BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048A15

Length=798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF69014.1|AF260827_1  cysteine protease                             363   2e-119   Ipomoea batatas [batate]
ref|XP_009780274.1|  PREDICTED: vacuolar-processing enzyme-like         299   1e-94    Nicotiana sylvestris
ref|XP_009616632.1|  PREDICTED: vacuolar-processing enzyme-like         297   5e-94    Nicotiana tomentosiformis
gb|ACB30368.1|  vascular processing enzyme-3                            297   5e-94    Capsicum annuum
ref|XP_009616670.1|  PREDICTED: vacuolar-processing enzyme-like         295   3e-93    Nicotiana tomentosiformis
ref|XP_004253098.1|  PREDICTED: vacuolar-processing enzyme              290   2e-91    
emb|CAH56498.1|  cysteine protease                                      290   3e-91    Solanum lycopersicum
ref|XP_009762556.1|  PREDICTED: vacuolar-processing enzyme-like         290   5e-91    Nicotiana sylvestris
ref|XP_006342509.1|  PREDICTED: vacuolar-processing enzyme-like         289   5e-91    Solanum tuberosum [potatoes]
emb|CDP08231.1|  unnamed protein product                                287   3e-90    Coffea canephora [robusta coffee]
ref|XP_011096125.1|  PREDICTED: vacuolar-processing enzyme              287   5e-90    Sesamum indicum [beniseed]
ref|XP_006355320.1|  PREDICTED: vacuolar-processing enzyme              285   1e-89    Solanum tuberosum [potatoes]
gb|ACC68680.1|  vacoular processing enzyme 1                            285   1e-89    Solanum tuberosum [potatoes]
ref|XP_004245113.1|  PREDICTED: vacuolar-processing enzyme-like         283   2e-88    
gb|KDO80008.1|  hypothetical protein CISIN_1g011066mg                   277   2e-88    Citrus sinensis [apfelsine]
gb|KJB65608.1|  hypothetical protein B456_010G103000                    276   3e-88    Gossypium raimondii
gb|KDP34125.1|  hypothetical protein JCGZ_07696                         281   1e-87    Jatropha curcas
ref|XP_004498922.1|  PREDICTED: vacuolar-processing enzyme-like         281   1e-87    Cicer arietinum [garbanzo]
ref|XP_006450793.1|  hypothetical protein CICLE_v10008097mg             276   2e-87    
gb|KJB65604.1|  hypothetical protein B456_010G103000                    277   2e-87    Gossypium raimondii
ref|XP_006450794.1|  hypothetical protein CICLE_v10008097mg             277   3e-87    
ref|XP_007012236.1|  Gamma vacuolar processing enzyme                   280   3e-87    
gb|KJB65606.1|  hypothetical protein B456_010G103000                    276   5e-87    Gossypium raimondii
ref|XP_011019533.1|  PREDICTED: vacuolar-processing enzyme isofor...    276   5e-87    Populus euphratica
ref|XP_009783032.1|  PREDICTED: vacuolar-processing enzyme-like         274   5e-87    Nicotiana sylvestris
gb|KDO80007.1|  hypothetical protein CISIN_1g011066mg                   276   6e-87    Citrus sinensis [apfelsine]
ref|XP_006382031.1|  hypothetical protein POPTR_0006s24900g             272   1e-86    
ref|XP_002324151.1|  asparaginyl endopeptidase family protein           278   1e-86    Populus trichocarpa [western balsam poplar]
ref|XP_002516472.1|  Vacuolar-processing enzyme precursor, putative     277   4e-86    Ricinus communis
ref|NP_001275777.1|  vacuolar-processing enzyme precursor               276   6e-86    Citrus sinensis [apfelsine]
ref|XP_006450795.1|  hypothetical protein CICLE_v10008097mg             276   7e-86    Citrus clementina [clementine]
gb|KJB65602.1|  hypothetical protein B456_010G103000                    276   8e-86    Gossypium raimondii
emb|CAH59407.1|  endopeptidase 1                                        265   8e-86    Plantago major [cart-track plant]
gb|KEH39941.1|  vacuolar processing enzyme                              276   1e-85    Medicago truncatula
ref|XP_011019532.1|  PREDICTED: vacuolar-processing enzyme isofor...    275   2e-85    Populus euphratica
