP  CP+S+A
Sbjct  285  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEVSSQVVRQNLRPEIPRCCPNSVA  344

Query  5    S  3
            S
Sbjct  345  S  345



>ref|XP_007050529.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX94686.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=432

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  261  RGLSYLHSKKIVHRDVKTENMLLDPRRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  320

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PY DLSFAEVSSAVVRQNLRPEIP  CPSSLA
Sbjct  321  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYADLSFAEVSSAVVRQNLRPEIPRCCPSSLA  380

Query  5    S  3
            S
Sbjct  381  S  381



>ref|XP_008386459.1| PREDICTED: serine/threonine-protein kinase HT1 [Malus domestica]
Length=378

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            +GLSYLH+KKIVHRDVK ENMLLDT R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  206  KGLSYLHTKKIVHRDVKTENMLLDTHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+VSSAVVRQNLRPEIP  CPS+LA
Sbjct  266  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADVSSAVVRQNLRPEIPRCCPSTLA  325

Query  5    S  3
            S
Sbjct  326  S  326



>ref|XP_007034830.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY05756.1| Kinase superfamily protein [Theobroma cacao]
Length=477

 Score =   239 bits (609),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  221  RGLSYLHSRKIVHRDVKTENMLLDIHRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  280

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSSLA
Sbjct  281  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSSLA  340

Query  5    S  3
            S
Sbjct  341  S  341



>ref|XP_009405934.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405935.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405936.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405937.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   236 bits (602),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDT+R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDTNRKLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DLSF +VSSAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLSFVDVSSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_010259112.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
Length=388

 Score =   236 bits (601),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD+ RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSKKIVHRDVKTENMLLDSHRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PY DLSF+EVSSAVVRQNLRPEIP  CP+S A
Sbjct  275  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYADLSFSEVSSAVVRQNLRPEIPRCCPNSFA  334

Query  5    S  3
            +
Sbjct  335  N  335



>ref|XP_009367596.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=378

 Score =   236 bits (601),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            +GLSYLH+KKIVHRDVK ENMLLDT R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  206  KGLSYLHAKKIVHRDVKTENMLLDTHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+VSSAVVRQNLRPEIP  CPS+LA
Sbjct  266  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADVSSAVVRQNLRPEIPRCCPSTLA  325

Query  5    S  3
            S
Sbjct  326  S  326



>ref|XP_002885523.1| hypothetical protein ARALYDRAFT_898756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61782.1| hypothetical protein ARALYDRAFT_898756 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  206  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP+SLA
Sbjct  266  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPTSLA  325

Query  5    S  3
            +
Sbjct  326  T  326



>ref|XP_006838998.1| hypothetical protein AMTR_s00002p00271860 [Amborella trichopoda]
 gb|ERN01567.1| hypothetical protein AMTR_s00002p00271860 [Amborella trichopoda]
Length=398

 Score =   236 bits (602),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD SR LKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  225  RGLSYLHSKKIVHRDVKTENMLLDASRTLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  284

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYNR+CDVYSFG+CLWEIYCC++PYPDLSFAEVS+AVVRQNLRPEIP  CPSSL 
Sbjct  285  VLNGKPYNRRCDVYSFGICLWEIYCCEMPYPDLSFAEVSAAVVRQNLRPEIPRCCPSSLV  344

Query  5    S  3
            +
Sbjct  345  N  345



>emb|CAN82019.1| hypothetical protein VITISV_003418 [Vitis vinifera]
Length=368

 Score =   235 bits (600),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  196  RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  255

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFA++SSAVVRQNLRP+IP  CPSSLA
Sbjct  256  VLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFADISSAVVRQNLRPDIPRCCPSSLA  315

Query  5    S  3
            S
Sbjct  316  S  316



>emb|CDY34236.1| BnaA01g24530D [Brassica napus]
Length=350

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  178  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  237

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP+SL+
Sbjct  238  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPTSLS  297

Query  5    S  3
            S
Sbjct  298  S  298



>ref|XP_010651999.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
Length=406

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  234  RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  293

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFA++SSAVVRQNLRP+IP  CPSSLA
Sbjct  294  VLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFADISSAVVRQNLRPDIPRCCPSSLA  353

Query  5    S  3
            S
Sbjct  354  S  354



>dbj|BAJ94876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  201  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  260

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP+IP  CPS+ A
Sbjct  261  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFA  320

Query  5    S  3
            +
Sbjct  321  N  321



>emb|CBI28728.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  232  RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  291

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWE YCCD+PYPDLSFA++SSAVVRQNLRP+IP  CPSSLA
Sbjct  292  VLDGKPYNRKCDVYSFGICLWETYCCDMPYPDLSFADISSAVVRQNLRPDIPRCCPSSLA  351

Query  5    S  3
            S
Sbjct  352  S  352



>gb|AGG38032.1| mitogen activated protein kinase kinase kinase 27 [Oryza sativa 
Indica Group]
Length=379

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  207  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  266

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP++P  CPS+ A
Sbjct  267  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDVPRCCPSAFA  326

Query  5    S  3
            +
Sbjct  327  N  327



>gb|EMT10391.1| Serine/threonine-protein kinase HT1 [Aegilops tauschii]
Length=399

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  201  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  260

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP+IP  CPS+ A
Sbjct  261  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFA  320

Query  5    S  3
            +
Sbjct  321  N  321



>gb|ADP37972.1| protein kinase-like protein [Brassica napus]
Length=303

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  131  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  190

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPD SFA+VSSAVVRQNLRP+IP  CP+SL+
Sbjct  191  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDFSFADVSSAVVRQNLRPDIPRCCPTSLS  250

Query  5    S  3
            S
Sbjct  251  S  251



>ref|XP_010024234.1| PREDICTED: serine/threonine-protein kinase HT1 [Eucalyptus grandis]
 gb|KCW60697.1| hypothetical protein EUGRSUZ_H03426 [Eucalyptus grandis]
Length=385

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  RNLKIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  213  RGLSYLHSKKIVHRDVKTENMLLDGQRNLKIADFGVARVEAQNPCDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPE+P  CPSSLA
Sbjct  273  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEMPRCCPSSLA  332

Query  5    S  3
            +
Sbjct  333  N  333



>ref|XP_008786039.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
Length=390

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSRKIVHRDVKTENMLLDAHRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFAEVSSAVV QNLRPEIP  CPS+LA
Sbjct  278  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFAEVSSAVVWQNLRPEIPRCCPSALA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_010232261.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
Length=376

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  204  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  263

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP++P  CPS+ A
Sbjct  264  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDVPRCCPSAFA  323

Query  5    S  3
            +
Sbjct  324  N  324



>gb|AAR01726.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAT77865.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF97807.1| protein kinase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAH01713.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  207  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  266

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP++P  CPS+ A
Sbjct  267  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDVPRCCPSAFA  326

Query  5    S  3
            +
Sbjct  327  N  327



>ref|XP_010923541.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=390

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSRKIVHRDVKTENMLLDAHRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP LSFA+VSSAVV+QNLRPEIP  CPS+LA
Sbjct  278  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPHLSFADVSSAVVQQNLRPEIPRCCPSALA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_010679276.1| PREDICTED: cysteine-rich receptor-like protein kinase 27 [Beta 
vulgaris subsp. vulgaris]
Length=679

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDT+RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  506  RGLSYLHSKKIVHRDVKTENMLLDTNRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  565

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPE+P  CP SLA
Sbjct  566  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEMPRCCPPSLA  625

Query  5    S  3
            S
Sbjct  626  S  626



>ref|XP_009108716.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brassica 
rapa]
 emb|CDY55265.1| BnaCnng28670D [Brassica napus]
Length=380

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  208  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  267

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP+SL+
Sbjct  268  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPTSLS  327

Query  5    S  3
            S
Sbjct  328  S  328



>ref|XP_010511655.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
 ref|XP_010488307.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=379

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  207  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  266

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP+SLA
Sbjct  267  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPTSLA  326



>ref|XP_008235378.1| PREDICTED: serine/threonine-protein kinase HT1 [Prunus mume]
Length=385

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            +GLSYLHSKKIVHRDVK ENMLLDT R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  213  KGLSYLHSKKIVHRDVKTENMLLDTHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+VSSAVVRQNLRPEIP  CP++L 
Sbjct  273  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADVSSAVVRQNLRPEIPRCCPTALV  332

Query  5    S  3
            S
Sbjct  333  S  333



>ref|XP_006650329.1| PREDICTED: serine/threonine-protein kinase HT1-like [Oryza brachyantha]
Length=378

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  206  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP++P  CPS+ A
Sbjct  266  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDVPRCCPSAFA  325

Query  5    S  3
            +
Sbjct  326  N  326



>ref|XP_003562048.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
Length=376

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  204  RGLSYLHSQKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  263

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP++P  CPS+ A
Sbjct  264  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDVPRCCPSAFA  323

Query  5    S  3
            +
Sbjct  324  N  324



>gb|KJB23020.1| hypothetical protein B456_004G077900 [Gossypium raimondii]
Length=243

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  72   RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  131

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSF +CLWEIYCCD+PY DLSFAEVSSAVV QNLRPEIP  CPSSLA
Sbjct  132  VLDGKPYNRKCDVYSFSICLWEIYCCDMPYADLSFAEVSSAVVCQNLRPEIPRCCPSSLA  191

Query  5    S  3
            S
Sbjct  192  S  192



>ref|XP_002283073.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
Length=391

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK+ENMLLD  R LKIADFGVARVEAQN ++MTGETGTLGYMAPE
Sbjct  219  RGLSYLHSKKIVHRDVKSENMLLDAQRTLKIADFGVARVEAQNLREMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFAEVSSAVVRQNLRPEIP  CPSSLA
Sbjct  279  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFAEVSSAVVRQNLRPEIPRCCPSSLA  338

Query  5    S  3
            +
Sbjct  339  N  339



>ref|XP_008224270.1| PREDICTED: serine/threonine-protein kinase HT1-like [Prunus mume]
Length=423

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL YLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  251  RGLCYLHSQKIVHRDVKTENMLLDTRRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  310

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWE+YCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPSS +
Sbjct  311  VLDGKPYNRRCDVYSFGICLWEVYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSSFS  370

Query  5    S  3
            +
Sbjct  371  N  371



>ref|NP_566716.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01250.1| kinase-like protein [Arabidopsis thaliana]
 gb|AAK59509.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34187.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76673.1| protein kinase family protein [Arabidopsis thaliana]
Length=378

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  206  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP++LA
Sbjct  266  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPTALA  325

Query  5    S  3
            +
Sbjct  326  T  326



>ref|XP_008782437.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Phoenix dactylifera]
Length=233

 Score =   229 bits (585),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  60   RGLSYLHSKKIVHRDVKTENMLLDRTRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  119

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  120  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  179

Query  5    S  3
            +
Sbjct  180  N  180



>ref|XP_010466567.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=379

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  207  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  266

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP+S A
Sbjct  267  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPTSFA  326

Query  5    S  3
            +
Sbjct  327  T  327



>ref|XP_006844952.1| hypothetical protein AMTR_s00058p00169420 [Amborella trichopoda]
 gb|ERN06627.1| hypothetical protein AMTR_s00058p00169420 [Amborella trichopoda]
Length=355

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  183  RGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  242

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  243  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  302

Query  5    S  3
            +
Sbjct  303  N  303



>ref|XP_002517090.1| protein kinase atmrk1, putative [Ricinus communis]
 gb|EEF45253.1| protein kinase atmrk1, putative [Ricinus communis]
Length=393

 Score =   234 bits (598),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  221  RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPSDMTGETGTLGYMAPE  280

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +VS+AVVRQNLRPEIP  CPSSLA
Sbjct  281  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDVSTAVVRQNLRPEIPRCCPSSLA  340

Query  5    S  3
            +
Sbjct  341  N  341



>gb|EAY91142.1| hypothetical protein OsI_12749 [Oryza sativa Indica Group]
Length=416

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  244  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  303

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP++P  CPS+ A
Sbjct  304  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDVPRCCPSAFA  363

Query  5    S  3
            +
Sbjct  364  N  364



>gb|EAZ27891.1| hypothetical protein OsJ_11846 [Oryza sativa Japonica Group]
Length=416

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  244  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  303

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP++P  CPS+ A
Sbjct  304  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDVPRCCPSAFA  363

Query  5    S  3
            +
Sbjct  364  N  364



>gb|KJB72260.1| hypothetical protein B456_011G167400 [Gossypium raimondii]
Length=391

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSK+IVHRDVK ENMLLD  RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSKRIVHRDVKTENMLLDAHRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR CDVYSFG+CLWEIYCCD+PYPDLSF +VSSAV RQNLRPEIP  CP+SLA
Sbjct  279  VLDGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFVDVSSAVARQNLRPEIPRCCPNSLA  338

Query  5    S  3
            S
Sbjct  339  S  339



>ref|XP_003537586.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Glycine max]
 ref|XP_006590407.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Glycine max]
Length=385

 Score =   234 bits (596),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHSKKIVHRDVK ENMLL TSRNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLNYLHSKKIVHRDVKTENMLLSTSRNLKIADFGVARVEAMNPSDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CPS+LA
Sbjct  273  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPSALA  332

Query  5    S  3
            +
Sbjct  333  N  333



>gb|ABK06452.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=389

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  206  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP++LA
Sbjct  266  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPTALA  325

Query  5    S  3
            +
Sbjct  326  T  326



>gb|KJB23019.1| hypothetical protein B456_004G077900 [Gossypium raimondii]
Length=297

 Score =   231 bits (589),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  126  RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  185

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSF +CLWEIYCCD+PY DLSFAEVSSAVV QNLRPEIP  CPSSLA
Sbjct  186  VLDGKPYNRKCDVYSFSICLWEIYCCDMPYADLSFAEVSSAVVCQNLRPEIPRCCPSSLA  245

Query  5    S  3
            S
Sbjct  246  S  246



>ref|XP_011026861.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Populus 
euphratica]
Length=390

 Score =   234 bits (596),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD+ RNLKIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDSHRNLKIADFGVARVEAQNPCDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYP+LSFA+V SAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPNLSFADVPSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_004511375.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Cicer arietinum]
 ref|XP_004511376.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Cicer arietinum]
Length=387

 Score =   234 bits (596),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD SRNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSKKIVHRDVKTENMLLDGSRNLKIADFGVARVEAMNPSDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPE+P  CPS++A
Sbjct  275  VLDGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEMPRCCPSAMA  334

Query  5    S  3
            +
Sbjct  335  N  335



>ref|XP_010242982.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
Length=363

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  191  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  250

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  251  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  310

Query  5    S  3
            +
Sbjct  311  N  311



>ref|XP_010251291.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
Length=360

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  188  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  247

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  248  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  307

Query  5    S  3
            +
Sbjct  308  N  308



>ref|XP_008812495.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Phoenix dactylifera]
Length=334

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  161  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  220

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  221  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  280

Query  5    S  3
            +
Sbjct  281  N  281



>ref|XP_010532573.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=398

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD SRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  226  RGLSYLHSKKIVHRDVKTENMLLDNSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  285

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PY DLSF  VSSAVVRQNLRP+IP  CP++LA
Sbjct  286  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYADLSFVHVSSAVVRQNLRPDIPRCCPTALA  345

Query  5    S  3
            +
Sbjct  346  N  346



>ref|XP_006644420.1| PREDICTED: serine/threonine-protein kinase HT1-like [Oryza brachyantha]
Length=233

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  60   RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPE  119

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  120  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  179

Query  5    S  3
            +
Sbjct  180  N  180



>ref|XP_011026124.1| PREDICTED: serine/threonine-protein kinase HT1 [Populus euphratica]
Length=400

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  227  RGLSYLHSKKIVHRDVKTENMLLDATRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  286

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA-EVSSAVVRQNLRPEIPXXCPSSL  9
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPD SFA EVSSAVVRQ+LRPEIP  CPSSL
Sbjct  287  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDPSFASEVSSAVVRQHLRPEIPRCCPSSL  346

Query  8    AS  3
            AS
Sbjct  347  AS  348



>ref|XP_004963118.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=366

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH++KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  194  RGLSYLHARKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  253

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP+IP  CPS++A
Sbjct  254  VLEGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAMA  313

Query  5    S  3
            +
Sbjct  314  N  314



>tpg|DAA47443.1| TPA: LOW QUALITY PROTEIN: putative protein kinase superfamily 
protein [Zea mays]
Length=273

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  101  RGLNYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  160

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP+IP  CPS +A
Sbjct  161  VLEGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSPMA  220

Query  5    S  3
            +
Sbjct  221  N  221



>gb|EMS51637.1| Serine/threonine-protein kinase HT1 [Triticum urartu]
Length=454

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  236  RGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  295

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP+IP  CPS+ A
Sbjct  296  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFA  355

Query  5    S  3
            +
Sbjct  356  N  356



>gb|KJB53126.1| hypothetical protein B456_008G294700 [Gossypium raimondii]
Length=238

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  66   RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  125

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  126  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  185

Query  5    S  3
            +
Sbjct  186  N  186



>gb|KJB38187.1| hypothetical protein B456_006G241500 [Gossypium raimondii]
Length=391

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSRKIVHRDVKTENMLLDGHRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP+SLA
Sbjct  279  VLEGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPNSLA  338