gb|KJB06489.1|  hypothetical protein B456_001G023700                    275   2e-85    Gossypium raimondii
emb|CBI20614.3|  unnamed protein product                                275   3e-85    Vitis vinifera
gb|KJB06487.1|  hypothetical protein B456_001G023700                    275   3e-85    Gossypium raimondii
emb|CAN70603.1|  hypothetical protein VITISV_040193                     275   3e-85    Vitis vinifera
ref|XP_002276759.2|  PREDICTED: vacuolar-processing enzyme              275   6e-85    Vitis vinifera
ref|XP_010526156.1|  PREDICTED: vacuolar-processing enzyme gamma-...    273   9e-85    Tarenaya hassleriana [spider flower]
ref|XP_010049168.1|  PREDICTED: vacuolar-processing enzyme-like         273   9e-85    Eucalyptus grandis [rose gum]
gb|ACJ84443.1|  unknown                                                 273   1e-84    Medicago truncatula
gb|KFK32531.1|  hypothetical protein AALP_AA6G255400                    273   1e-84    Arabis alpina [alpine rockcress]
ref|XP_009337146.1|  PREDICTED: vacuolar-processing enzyme-like         273   2e-84    Pyrus x bretschneideri [bai li]
ref|XP_009361606.1|  PREDICTED: vacuolar-processing enzyme-like         272   3e-84    Pyrus x bretschneideri [bai li]
gb|AGC94758.1|  vacuolar processing enzyme                              272   3e-84    Malus hupehensis
gb|AGC94759.1|  vacuolar processing enzyme                              272   3e-84    Malus micromalus [Kaido crab apple]
ref|XP_008393660.1|  PREDICTED: vacuolar-processing enzyme              272   3e-84    
ref|XP_006412409.1|  hypothetical protein EUTSA_v10025034mg             271   5e-84    Eutrema salsugineum [saltwater cress]
ref|XP_010097094.1|  Vacuolar-processing enzyme                         271   5e-84    Morus notabilis
gb|KHN37015.1|  Vacuolar-processing enzyme                              271   7e-84    Glycine soja [wild soybean]
gb|ACQ91103.1|  vacuolar processing enzyme a                            271   7e-84    Populus tomentosa [Chinese white poplar]
ref|XP_010526069.1|  PREDICTED: vacuolar-processing enzyme gamma-...    271   8e-84    Tarenaya hassleriana [spider flower]
ref|NP_001236564.1|  vacuolar processing enzyme 2 precursor             270   9e-84    Glycine max [soybeans]
ref|XP_002308580.1|  asparaginyl endopeptidase family protein           271   9e-84    Populus trichocarpa [western balsam poplar]
ref|XP_003550283.1|  PREDICTED: vacuolar-processing enzyme-like         270   1e-83    Glycine max [soybeans]
gb|AGC94756.1|  vacuolar processing enzyme                              270   1e-83    Malus sieversii
gb|KHG30636.1|  Vacuolar-processing enzyme                              270   2e-83    Gossypium arboreum [tree cotton]
gb|EYU20379.1|  hypothetical protein MIMGU_mgv1a005412mg                270   2e-83    Erythranthe guttata [common monkey flower]
ref|XP_010669172.1|  PREDICTED: vacuolar-processing enzyme-like         270   2e-83    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010447316.1|  PREDICTED: vacuolar-processing enzyme gamma-...    270   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010417372.1|  PREDICTED: vacuolar-processing enzyme alpha-...    269   4e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010429611.1|  PREDICTED: vacuolar-processing enzyme alpha-...    269   4e-83    
ref|XP_010429610.1|  PREDICTED: vacuolar-processing enzyme alpha-...    269   5e-83    Camelina sativa [gold-of-pleasure]
gb|ACR24644.1|  vacuolar processing enzyme                              269   6e-83    Malus hupehensis var. mengshanensis
gb|AGC94757.1|  vacuolar processing enzyme                              269   6e-83    Malus sikkimensis
gb|KHG13131.1|  Vacuolar-processing enzyme                              268   6e-83    Gossypium arboreum [tree cotton]