Query  5    S  3
            +
Sbjct  339  N  339



>gb|KJB53123.1| hypothetical protein B456_008G294700 [Gossypium raimondii]
 gb|KJB53124.1| hypothetical protein B456_008G294700 [Gossypium raimondii]
Length=232

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  60   RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  119

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  120  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  179

Query  5    S  3
            +
Sbjct  180  N  180



>ref|XP_007157110.1| hypothetical protein PHAVU_002G043600g [Phaseolus vulgaris]
 ref|XP_007157111.1| hypothetical protein PHAVU_002G043600g [Phaseolus vulgaris]
 gb|ESW29104.1| hypothetical protein PHAVU_002G043600g [Phaseolus vulgaris]
 gb|ESW29105.1| hypothetical protein PHAVU_002G043600g [Phaseolus vulgaris]
Length=387

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK+ENMLL+ SRNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSKKIVHRDVKSENMLLNPSRNLKIADFGVARVEAMNPSDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVR NLRP+IP  CPSSLA
Sbjct  275  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRHNLRPDIPRCCPSSLA  334

Query  5    S  3
            +
Sbjct  335  N  335



>ref|XP_008782436.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Phoenix dactylifera]
Length=358

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  185  RGLSYLHSKKIVHRDVKTENMLLDRTRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  244

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  245  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  304

Query  5    S  3
            +
Sbjct  305  N  305



>gb|KJB23017.1| hypothetical protein B456_004G077900 [Gossypium raimondii]
Length=381

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  210  RGLSYLHSKKIVHRDVKTENMLLDAHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  269

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSF +CLWEIYCCD+PY DLSFAEVSSAVV QNLRPEIP  CPSSLA
Sbjct  270  VLDGKPYNRKCDVYSFSICLWEIYCCDMPYADLSFAEVSSAVVCQNLRPEIPRCCPSSLA  329

Query  5    S  3
            S
Sbjct  330  S  330



>ref|XP_010925403.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=364

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  191  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  250

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  251  VLNGDPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  310

Query  5    S  3
            +
Sbjct  311  N  311



>ref|XP_011073446.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=402

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  229  RGLSYLHSKKIVHRDVKAENMLLDHHRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  288

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWE YCCDLPY D SFAEVS AVVRQNLRPEIP  CPSSLA
Sbjct  289  VLDGKPYNRKCDVYSFGICLWETYCCDLPYTDFSFAEVSYAVVRQNLRPEIPRCCPSSLA  348

Query  5    S  3
            +
Sbjct  349  N  349



>ref|XP_008451641.1| PREDICTED: serine/threonine-protein kinase HT1, partial [Cucumis 
melo]
Length=265

 Score =   228 bits (581),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRD+K EN+LLD  + LKI DFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  94   RGLSYLHSKKIVHRDIKTENVLLDAQKTLKIVDFGVARVEAQNPKDMTGETGTLGYMAPE  153

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYS G+CLWE YCCD+PYPDLSFAEVS+AVVRQNLRPEIP  CPSS A
Sbjct  154  VLDGKPYNRKCDVYSLGICLWETYCCDMPYPDLSFAEVSTAVVRQNLRPEIPRCCPSSFA  213

Query  5    S  3
            +
Sbjct  214  N  214



>ref|XP_011030650.1| PREDICTED: serine/threonine-protein kinase HT1 [Populus euphratica]
Length=391

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD+ + LKIADFGVAR+EAQNP DMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSKKIVHRDVKTENMLLDSHKTLKIADFGVARIEAQNPCDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CPSSLA
Sbjct  279  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPSSLA  338

Query  5    S  3
            +
Sbjct  339  N  339



>ref|XP_009788249.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
Length=232

 Score =   227 bits (578),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  60   RGLSYLHSQKIVHRDVKTENMLLDKSRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  119

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYS+G+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  120  VLNGNPYNRKCDVYSYGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  179

Query  5    S  3
            +
Sbjct  180  N  180



>ref|XP_004290624.1| PREDICTED: serine/threonine-protein kinase HT1 [Fragaria vesca 
subsp. vesca]
Length=400

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            +GLSYLH+KKIVHRDVK EN+LLD +R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  228  KGLSYLHAKKIVHRDVKTENVLLDKNRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  287

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA+VSSAVVRQNLRPEIP  CP++LA
Sbjct  288  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADVSSAVVRQNLRPEIPRCCPTALA  347

Query  5    S  3
            S
Sbjct  348  S  348



>gb|KCW84187.1| hypothetical protein EUGRSUZ_B01052 [Eucalyptus grandis]
Length=264

 Score =   228 bits (580),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHSKKIVHRDVK ENMLLD+ RNLKIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  91   RGLNYLHSKKIVHRDVKTENMLLDSRRNLKIADFGVARVEAQNPGDMTGETGTLGYMAPE  150

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR CDVYSFG+CLWEIYCCD+PYP+LSFA+VSSAVV QNLRPEIP  CP +LA
Sbjct  151  VLDGKPYNRSCDVYSFGICLWEIYCCDMPYPNLSFADVSSAVVLQNLRPEIPRCCPGALA  210

Query  5    S  3
            +
Sbjct  211  N  211



>gb|KHG05976.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
 gb|KHG27724.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=391

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSRKIVHRDVKTENMLLDGHRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CP+SLA
Sbjct  279  VLEGKPYNRICDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPNSLA  338

Query  5    S  3
            +
Sbjct  339  N  339



>ref|XP_003610747.1| Kinase-like protein [Medicago truncatula]
 gb|AES93705.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=390

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +RNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSEKIVHRDVKTENMLLDGNRNLKIADFGVARVEALNPSDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPS+LA
Sbjct  278  VLDGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSALA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_010678745.1| PREDICTED: serine/threonine-protein kinase HT1-like [Beta vulgaris 
subsp. vulgaris]
Length=366

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH++KIVHRDVK ENMLLD SR LKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  194  RGLSYLHAQKIVHRDVKTENMLLDKSRTLKIADFGVARVEASNPSDMTGETGTLGYMAPE  253

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  254  VLNGDPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  313

Query  5    S  3
            +
Sbjct  314  N  314



>emb|CBI26291.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK+ENMLLD  R LKIADFGVARVEAQN ++MTGETGTLGYMAPE
Sbjct  284  RGLSYLHSKKIVHRDVKSENMLLDAQRTLKIADFGVARVEAQNLREMTGETGTLGYMAPE  343

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFAEVSSAVVRQNLRPEIP  CPSSLA
Sbjct  344  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFAEVSSAVVRQNLRPEIPRCCPSSLA  403

Query  5    S  3
            +
Sbjct  404  N  404



>ref|XP_010496560.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=287

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  115  RGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  174

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  175  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  234

Query  5    S  3
            +
Sbjct  235  N  235



>emb|CDP02127.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   231 bits (589),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  211  RGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVARVEASNPNDMTGETGTLGYMAPE  270

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  271  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  330

Query  5    S  3
            +
Sbjct  331  N  331



>ref|NP_001142326.1| uncharacterized protein LOC100274496 [Zea mays]
 ref|NP_001232827.1| ATP binding protein [Zea mays]
 ref|XP_008668643.1| PREDICTED: uncharacterized protein LOC100274496 isoform X1 [Zea 
mays]
 gb|ACF88193.1| unknown [Zea mays]
 gb|ACG46627.1| ATP binding protein [Zea mays]
 gb|ACN25983.1| unknown [Zea mays]
 tpg|DAA50370.1| TPA: putative protein kinase superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA50371.1| TPA: putative protein kinase superfamily protein isoform 2 [Zea 
mays]
 tpg|DAA50372.1| TPA: putative protein kinase superfamily protein isoform 3 [Zea 
mays]
Length=378

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK+ENMLL   RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  206  RGLSYLHSRKIVHRDVKSENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP+IP  CPS+ A
Sbjct  266  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSAFA  325

Query  5    S  3
            +
Sbjct  326  N  326



>gb|EYU29919.1| hypothetical protein MIMGU_mgv1a022188mg, partial [Erythranthe 
guttata]
Length=359

 Score =   230 bits (587),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  198  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  257

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  258  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  317

Query  5    S  3
            +
Sbjct  318  N  318



>ref|XP_002278739.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
 emb|CBI34936.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   230 bits (586),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  188  RGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVARMEASNPNDMTGETGTLGYMAPE  247

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  248  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  307

Query  5    S  3
            +
Sbjct  308  N  308



>ref|XP_011079887.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum]
Length=390

 Score =   231 bits (589),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD++R LKIADFGVAR+EAQNP+DMTG TGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDSNRTLKIADFGVARIEAQNPRDMTGNTGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VS+AVV+QNLRPE+P  CP   A
Sbjct  278  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSAAVVQQNLRPEVPRCCPGGFA  337