ref|XP_004501477.1|  PREDICTED: vacuolar-processing enzyme-like         268   8e-83    Cicer arietinum [garbanzo]
ref|XP_007222246.1|  hypothetical protein PRUPE_ppa004713mg             267   3e-82    Prunus persica
ref|XP_009607675.1|  PREDICTED: vacuolar-processing enzyme-like         266   3e-82    Nicotiana tomentosiformis
ref|XP_002867219.1|  GAMMA-VPE                                          266   4e-82    
ref|NP_195020.1|  vacuolar-processing enzyme gamma                      266   5e-82    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA18924.1|  gamma-VPE                                              266   7e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296251.1|  hypothetical protein CARUB_v10025418mg             265   8e-82    Capsella rubella
ref|XP_010432633.1|  PREDICTED: vacuolar-processing enzyme gamma-...    266   1e-81    Camelina sativa [gold-of-pleasure]
dbj|BAC54829.1|  vacuolar processing enzyme-2                           265   1e-81    Nicotiana tabacum [American tobacco]
ref|XP_003603121.1|  Vacuolar processing enzyme                         265   2e-81    Medicago truncatula
ref|XP_010472621.1|  PREDICTED: vacuolar-processing enzyme alpha-...    264   3e-81    Camelina sativa [gold-of-pleasure]
ref|XP_004291017.1|  PREDICTED: vacuolar-processing enzyme              264   4e-81    Fragaria vesca subsp. vesca
ref|XP_006408834.1|  hypothetical protein EUTSA_v10001970mg             264   4e-81    Eutrema salsugineum [saltwater cress]
sp|P49044.1|VPE_VICSA  RecName: Full=Vacuolar-processing enzyme; ...    263   6e-81    Vicia sativa [spring vetch]
ref|XP_002880728.1|  alpha-vacuolar processing enzyme                   263   7e-81    
ref|XP_003525979.1|  PREDICTED: vacuolar-processing enzyme-like         263   8e-81    Glycine max [soybeans]
emb|CDX68923.1|  BnaC01g05300D                                          263   9e-81    
ref|XP_010437829.1|  PREDICTED: vacuolar-processing enzyme gamma-...    263   1e-80    Camelina sativa [gold-of-pleasure]
gb|KFK29905.1|  hypothetical protein AALP_AA7G193600                    263   1e-80    Arabis alpina [alpine rockcress]
gb|AAK15049.1|AF238384_1  asparaginyl endopeptidase                     261   2e-80    Vigna radiata [mung bean]
gb|AEO79971.1|  vacuolar processing enzyme                              261   3e-80    Arachis diogoi
ref|XP_010244352.1|  PREDICTED: vacuolar-processing enzyme-like         261   3e-80    Nelumbo nucifera [Indian lotus]
ref|XP_009125229.1|  PREDICTED: vacuolar-processing enzyme gamma-...    261   3e-80    Brassica rapa
emb|CDX75302.1|  BnaA01g04000D                                          261   5e-80    
gb|KHN29737.1|  Vacuolar-processing enzyme                              261   5e-80    Glycine soja [wild soybean]
ref|XP_008377927.1|  PREDICTED: vacuolar-processing enzyme-like         261   5e-80    
ref|XP_006285517.1|  hypothetical protein CARUB_v10006959mg             261   6e-80    Capsella rubella
ref|XP_007136809.1|  hypothetical protein PHAVU_009G076100g             260   8e-80    Phaseolus vulgaris [French bean]
ref|XP_010911246.1|  PREDICTED: vacuolar-processing enzyme              260   1e-79    Elaeis guineensis
gb|EYU29312.1|  hypothetical protein MIMGU_mgv1a005315mg                259   2e-79    Erythranthe guttata [common monkey flower]
ref|XP_007160985.1|  hypothetical protein PHAVU_001G033500g             259   4e-79    Phaseolus vulgaris [French bean]
sp|O24325.1|VPE1_PHAVU  RecName: Full=Vacuolar-processing enzyme;...    258   4e-79    Phaseolus vulgaris [French bean]
ref|XP_006578073.1|  PREDICTED: vacuolar-processing enzyme-like         258   4e-79    Glycine max [soybeans]
dbj|BAC86022.1|  unnamed protein product                                258   4e-79    Homo sapiens [man]
dbj|BAJ33795.1|  unnamed protein product                                258   5e-79    Eutrema halophilum
ref|XP_008797891.1|  PREDICTED: vacuolar-processing enzyme              258   8e-79    Phoenix dactylifera
dbj|BAA76744.1|  asparaginyl endopeptidase (VmPE-1)                     258   8e-79    Vigna mungo [urad dal]
dbj|BAA76745.1|  asparaginyl endopeptidase (VmPE-1A)                    257   1e-78    Vigna mungo [urad dal]
gb|AIB06797.1|  cte peptide ligase                                      256   4e-78    Clitoria ternatea
ref|XP_008444493.1|  PREDICTED: vacuolar-processing enzyme-like         256   4e-78    Cucumis melo [Oriental melon]
emb|CDX76736.1|  BnaC08g33220D                                          255   7e-78    
emb|CDY11506.1|  BnaA09g40720D                                          255   1e-77    Brassica napus [oilseed rape]
ref|XP_009117035.1|  PREDICTED: vacuolar-processing enzyme alpha-...    254   3e-77    Brassica rapa
ref|XP_004159537.1|  PREDICTED: vacuolar-processing enzyme-like         254   4e-77    
ref|XP_004142919.1|  PREDICTED: vacuolar-processing enzyme-like         253   4e-77    Cucumis sativus [cucumbers]
ref|XP_010669169.1|  PREDICTED: vacuolar-processing enzyme-like         253   5e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009407316.1|  PREDICTED: vacuolar-processing enzyme-like         252   1e-76    Musa acuminata subsp. malaccensis [pisang utan]
emb|CBM41515.1|  legumain/vacuolar processing enzyme                    252   1e-76    Papaver rhoeas [field poppy]
ref|XP_003589032.1|  Vacuolar-processing enzyme                         251   3e-76    
ref|XP_008220440.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    251   8e-76    Prunus mume [ume]
ref|XP_009420869.1|  PREDICTED: vacuolar-processing enzyme-like         248   2e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410798.1|  PREDICTED: vacuolar-processing enzyme              247   1e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001043344.1|  Os01g0559600                                       243   4e-73    
gb|EEE54813.1|  hypothetical protein OsJ_02232                          243   4e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646004.1|  PREDICTED: vacuolar-processing enzyme-like         241   4e-72    
gb|KJB70141.1|  hypothetical protein B456_011G060200                    238   4e-71    Gossypium raimondii
gb|EPS65165.1|  vacuolar processing enzyme-1b                           235   4e-70    Genlisea aurea
gb|AIT97058.1|  vacuolar processing enzyme                              229   8e-70    Triticum aestivum [Canadian hard winter wheat]
gb|ABF00019.1|  legumain precursor                                      233   2e-69    Saccharum officinarum [noble cane]
gb|EMS54452.1|  Vacuolar-processing enzyme                              230   6e-69    Triticum urartu
ref|XP_006853917.1|  hypothetical protein AMTR_s00036p00187360          231   2e-68    Amborella trichopoda
ref|NP_180165.1|  alpha-vacuolar processing enzyme                      231   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002455802.1|  hypothetical protein SORBIDRAFT_03g025440          229   6e-68    Sorghum bicolor [broomcorn]
gb|EMT06287.1|  Vacuolar-processing enzyme                              228   8e-68    
gb|AEY68248.1|  legumain                                                229   9e-68    Saccharum hybrid cultivar SP80-3280
ref|XP_004968980.1|  PREDICTED: vacuolar-processing enzyme-like         228   1e-67    Setaria italica
ref|XP_010049768.1|  PREDICTED: vacuolar-processing enzyme-like         221   5e-67    Eucalyptus grandis [rose gum]
gb|EPS60990.1|  vacuolar processing enzyme a                            221   6e-67    Genlisea aurea
gb|KCW82539.1|  hypothetical protein EUGRSUZ_C03943                     220   6e-67    Eucalyptus grandis [rose gum]