Query  5    S  3
            S
Sbjct  338  S  338



>ref|XP_009145271.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 ref|XP_009145272.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 gb|AGA37229.1| mitogen-activated protein kinase kinase kinase Raf39.1 [Brassica 
napus]
 emb|CDY10667.1| BnaA05g16950D [Brassica napus]
 emb|CDY10304.1| BnaC05g29750D [Brassica napus]
Length=378

 Score =   231 bits (588),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  206  RGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCC +PYPDLSFA+VSSAVVRQNLRP+IP  CP+SL+
Sbjct  266  VLDGKPYNRRCDVYSFGICLWEIYCCAMPYPDLSFADVSSAVVRQNLRPDIPRCCPTSLS  325

Query  5    S  3
            +
Sbjct  326  N  326



>ref|NP_001131428.2| uncharacterized LOC100192758 [Zea mays]
 gb|ACG32092.1| ATP binding protein [Zea mays]
 gb|ACR36663.1| unknown [Zea mays]
 gb|ACF79829.2| unknown [Zea mays]
 tpg|DAA47442.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=370

 Score =   230 bits (587),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHS+KIVHRDVK ENMLLDT RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  198  RGLNYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  257

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP+IP  CPS +A
Sbjct  258  VLEGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSPMA  317

Query  5    S  3
            +
Sbjct  318  N  318



>gb|KJB40735.1| hypothetical protein B456_007G076700 [Gossypium raimondii]
Length=303

 Score =   228 bits (581),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  131  RGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  190

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  191  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  250

Query  5    S  3
            +
Sbjct  251  N  251



>ref|XP_011087151.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=381

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  209  RGLSYLHSQKIVHRDVKTENMLLDKSRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  268

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  269  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  328

Query  5    S  3
            +
Sbjct  329  N  329



>ref|XP_010532275.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010532276.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010532277.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X3 
[Tarenaya hassleriana]
Length=383

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  211  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  270

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+FAEV+SAVVRQNLRPEIP  CPSSLA
Sbjct  271  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFAEVTSAVVRQNLRPEIPRCCPSSLA  330

Query  5    S  3
            +
Sbjct  331  A  331



>ref|XP_007151088.1| hypothetical protein PHAVU_004G016900g [Phaseolus vulgaris]
 gb|ESW23082.1| hypothetical protein PHAVU_004G016900g [Phaseolus vulgaris]
Length=366

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  194  RGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVARIEASNPHDMTGETGTLGYMAPE  253

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  254  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  313

Query  5    S  3
            +
Sbjct  314  N  314



>ref|XP_004138114.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 ref|XP_004155013.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
Length=379

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  207  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  266

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  267  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  326

Query  5    S  3
            +
Sbjct  327  N  327



>ref|XP_008453100.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
melo]
Length=379

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  207  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  266

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  267  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  326

Query  5    S  3
            +
Sbjct  327  N  327



>ref|XP_002314673.2| hypothetical protein POPTR_0010s09360g [Populus trichocarpa]
 gb|EEF00844.2| hypothetical protein POPTR_0010s09360g [Populus trichocarpa]
Length=391

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD+ + LKIADFGVAR+EAQNP +MTGETGTLGYMAPE
Sbjct  219  RGLSYLHSKKIVHRDVKTENMLLDSHKTLKIADFGVARIEAQNPCEMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CPSSLA
Sbjct  279  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPSSLA  338

Query  5    S  3
            +
Sbjct  339  N  339



>gb|KEH27357.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=424

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +RNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  252  RGLSYLHSEKIVHRDVKTENMLLDGNRNLKIADFGVARVEALNPSDMTGETGTLGYMAPE  311

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRPEIP  CPS+LA
Sbjct  312  VLDGKPYNRTCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPEIPRCCPSALA  371

Query  5    S  3
            +
Sbjct  372  N  372



>ref|XP_004982354.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=378

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLL   RNLKIADFGVARVEAQNPKDMTG TGTLGYMAPE
Sbjct  206  RGLSYLHSRKIVHRDVKTENMLLTPQRNLKIADFGVARVEAQNPKDMTGATGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVV QNLRP+IP  CPS+ A
Sbjct  266  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVHQNLRPDIPRCCPSTFA  325

Query  5    S  3
            +
Sbjct  326  N  326



>gb|KHN23551.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=334

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  162  RGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVARIEASNPHDMTGETGTLGYMAPE  221

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  222  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  281

Query  5    S  3
            +
Sbjct  282  N  282



>gb|KJB42143.1| hypothetical protein B456_007G139200 [Gossypium raimondii]
Length=391

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD  R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSKKIVHRDVKTENMLLDARRILKIADFGVARVEAQNPQDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PY +LSFA+ +SAVVRQNLRPEIP  CPS+LA
Sbjct  280  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYANLSFADFTSAVVRQNLRPEIPRCCPSALA  339

Query  5    S  3
            S
Sbjct  340  S  340



>gb|KJB40732.1| hypothetical protein B456_007G076700 [Gossypium raimondii]
Length=377

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  205  RGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  264

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  265  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  324

Query  5    S  3
            +
Sbjct  325  N  325



>ref|XP_003527023.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
Length=386

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+K+VHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKVVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  274  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  333

Query  5    S  3
            +
Sbjct  334  N  334



>gb|EMT33153.1| Serine/threonine-protein kinase HT1 [Aegilops tauschii]
Length=305

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  132  RGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPE  191

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  192  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  251

Query  5    S  3
            +
Sbjct  252  N  252



>ref|XP_003525335.1| PREDICTED: dual specificity protein kinase zakA-like [Glycine 
max]
 gb|KHN48600.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=391

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPE+P  CPSSLA
Sbjct  279  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEVPRCCPSSLA  338

Query  5    S  3
            +
Sbjct  339  N  339



>ref|XP_010936750.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Elaeis guineensis]
Length=358

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS KIVHRDVK ENMLLD +R +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  185  RGLSYLHSNKIVHRDVKTENMLLDRTRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  244

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  245  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  304

Query  5    S  3
            +
Sbjct  305  N  305



>ref|XP_003523078.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
Length=386

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+K+VHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKVVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  274  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  333

Query  5    S  3
            +
Sbjct  334  N  334



>ref|NP_186798.1| Protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAF01534.1|AC009325_4 putative protein kinase [Arabidopsis thaliana]
 gb|AAL15278.1| AT3g01490/F4P13_4 [Arabidopsis thaliana]
 gb|AAM97058.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAN15525.1| putative protein kinase [Arabidopsis thaliana]
 dbj|BAE99178.1| protein kinase like protein [Arabidopsis thaliana]
 gb|AEE73674.1| Protein kinase superfamily protein [Arabidopsis thaliana]
Length=411

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  239  RGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  298

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  299  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  358

Query  5    S  3
            +
Sbjct  359  N  359



>ref|NP_001043682.1| Os01g0641000 [Oryza sativa Japonica Group]
 dbj|BAB92793.1| protein kinase 6-like [Oryza sativa Japonica Group]
 dbj|BAF05596.1| Os01g0641000 [Oryza sativa Japonica Group]
 gb|EAY75128.1| hypothetical protein OsI_03022 [Oryza sativa Indica Group]
Length=388

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVARIEASNPSDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  275  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  334

Query  5    S  3
            +
Sbjct  335  N  335



>gb|KHN18465.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=392

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPE+P  CPSSLA
Sbjct  280  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEVPRCCPSSLA  339

Query  5    S  3
            +
Sbjct  340  N  340



>ref|XP_003549630.1| PREDICTED: dual specificity protein kinase zakA-like [Glycine 
max]
Length=392

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPE+P  CPSSLA
Sbjct  280  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEVPRCCPSSLA  339

Query  5    S  3
            +
Sbjct  340  N  340



>gb|KJB75695.1| hypothetical protein B456_012G061300 [Gossypium raimondii]
Length=294

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  122  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPNDMTGETGTLGYMAPE  181

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  182  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  241

Query  5    S  3
            +
Sbjct  242  N  242



>gb|KJB11479.1| hypothetical protein B456_001G261300 [Gossypium raimondii]
Length=381

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  209  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPNDMTGETGTLGYMAPE  268

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  269  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  328

Query  5    S  3
            +
Sbjct  329  N  329



>gb|KHG06519.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=381

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  209  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPNDMTGETGTLGYMAPE  268

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  269  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  328

Query  5    S  3
            +
Sbjct  329  N  329



>gb|KJB53127.1| hypothetical protein B456_008G294700 [Gossypium raimondii]
Length=399

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  227  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  286

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  287  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  346

Query  5    S  3
            +
Sbjct  347  N  347



>gb|EEE55065.1| hypothetical protein OsJ_02781 [Oryza sativa Japonica Group]
Length=373

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  200  RGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVARIEASNPSDMTGETGTLGYMAPE  259

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  260  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  319

Query  5    S  3
            +
Sbjct  320  N  320



>ref|XP_010028228.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Eucalyptus grandis]
 gb|KCW83441.1| hypothetical protein EUGRSUZ_B00365 [Eucalyptus grandis]
Length=440