emb|CDM87100.1|  unnamed protein product                                227   6e-67    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569218.1|  PREDICTED: vacuolar-processing enzyme-like         227   7e-67    Brachypodium distachyon [annual false brome]
gb|KCW81647.1|  hypothetical protein EUGRSUZ_C03009                     221   7e-67    Eucalyptus grandis [rose gum]
dbj|BAJ95226.1|  predicted protein                                      226   2e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF79136.1|  unknown                                                 226   2e-66    Zea mays [maize]
ref|XP_011081710.1|  PREDICTED: vacuolar-processing enzyme              225   3e-66    Sesamum indicum [beniseed]
ref|NP_001105613.1|  LOC542609 precursor                                225   3e-66    
gb|EMS65516.1|  Vacuolar-processing enzyme                              223   6e-66    Triticum urartu
gb|EMT10444.1|  Vacuolar-processing enzyme                              225   1e-65    
emb|CAQ00099.1|  legumain                                               223   1e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG34144.1|  vacuolar processing enzyme precursor                    223   2e-65    Zea mays [maize]
gb|AET08891.1|  vacuolar processing enzyme 4                            223   2e-65    Triticum monococcum [einkorn wheat]
emb|CAB42655.1|  putative preprolegumain                                219   3e-65    Vicia narbonensis
gb|EMT02419.1|  Vacuolar-processing enzyme                              223   4e-65    
emb|CAB64545.1|  legumain-like protease                                 222   5e-65    Zea mays [maize]
ref|NP_001241716.1|  uncharacterized protein LOC100856894 precursor     221   8e-65    Zea mays [maize]
ref|NP_001105119.1|  legumain-like protease precursor                   221   1e-64    
gb|KHG17266.1|  Vacuolar-processing enzyme                              219   4e-64    Gossypium arboreum [tree cotton]
gb|AET08893.1|  vacuolar processing enzyme 4                            219   5e-64    Aegilops speltoides
gb|AET08896.1|  vacuolar processing enzyme 4                            218   2e-63    Aegilops tauschii
gb|AAL69377.1|AF462214_1  putative asparaginyl endopeptidase            207   3e-63    Narcissus pseudonarcissus
emb|CAC18100.1|  putative legumain                                      217   4e-63    Zea mays [maize]
ref|XP_009396761.1|  PREDICTED: vacuolar-processing enzyme-like         211   3e-61    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB54730.1|  hypothetical protein B456_009G046800                    210   8e-61    Gossypium raimondii
gb|ABR18199.1|  unknown                                                 211   1e-60    Picea sitchensis
gb|ABR17022.1|  unknown                                                 204   6e-60    Picea sitchensis
gb|EPS59704.1|  hypothetical protein M569_15100                         207   7e-60    Genlisea aurea
ref|XP_010051267.1|  PREDICTED: vacuolar-processing enzyme-like         201   1e-59    
emb|CAQ00100.1|  legumain                                               206   3e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009764212.1|  PREDICTED: vacuolar-processing enzyme-like         203   4e-58    Nicotiana sylvestris
gb|KDO48392.1|  hypothetical protein CISIN_1g016176mg                   196   7e-57    Citrus sinensis [apfelsine]
ref|XP_009386040.1|  PREDICTED: vacuolar-processing enzyme-like         191   1e-56    
gb|EMS56335.1|  Vacuolar-processing enzyme beta-isozyme                 199   2e-56    Triticum urartu
gb|AET08888.1|  vacuolar processing enzyme 1                            199   3e-56    Triticum monococcum [einkorn wheat]
gb|KDO48391.1|  hypothetical protein CISIN_1g016176mg                   196   7e-56    Citrus sinensis [apfelsine]
gb|ABH09087.1|  vacuolar processing enzyme-like protein                 186   1e-55    Artemisia annua [sweet Annie]