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            +GLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  268  KGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVARVEASNPNDMTGETGTLGYMAPE  327

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDG PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  328  VLDGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEMTSAVVRQNLRPEIPRCCPSSLA  387

Query  5    S  3
            +
Sbjct  388  N  388



>ref|XP_006299114.1| hypothetical protein CARUB_v10015255mg [Capsella rubella]
 gb|EOA32012.1| hypothetical protein CARUB_v10015255mg [Capsella rubella]
Length=410

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  238  RGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  297

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  298  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  357

Query  5    S  3
            +
Sbjct  358  N  358



>gb|KHG08462.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=383

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  211  RGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  270

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  271  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  330

Query  5    S  3
            +
Sbjct  331  N  331



>ref|XP_003542696.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
Length=366

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  194  RGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVARIEASNPHDMTGETGTLGYMAPE  253

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  254  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  313

Query  5    S  3
            +
Sbjct  314  N  314



>gb|KDO69703.1| hypothetical protein CISIN_1g018489mg [Citrus sinensis]
Length=355

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  183  RGLSYLHSQKIVHRDVKTENMLLDKNRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  242

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  243  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  302

Query  5    S  3
            +
Sbjct  303  N  303



>ref|XP_006603815.1| PREDICTED: serine/threonine-protein kinase HT1 [Glycine max]
Length=367

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  195  RGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVARIEASNPHDMTGETGTLGYMAPE  254

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  255  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  314

Query  5    S  3
            +
Sbjct  315  N  315



>ref|XP_010034835.1| PREDICTED: serine/threonine-protein kinase HT1-like [Eucalyptus 
grandis]
 ref|XP_010034843.1| PREDICTED: serine/threonine-protein kinase HT1-like [Eucalyptus 
grandis]
 gb|KCW84186.1| hypothetical protein EUGRSUZ_B01052 [Eucalyptus grandis]
Length=386

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHSKKIVHRDVK ENMLLD+ RNLKIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  213  RGLNYLHSKKIVHRDVKTENMLLDSRRNLKIADFGVARVEAQNPGDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR CDVYSFG+CLWEIYCCD+PYP+LSFA+VSSAVV QNLRPEIP  CP +LA
Sbjct  273  VLDGKPYNRSCDVYSFGICLWEIYCCDMPYPNLSFADVSSAVVLQNLRPEIPRCCPGALA  332

Query  5    S  3
            +
Sbjct  333  N  333



>ref|XP_011071834.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=387

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  275  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  334

Query  5    S  3
            +
Sbjct  335  N  335



>ref|XP_002300019.1| kinase family protein [Populus trichocarpa]
 gb|EEE84824.1| kinase family protein [Populus trichocarpa]
Length=382

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +K+ADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  210  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKLADFGVARIEASNPNDMTGETGTLGYMAPE  269

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  270  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  329

Query  5    S  3
            +
Sbjct  330  N  330



>ref|XP_011007522.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Populus euphratica]
Length=380

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +K+ADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  208  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKLADFGVARIEASNPNDMTGETGTLGYMAPE  267

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  268  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  327

Query  5    S  3
            +
Sbjct  328  N  328



>gb|KHN19315.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=400

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+K+VHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  228  RGLSYLHSQKVVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  287

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  288  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  347

Query  5    S  3
            +
Sbjct  348  N  348



>gb|KHN30896.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=429

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+K+VHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  257  RGLSYLHSQKVVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  316

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  317  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  376

Query  5    S  3
            +
Sbjct  377  N  377



>ref|XP_007155414.1| hypothetical protein PHAVU_003G199400g [Phaseolus vulgaris]
 gb|ESW27408.1| hypothetical protein PHAVU_003G199400g [Phaseolus vulgaris]
Length=386

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPE+P  CPSSLA
Sbjct  274  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEMPRCCPSSLA  333

Query  5    S  3
            +
Sbjct  334  N  334



>ref|XP_006439794.1| hypothetical protein CICLE_v10020546mg [Citrus clementina]
 ref|XP_006476760.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
 gb|ESR53034.1| hypothetical protein CICLE_v10020546mg [Citrus clementina]
Length=387

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSQKIVHRDVKTENMLLDKNRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  275  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  334

Query  5    S  3
            +
Sbjct  335  N  335



>emb|CDP03662.1| unnamed protein product [Coffea canephora]
Length=392

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKK VHRDVK+ENMLL+ +R LKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSKKFVHRDVKSENMLLNANRTLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWEIYCCD+PYP+LSFA++SSAVV QNLRPEIP  CP +LA
Sbjct  280  VLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLSFADLSSAVVNQNLRPEIPRCCPGALA  339

Query  5    S  3
            S
Sbjct  340  S  340



>gb|KDP45365.1| hypothetical protein JCGZ_09614 [Jatropha curcas]
Length=378

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  206  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARMEASNPNDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  266  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  325

Query  5    S  3
            +
Sbjct  326  N  326



>ref|XP_006654831.1| PREDICTED: serine/threonine-protein kinase HT1-like [Oryza brachyantha]
Length=383

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  210  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPSDMTGETGTLGYMAPE  269

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  270  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  329

Query  5    S  3
            +
Sbjct  330  N  330



>ref|XP_004961129.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=391

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  218  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPSDMTGETGTLGYMAPE  277

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  278  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  337

Query  5    S  3
            +
Sbjct  338  N  338



>ref|XP_008443512.1| PREDICTED: serine/threonine-protein kinase HT1 [Cucumis melo]
Length=384

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  212  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  271

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  272  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  331

Query  5    S  3
            +
Sbjct  332  N  332



>ref|XP_004158316.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
HT1-like [Cucumis sativus]
Length=395

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  273  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  332

Query  5    S  3
            +
Sbjct  333  N  333



>ref|NP_001132838.1| uncharacterized LOC100194330 [Zea mays]
 gb|ACF81853.1| unknown [Zea mays]
 tpg|DAA58377.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=233

 Score =   224 bits (571),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  60   RGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPE  119

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  120  VLNGHAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  179

Query  5    S  3
            +
Sbjct  180  N  180



>ref|XP_008787949.1| PREDICTED: serine/threonine-protein kinase HT1-like [Phoenix 
dactylifera]
Length=360

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK EN+LLD +R +KIADFGVARVEAQNP DMTGETGTLGYMAPE
Sbjct  187  RGLSYLHSKKIVHRDVKTENVLLDRTRTVKIADFGVARVEAQNPNDMTGETGTLGYMAPE  246

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSS A
Sbjct  247  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSFA  306

Query  5    S  3
            +
Sbjct  307  N  307



>ref|XP_002511419.1| protein kinase atmrk1, putative [Ricinus communis]
 gb|EEF52021.1| protein kinase atmrk1, putative [Ricinus communis]
Length=393

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  221  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  280

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  281  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  340

Query  5    S  3
            +
Sbjct  341  N  341



>ref|XP_004141085.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 gb|KGN59662.1| hypothetical protein Csa_3G836460 [Cucumis sativus]
Length=385

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  273  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  332

Query  5    S  3
            +
Sbjct  333  N  333



>gb|ABK06450.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=422

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  239  RGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  298

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  299  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  358

Query  5    S  3
            +
Sbjct  359  N  359



>ref|XP_007036183.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY20684.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=386

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPE+P  CPSSLA
Sbjct  274  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEMPRCCPSSLA  333

Query  5    S  3
            +
Sbjct  334  N  334



>ref|XP_010496308.1| PREDICTED: serine/threonine-protein kinase HT1 [Camelina sativa]
Length=410

 Score =   229 bits (584),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH++KIVHRDVK ENMLLD SR LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  238  RGLSYLHTQKIVHRDVKTENMLLDKSRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  297

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  298  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  357

Query  5    S  3
            +
Sbjct  358  N  358



>gb|AES91171.2| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=392

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWE YCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  280  VLNGNPYNRKCDVYSFGICLWETYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  339

Query  5    S  3
            +
Sbjct  340  N  340



>ref|XP_002441568.1| hypothetical protein SORBIDRAFT_09g029440 [Sorghum bicolor]
 gb|EES19998.1| hypothetical protein SORBIDRAFT_09g029440 [Sorghum bicolor]
Length=379

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  206  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPSDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  266  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  325

Query  5    S  3
            +
Sbjct  326  N  326



>ref|XP_008239746.1| PREDICTED: serine/threonine-protein kinase HT1-like [Prunus mume]
Length=385

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLSYLHSQKIVHRDVKTENMLLDKTRVVKIADFGVARVEASNPNDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  273  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  332

Query  5    S  3
            +
Sbjct  333  N  333



>emb|CBI15048.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   227 bits (579),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  177  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  236

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CP+SLA
Sbjct  237  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPNSLA  296