gb|KDP25622.1|  hypothetical protein JCGZ_20778                         196   4e-55    Jatropha curcas
ref|XP_006477253.1|  PREDICTED: vacuolar-processing enzyme-like         195   1e-54    Citrus sinensis [apfelsine]
gb|AET08892.1|  vacuolar processing enzyme 2                            193   3e-54    Aegilops speltoides
ref|XP_010933721.1|  PREDICTED: vacuolar-processing enzyme              193   4e-54    Elaeis guineensis
ref|XP_003569976.1|  PREDICTED: vacuolar-processing enzyme beta-i...    192   1e-53    Brachypodium distachyon [annual false brome]
ref|XP_009398114.1|  PREDICTED: vacuolar-processing enzyme-like         190   1e-53    
ref|XP_009621616.1|  PREDICTED: vacuolar-processing enzyme gamma-...    191   1e-53    Nicotiana tomentosiformis
ref|XP_002448237.1|  hypothetical protein SORBIDRAFT_06g023820          192   2e-53    Sorghum bicolor [broomcorn]
ref|XP_006440379.1|  hypothetical protein CICLE_v10019686mg             192   2e-53    Citrus clementina [clementine]
gb|EMT33588.1|  Vacuolar-processing enzyme beta-isozyme                 189   3e-53    
gb|AEB22070.1|  vacuolar processing enzyme 2                            180   7e-53    Solanum tuberosum [potatoes]
ref|XP_004976374.1|  PREDICTED: vacuolar-processing enzyme-like         190   7e-53    Setaria italica
ref|XP_006647602.1|  PREDICTED: vacuolar-processing enzyme-like         189   1e-52    Oryza brachyantha
ref|NP_001275272.1|  vacoular processing enzyme 2 precursor             189   1e-52    Solanum tuberosum [potatoes]
gb|EMT06055.1|  Vacuolar-processing enzyme                              189   1e-52    
tpg|DAA36671.1|  TPA: hypothetical protein ZEAMMB73_569687              184   2e-52    
gb|EMS56147.1|  Vacuolar-processing enzyme                              188   3e-52    Triticum urartu
gb|KHG24041.1|  Vacuolar-processing enzyme                              188   4e-52    Gossypium arboreum [tree cotton]
gb|AET08895.1|  vacuolar processing enzyme 2                            188   4e-52    Aegilops tauschii
gb|KJB25635.1|  hypothetical protein B456_004G201300                    188   4e-52    Gossypium raimondii
ref|XP_004960991.1|  PREDICTED: vacuolar-processing enzyme-like         187   5e-52    Setaria italica
ref|XP_006652582.1|  PREDICTED: vacuolar-processing enzyme-like         188   5e-52    Oryza brachyantha
ref|XP_003580236.1|  PREDICTED: vacuolar-processing enzyme beta-i...    187   7e-52    
ref|XP_004953273.1|  PREDICTED: vacuolar-processing enzyme beta-i...    187   8e-52    Setaria italica
ref|XP_002452849.1|  hypothetical protein SORBIDRAFT_04g033520          186   2e-51    Sorghum bicolor [broomcorn]
dbj|BAD25788.1|  putative asparaginyl endopeptidase REP-2               184   2e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441635.1|  hypothetical protein SORBIDRAFT_09g030710          186   2e-51    
ref|NP_001105183.1|  vacuolar processing enzyme1 precursor              186   2e-51    Zea mays [maize]
gb|KDO80009.1|  hypothetical protein CISIN_1g011066mg                   185   2e-51    Citrus sinensis [apfelsine]
gb|AFW72544.1|  vacuolar processing enzyme 1                            186   2e-51    
dbj|BAJ89125.1|  predicted protein                                      181   2e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001047562.1|  Os02g0644000                                       184   5e-51    
ref|NP_001152500.1|  LOC100286140                                       184   7e-51    Zea mays [maize]
ref|XP_010259032.1|  PREDICTED: vacuolar-processing enzyme-like         184   1e-50    Nelumbo nucifera [Indian lotus]
ref|XP_008668185.1|  PREDICTED: LOC100286140 isoform X1                 184   1e-50    Zea mays [maize]
dbj|BAC41386.1|  asparaginyl endopeptidase REP-2                        184   2e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008369533.1|  PREDICTED: legumain                                183   3e-50    Malus domestica [apple tree]