Query  5    S  3
            +
Sbjct  297  N  297



>ref|XP_009613289.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=389

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  217  RGLSYLHSQKIVHRDVKTENMLLDKSRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  276

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYS+G+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  277  VLNGNPYNRKCDVYSYGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  336

Query  5    S  3
            +
Sbjct  337  N  337



>ref|XP_010111765.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXC31627.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=377

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  205  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARIEASNPNDMTGETGTLGYMAPE  264

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+C+WEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  265  VLNGNPYNRKCDVYSFGICMWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  324

Query  5    S  3
            +
Sbjct  325  N  325



>emb|CDP12370.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   229 bits (584),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  241  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  300

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  301  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  360

Query  5    S  3
            +
Sbjct  361  N  361



>ref|XP_007210513.1| hypothetical protein PRUPE_ppa007019mg [Prunus persica]
 gb|EMJ11712.1| hypothetical protein PRUPE_ppa007019mg [Prunus persica]
Length=385

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLSYLHSQKIVHRDVKTENMLLDKTRVVKIADFGVARVEASNPNDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  273  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  332

Query  5    S  3
            +
Sbjct  333  N  333



>gb|EYU45671.1| hypothetical protein MIMGU_mgv1a007529mg [Erythranthe guttata]
Length=404

 Score =   229 bits (583),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVKAENMLLD +RNLKIADFGVARVEAQNP+DMTGETGTLGYMAPE
Sbjct  230  RGLSYLHSKKIVHRDVKAENMLLDNNRNLKIADFGVARVEAQNPRDMTGETGTLGYMAPE  289

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+CLWE YCC++PY DLSFA+VSSAVVR NLRP IP  CPSSL 
Sbjct  290  VLDGKPYNRKCDVYSFGICLWETYCCEVPYTDLSFADVSSAVVRNNLRPPIPRCCPSSLG  349

Query  5    S  3
            +
Sbjct  350  N  350



>ref|XP_009609245.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   227 bits (579),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHS+KIVHRDVK ENMLLD +R LKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  184  RGLNYLHSEKIVHRDVKTENMLLDRNRTLKIADFGVARVEASNPNDMTGETGTLGYMAPE  243

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV++AVVRQNLRPEIP  CPSSLA
Sbjct  244  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTTAVVRQNLRPEIPRCCPSSLA  303

Query  5    S  3
            +
Sbjct  304  N  304



>gb|KJB75694.1| hypothetical protein B456_012G061300 [Gossypium raimondii]
 gb|KJB75698.1| hypothetical protein B456_012G061300 [Gossypium raimondii]
Length=374

 Score =   228 bits (581),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  202  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPNDMTGETGTLGYMAPE  261

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  262  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  321

Query  5    S  3
            +
Sbjct  322  N  322



>ref|NP_001056408.1| Os05g0577700 [Oryza sativa Japonica Group]
 gb|AAT39152.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF18322.1| Os05g0577700 [Oryza sativa Japonica Group]
 gb|EAY99152.1| hypothetical protein OsI_21111 [Oryza sativa Indica Group]
 gb|EAZ41127.1| hypothetical protein OsJ_25620 [Oryza sativa Japonica Group]
Length=381

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  208  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPSDMTGETGTLGYMAPE  267

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPE+P  CPSSLA
Sbjct  268  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEMPRCCPSSLA  327

Query  5    S  3
            +
Sbjct  328  N  328



>emb|CDY37517.1| BnaA05g33820D [Brassica napus]
Length=386

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKIVHRDVKTENMLLDKTRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  274  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  333

Query  5    S  3
            +
Sbjct  334  N  334



>ref|XP_004508858.1| PREDICTED: dual specificity protein kinase zakA-like [Cicer arietinum]
Length=389

 Score =   228 bits (582),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  217  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  276

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWE YCCD+PYPDLSF+E++SAVVRQNLRPE+P  CPSSLA
Sbjct  277  VLNGNPYNRKCDVYSFGICLWETYCCDMPYPDLSFSEITSAVVRQNLRPEVPRCCPSSLA  336

Query  5    S  3
            +
Sbjct  337  N  337



>ref|XP_010533472.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=391

 Score =   228 bits (582),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWE YCCD+PYPDL+F+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  279  VLNGNPYNRKCDVYSFGICLWETYCCDMPYPDLTFSEVTSAVVRQNLRPEIPRCCPSSLA  338

Query  5    S  3
            +
Sbjct  339  A  339



>ref|XP_004252665.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
lycopersicum]
Length=362

 Score =   228 bits (580),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  192  RGLSYLHSEKIVHRDVKTENMLLDRNRTLKIADFGVARVEASNPNDMTGETGTLGYMAPE  251

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV++AVVRQNLRPEIP  CPSSL 
Sbjct  252  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTTAVVRQNLRPEIPRCCPSSLG  311

Query  5    S  3
            +
Sbjct  312  N  312



>ref|XP_008348029.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=232

 Score =   223 bits (569),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEA NP +MTGETGTLGYMAPE
Sbjct  60   RGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNEMTGETGTLGYMAPE  119

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  120  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  179

Query  5    S  3
            +
Sbjct  180  N  180



>ref|XP_004241510.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
Length=394

 Score =   228 bits (582),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH++KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  222  RGLSYLHTQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  281

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  282  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  341

Query  5    S  3
            +
Sbjct  342  N  342



>gb|AFK45479.1| unknown [Lotus japonicus]
Length=386

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK+ENMLLD +RNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKIVHRDVKSENMLLDGNRNLKIADFGVARVEAMNPSDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYP LSFA+VSSAVV QNLRPEIP  CPS+L+
Sbjct  274  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPYLSFADVSSAVVHQNLRPEIPRCCPSALS  333

Query  5    S  3
            S
Sbjct  334  S  334



>gb|KFK37616.1| hypothetical protein AALP_AA3G006100 [Arabis alpina]
Length=409

 Score =   229 bits (583),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  237  RGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  296

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CP+SLA
Sbjct  297  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPNSLA  356

Query  5    S  3
            +
Sbjct  357  N  357



>ref|XP_006341320.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
tuberosum]
Length=368

 Score =   228 bits (580),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  198  RGLSYLHSEKIVHRDVKTENMLLDRNRTLKIADFGVARVEASNPNDMTGETGTLGYMAPE  257

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV++AVVRQNLRPEIP  CPSSL 
Sbjct  258  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTTAVVRQNLRPEIPRCCPSSLG  317

Query  5    S  3
            +
Sbjct  318  N  318



>gb|AFK43156.1| unknown [Lotus japonicus]
Length=393

 Score =   228 bits (582),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDV+ ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  221  RGLSYLHSQKIVHRDVQTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  280

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  281  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  340

Query  5    S  3
            +
Sbjct  341  N  341



>emb|CDY49058.1| BnaC05g48860D [Brassica napus]
Length=386

 Score =   228 bits (581),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKIVHRDVKTENMLLDKTRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  274  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  333

Query  5    S  3
            +
Sbjct  334  N  334



>ref|XP_009801079.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Nicotiana sylvestris]
Length=359

 Score =   227 bits (579),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHS+KIVHRDVK ENMLLD +R LKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  187  RGLNYLHSEKIVHRDVKTENMLLDRNRTLKIADFGVARVEASNPNDMTGETGTLGYMAPE  246

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV++AVVRQNLRPEIP  CPSSLA
Sbjct  247  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTTAVVRQNLRPEIPRCCPSSLA  306

Query  5    S  3
            +
Sbjct  307  N  307



>ref|XP_002882179.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=411

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  239  RGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  298

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSL 
Sbjct  299  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLV  358

Query  5    S  3
            +
Sbjct  359  N  359



>ref|XP_010524307.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=392

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  220  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPNDMTGETGTLGYMAPE  279

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  280  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  339

Query  5    S  3
            +
Sbjct  340  N  340



>ref|XP_004146993.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 ref|XP_004166163.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 gb|KGN44782.1| hypothetical protein Csa_7G387170 [Cucumis sativus]
Length=398

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRD+K EN+LLD  + LKI DFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  227  RGLSYLHSKKIVHRDIKTENVLLDAQKTLKIVDFGVARVEAQNPKDMTGETGTLGYMAPE  286

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYS G+CLWE YCCD+PYPDLSFAEVS+AVVRQNLRP+IP  CPSS A
Sbjct  287  VLDGKPYNRKCDVYSLGICLWETYCCDMPYPDLSFAEVSTAVVRQNLRPDIPRCCPSSFA  346

Query  5    S  3
            +
Sbjct  347  N  347



>ref|XP_002283021.1| PREDICTED: serine/threonine-protein kinase HT1-like [Vitis vinifera]
Length=381

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  209  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  268

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CP+SLA
Sbjct  269  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPNSLA  328

Query  5    S  3
            +
Sbjct  329  N  329



>ref|XP_007031440.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007031441.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007031442.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY02366.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY02367.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY02368.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=378

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSY+HSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  206  RGLSYIHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPHDMTGETGTLGYMAPE  265

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  266  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  325

Query  5    S  3
            +
Sbjct  326  N  326



>emb|CAN64754.1| hypothetical protein VITISV_010542 [Vitis vinifera]
Length=381

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  209  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  268

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CP+SLA
Sbjct  269  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPNSLA  328

Query  5    S  3
            +
Sbjct  329  N  329



>ref|XP_008374458.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=396

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  224  RGLSYLHSQKIVHRDVKTENMLLDKTRAVKIADFGVARVEASNPNDMTGETGTLGYMAPE  283

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  284  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  343

Query  5    S  3
            +
Sbjct  344  N  344



>ref|XP_010449990.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=364

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVARVEA NPKDMTGETGTLGYMAPE
Sbjct  192  RGLSYLHSEKIVHRDVKTENMLLDAQKNLKIADFGVARVEALNPKDMTGETGTLGYMAPE  251

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            V+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +VSSAVV  NLRPEIP  CP++LA
Sbjct  252  VIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDVSSAVVLHNLRPEIPRCCPTALA  311

Query  5    S  3
            S
Sbjct  312  S  312



>ref|NP_001151897.1| ATP binding protein [Zea mays]
 gb|ACG44839.1| ATP binding protein [Zea mays]
 gb|ACL53857.1| unknown [Zea mays]
 gb|ACN32142.1| unknown [Zea mays]
 gb|AFW81228.1| putative protein kinase superfamily protein [Zea mays]
Length=377

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  204  RGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARLEASNPSDMTGETGTLGYMAPE  263

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSL+
Sbjct  264  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLS  323

Query  5    S  3
            +
Sbjct  324  N  324



>ref|XP_009147438.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
Length=408

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  236  RGLSYLHSQKIVHRDVKTENMLLDKTRTLKIADFGVARLEASNPNDMTGETGTLGYMAPE  295

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  296  VLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  355

Query  5    S  3
            +
Sbjct  356  N  356



>gb|KDP31115.1| hypothetical protein JCGZ_11491 [Jatropha curcas]
Length=382

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLL+ +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  210  RGLSYLHSQKIVHRDVKTENMLLNKNRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  269

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  270  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  329

Query  5    S  3
            +
Sbjct  330  N  330



>ref|XP_002318645.1| kinase family protein [Populus trichocarpa]
 gb|EEE96865.1| kinase family protein [Populus trichocarpa]
Length=381

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHS+KIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  209  RGLNYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARIEASNPNDMTGETGTLGYMAPE  268

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSFAEV+SAVVRQNLRPEIP  CP+SLA
Sbjct  269  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFAEVTSAVVRQNLRPEIPRCCPNSLA  328

Query  5    S  3
            +
Sbjct  329  N  329



>ref|XP_004298934.1| PREDICTED: serine/threonine-protein kinase HT1-like [Fragaria 
vesca subsp. vesca]
Length=404

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  232  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  291

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  292  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPDIPRCCPSALA  351

Query  5    S  3
            +
Sbjct  352  N  352



>ref|XP_009398135.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +  +KIADFGVAR+EAQNP DMTGETGTLGYMAPE
Sbjct  185  RGLSYLHSQKIVHRDVKTENMLLDRTGTVKIADFGVARIEAQNPNDMTGETGTLGYMAPE  244

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQNLRPEIP  CPSSLA
Sbjct  245  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNLRPEIPRCCPSSLA  304

Query  5    S  3
            +
Sbjct  305  N  305



>ref|XP_010094284.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB55558.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=391

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRP+IP  CPSSLA
Sbjct  279  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPDIPRCCPSSLA  338

Query  5    S  3
            +
Sbjct  339  N  339



>emb|CAN60343.1| hypothetical protein VITISV_017020 [Vitis vinifera]
Length=320

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -3

Query  359  LSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVL  180
            LSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPEVL
Sbjct  150  LSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVARMEASNPNDMTGETGTLGYMAPEVL  209

Query  179  DGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLAS  3
            +G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA+
Sbjct  210  NGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLAN  268



>ref|XP_004969282.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=382

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  209  RGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPGDMTGETGTLGYMAPE  268

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  269  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  328

Query  5    S  3
            +
Sbjct  329  N  329



>gb|KHN35167.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=711

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHSKKIVHRDVK ENMLL TSRNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLNYLHSKKIVHRDVKTENMLLSTSRNLKIADFGVARVEAMNPSDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+VSSAVVRQNLRP+IP  CPS+LA
Sbjct  273  VLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDIPRCCPSALA  332

Query  5    S  3
            +
Sbjct  333  N  333



>gb|KHN47176.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=428

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH+KKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  256  RGLSYLHTKKIVHRDVKTENMLLDKTRTLKIADFGVARIEASNPHDMTGETGTLGYMAPE  315

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  316  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  375

Query  5    S  3
            +
Sbjct  376  N  376



>ref|XP_007216049.1| hypothetical protein PRUPE_ppa017603mg [Prunus persica]
 gb|EMJ17248.1| hypothetical protein PRUPE_ppa017603mg [Prunus persica]
Length=374

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  202  RGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  261

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPE+P  CPSSLA
Sbjct  262  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEMPRCCPSSLA  321

Query  5    S  3
            +
Sbjct  322  N  322



>emb|CDM83508.1| unnamed protein product [Triticum aestivum]
Length=385

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  212  RGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPE  271

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  272  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  331

Query  5    S  3
            +
Sbjct  332  N  332



>ref|XP_010435069.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=364

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVARVEA NPKDMTGETGTLGYMAPE
Sbjct  192  RGLSYLHSEKIVHRDVKTENMLLDGQKNLKIADFGVARVEALNPKDMTGETGTLGYMAPE  251

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            V+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +VSSAVV  NLRPEIP  CP++LA
Sbjct  252  VIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDVSSAVVLHNLRPEIPRCCPTALA  311

Query  5    S  3
            S
Sbjct  312  S  312



>ref|XP_008230622.1| PREDICTED: serine/threonine-protein kinase HT1 [Prunus mume]
Length=372

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  200  RGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  259

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPE+P  CPSSLA
Sbjct  260  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEMPRCCPSSLA  319

Query  5    S  3
            +
Sbjct  320  N  320



>ref|XP_006414642.1| hypothetical protein EUTSA_v10025537mg [Eutrema salsugineum]
 gb|ESQ56095.1| hypothetical protein EUTSA_v10025537mg [Eutrema salsugineum]
Length=362

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  RNLKIADFGVARVEA NPKDMTGETGTLGYMAPE
Sbjct  190  RGLSYLHSEKIVHRDVKTENMLLDAQRNLKIADFGVARVEALNPKDMTGETGTLGYMAPE  249

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            V+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +VSSAVV  NLRPEIP  CP++LA
Sbjct  250  VIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDVSSAVVLHNLRPEIPRCCPNALA  309

Query  5    S  3
            +
Sbjct  310  N  310



>gb|KEH24853.1| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=375

 Score =   226 bits (577),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH KKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  203  RGLSYLHMKKIVHRDVKTENMLLDKTRTLKIADFGVARIEASNPHDMTGETGTLGYMAPE  262

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  263  VLNGSAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  322

Query  5    S  3
            +
Sbjct  323  N  323



>ref|XP_003569430.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
Length=387

 Score =   226 bits (577),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  274  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  333

Query  5    S  3
            +
Sbjct  334  N  334



>ref|NP_193214.1| protein kinase family protein [Arabidopsis thaliana]
 emb|CAB10257.1| kinase like protein [Arabidopsis thaliana]
 emb|CAB78520.1| kinase like protein [Arabidopsis thaliana]
 dbj|BAC42800.1| kinase like protein [Arabidopsis thaliana]
 gb|AAP04028.1| putative kinase [Arabidopsis thaliana]
 gb|AEE83497.1| protein kinase family protein [Arabidopsis thaliana]
Length=364

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVARVEA NPKDMTGETGTLGYMAPE
Sbjct  192  RGLSYLHSEKIVHRDVKTENMLLDAQKNLKIADFGVARVEALNPKDMTGETGTLGYMAPE  251

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            V+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +VSSAVV  NLRPEIP  CP++LA
Sbjct  252  VIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDVSSAVVLHNLRPEIPRCCPTALA  311

Query  5    S  3
             
Sbjct  312  G  312



>gb|AES71542.2| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=363

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHS+KIVHRDVK ENMLLD SR +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  191  RGLNYLHSQKIVHRDVKTENMLLDKSRTVKIADFGVARIEASNPNDMTGETGTLGYMAPE  250

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E++SAVVRQN+RPEIP  CPSS+A
Sbjct  251  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEITSAVVRQNVRPEIPRCCPSSVA  310

Query  5    S  3
            +
Sbjct  311  N  311



>ref|XP_006280611.1| hypothetical protein CARUB_v10026576mg [Capsella rubella]
 gb|EOA13509.1| hypothetical protein CARUB_v10026576mg [Capsella rubella]
Length=386

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  274  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  333

Query  5    S  3
            +
Sbjct  334  A  334



>ref|XP_004489293.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=372

 Score =   226 bits (575),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH KKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  200  RGLSYLHMKKIVHRDVKTENMLLDKTRTLKIADFGVARIEASNPHDMTGETGTLGYMAPE  259

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G  YNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  260  VLNGSAYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  319

Query  5    S  3
            +
Sbjct  320  N  320



>ref|XP_004304609.1| PREDICTED: serine/threonine-protein kinase HT1 [Fragaria vesca 
subsp. vesca]
Length=384

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL YLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  212  RGLGYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  271

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  272  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  331

Query  5    S  3
            +
Sbjct  332  N  332



>ref|NP_199811.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB10286.1| protein kinase [Arabidopsis thaliana]
 gb|AED95882.1| protein kinase [Arabidopsis thaliana]
Length=385

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  273  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  332

Query  5    S  3
            +
Sbjct  333  A  333



>ref|XP_002865771.1| hypothetical protein ARALYDRAFT_918001 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42030.1| hypothetical protein ARALYDRAFT_918001 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  273  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  332

Query  5    S  3
            +
Sbjct  333  A  333



>ref|XP_010441391.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=387

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  275  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  334

Query  5    S  3
            +
Sbjct  335  A  335



>ref|XP_010440392.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=364

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVARVEA NPKDMTGETG+LGYMAPE
Sbjct  192  RGLSYLHSEKIVHRDVKTENMLLDGQKNLKIADFGVARVEALNPKDMTGETGSLGYMAPE  251

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            V+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +VSSAVV  NLRPEIP  CP++LA
Sbjct  252  VIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDVSSAVVLHNLRPEIPRCCPTALA  311

Query  5    S  3
            S
Sbjct  312  S  312



>gb|EMS54076.1| Serine/threonine-protein kinase HT1 [Triticum urartu]
Length=426

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  253  RGLSYLHSEKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPSDMTGETGTLGYMAPE  312

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  313  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  372

Query  5    S  3
            +
Sbjct  373  N  373



>ref|XP_010442480.1| PREDICTED: serine/threonine-protein kinase HT1 [Camelina sativa]
Length=387

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  275  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  334

Query  5    S  3
            +
Sbjct  335  A  335



>ref|XP_010029202.1| PREDICTED: serine/threonine-protein kinase HT1 [Eucalyptus grandis]
 gb|KCW56061.1| hypothetical protein EUGRSUZ_I01815 [Eucalyptus grandis]
Length=384

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLD +R LKIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  212  RGLSYLHSKKIVHRDVKTENMLLDKTRTLKIADFGVARIEASNPHDMTGETGTLGYMAPE  271

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G  Y+RKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  272  VLNGSAYDRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  331

Query  5    S  3
            +
Sbjct  332  N  332



>ref|XP_009134038.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 gb|AHL77717.1| mitogen activated kinase kinase kinase Raf33 [Brassica napus]
 emb|CDY68821.1| BnaA03g56980D [Brassica napus]
Length=384

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  212  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  271

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  272  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  331

Query  5    S  3
            +
Sbjct  332  A  332



>gb|KFK26634.1| hypothetical protein AALP_AA8G274000 [Arabis alpina]
Length=377

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  205  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  264

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  265  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  324

Query  5    S  3
            +
Sbjct  325  A  325



>ref|XP_010695285.1| PREDICTED: serine/threonine-protein kinase HT1-like [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score =   225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLH+ KIVHRDVK ENMLLD  RNLKIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  198  RGLSYLHTMKIVHRDVKTENMLLDKQRNLKIADFGVARVEASNPHDMTGETGTLGYMAPE  257

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G  YNRKCDVYSFG+CLWEIYCC++PYPDLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  258  VLNGHAYNRKCDVYSFGICLWEIYCCEMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  317



>ref|XP_010482303.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=387

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  215  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  274

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  275  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  334

Query  5    S  3
            +
Sbjct  335  A  335



>ref|XP_004236113.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
lycopersicum]
 ref|XP_006345046.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
tuberosum]
 ref|XP_010318916.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
lycopersicum]
Length=391

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  219  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  278

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+C+WEIYCCD+PYPDLSF+EV+SAVVRQNLRP+IP  CPSSLA
Sbjct  279  VLNGNPYNRKCDVYSFGICVWEIYCCDMPYPDLSFSEVTSAVVRQNLRPDIPRCCPSSLA  338

Query  5    S  3
            +
Sbjct  339  N  339



>ref|XP_006402198.1| hypothetical protein EUTSA_v10013816mg [Eutrema salsugineum]
 gb|ESQ43651.1| hypothetical protein EUTSA_v10013816mg [Eutrema salsugineum]
Length=382

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  210  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  269

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  270  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  329

Query  5    S  3
            +
Sbjct  330  A  330



>emb|CDY21438.1| BnaC03g27590D [Brassica napus]
Length=386

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  214  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  274  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  333

Query  5    S  3
            +
Sbjct  334  A  334



>gb|ABK06453.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=375

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVARVEA NPKDMTGETGTLGYMAPE
Sbjct  192  RGLSYLHSEKIVHRDVKTENMLLDAQKNLKIADFGVARVEALNPKDMTGETGTLGYMAPE  251

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            V+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +VSSAVV  NLRPEIP  CP++LA
Sbjct  252  VIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDVSSAVVLHNLRPEIPRCCPTALA  311



>gb|ABK06451.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=396

 Score =   226 bits (576),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVARVEA NP DMTGETGTLGYMAPE
Sbjct  213  RGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPE  272

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV+SAVVRQNLRP+IP  CPS+LA
Sbjct  273  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEVTSAVVRQNLRPDIPRCCPSALA  332

Query  5    S  3
            +
Sbjct  333  A  333



>ref|XP_010524023.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010524024.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010524025.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010524026.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010524033.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010524034.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010524035.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010524036.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Tarenaya hassleriana]
Length=384

 Score =   225 bits (574),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHSKKIVHRDVK ENMLLDT+R LKIADFGVARVEAQNPKDMTGETGTLGYMAPE
Sbjct  212  RGLSYLHSKKIVHRDVKTENMLLDTNRTLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  271

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VLDGKPYNRKCDVYSFG+C+WEIYCCD+P+ D SFAE+S AVV QN+RPEIP  CP+++ 
Sbjct  272  VLDGKPYNRKCDVYSFGICMWEIYCCDMPFADWSFAELSHAVVHQNVRPEIPRCCPNAVG  331

Query  5    S  3
            S
Sbjct  332  S  332



>ref|XP_002322160.1| kinase family protein [Populus trichocarpa]
 gb|EEF06287.1| kinase family protein [Populus trichocarpa]
Length=380

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL+YLHS+KIVHRDVK ENMLLD +R +KIADFGVAR+EA NP DMTGETGTLGYMAPE
Sbjct  208  RGLNYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVARIEASNPNDMTGETGTLGYMAPE  267

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PY DLSF+EV+SAVVRQNLRPEIP  CPSSLA
Sbjct  268  VLNGNPYNRKCDVYSFGICLWEIYCCDMPYSDLSFSEVTSAVVRQNLRPEIPRCCPSSLA  327

Query  5    S  3
            +
Sbjct  328  N  328



>ref|XP_009408505.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGLSYLHS+KIVHRDVK ENMLLD + NLKIADFGVARVEAQNP+DMTG TGTLGYMAPE
Sbjct  214  RGLSYLHSQKIVHRDVKTENMLLDANSNLKIADFGVARVEAQNPRDMTGATGTLGYMAPE  273

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+GKPYNRKCDVYSFG+CLWEIYCCD+PY +LSFAEVSS+VV++NLRPEIP  CPS++A
Sbjct  274  VLNGKPYNRKCDVYSFGICLWEIYCCDMPYANLSFAEVSSSVVQKNLRPEIPRCCPSAMA  333

Query  5    S  3
            S
Sbjct  334  S  334



>ref|XP_008379254.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=375

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  365  RGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPE  186
            RGL YLHSKKIVHRDVK ENMLLD +R +KIADFGVARVEA NP +MTGETGTLGYMAPE
Sbjct  203  RGLCYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVARVEASNPNEMTGETGTLGYMAPE  262

Query  185  VLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPXXCPSSLA  6
            VL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV+SAVVRQNLRPEIP  CPS+LA
Sbjct  263  VLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSALA  322

Query  5    S  3
            +
Sbjct  323  N  323



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559392177135