gb|KCW81643.1|  hypothetical protein EUGRSUZ_C03004                     181   3e-50    Eucalyptus grandis [rose gum]
ref|XP_006371860.1|  hypothetical protein POPTR_0018s04650g             182   4e-50    
ref|NP_001053428.1|  Os04g0537900                                       183   4e-50    
sp|B8ASK4.1|VPE1_ORYSI  RecName: Full=Vacuolar-processing enzyme ...    182   5e-50    Oryza sativa Indica Group [Indian rice]
emb|CAQ00096.1|  legumain                                               182   6e-50    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003608767.1|  Vacuolar-processing enzyme                         177   9e-50    
gb|EMT14075.1|  Vacuolar-processing enzyme beta-isozyme                 180   9e-50    
emb|CBX26637.1|  vacuolar processing enzyme 2a                          180   1e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAD04882.1|  C13 endopeptidase NP1 precursor                         180   1e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBX26639.1|  vacuolar processing enzyme 2c                          181   1e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB51882.1|  hypothetical protein B456_008G236100                    181   1e-49    Gossypium raimondii
ref|XP_002509577.1|  Vacuolar-processing enzyme precursor               181   2e-49    
emb|CAQ00098.1|  legumain                                               181   2e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT00724.1|  Vacuolar-processing enzyme                              180   3e-49    
gb|EYU24761.1|  hypothetical protein MIMGU_mgv1a005235mg                181   3e-49    Erythranthe guttata [common monkey flower]
ref|XP_009382344.1|  PREDICTED: legumain-like                           181   3e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796848.1|  PREDICTED: vacuolar-processing enzyme              180   3e-49    Phoenix dactylifera
ref|XP_002886459.1|  F23N19.7                                           181   4e-49    
ref|XP_007039931.1|  Beta vacuolar processing enzyme                    181   4e-49    
gb|EMT17626.1|  Vacuolar-processing enzyme                              182   5e-49    
ref|XP_006838620.1|  hypothetical protein AMTR_s00002p00231730          172   5e-49    
emb|CAQ00097.1|  legumain                                               179   6e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU34366.1|  hypothetical protein MIMGU_mgv1a018579mg                179   7e-49    Erythranthe guttata [common monkey flower]
gb|ABS57371.1|  VPE1                                                    179   7e-49    Triticum aestivum [Canadian hard winter wheat]
emb|CBX26640.1|  vacuolar processing enzyme 2d                          179   7e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010093667.1|  Vacuolar-processing enzyme                         179   8e-49    Morus notabilis
ref|XP_006391830.1|  hypothetical protein EUTSA_v10023430mg             179   1e-48    Eutrema salsugineum [saltwater cress]
ref|XP_004245119.1|  PREDICTED: vacuolar-processing enzyme-like         177   2e-48    
ref|XP_010430341.1|  PREDICTED: vacuolar-processing enzyme beta-i...    178   2e-48    Camelina sativa [gold-of-pleasure]
gb|AAL40390.1|  C13 cysteine proteinase precursor                       177   2e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_001759301.1|  predicted protein                                  177   3e-48    
ref|XP_010473493.1|  PREDICTED: vacuolar-processing enzyme beta-i...    177   3e-48    Camelina sativa [gold-of-pleasure]
ref|XP_008437131.1|  PREDICTED: legumain                                177   4e-48    Cucumis melo [Oriental melon]
ref|XP_007155624.1|  hypothetical protein PHAVU_003G217500g             177   4e-48    Phaseolus vulgaris [French bean]
ref|XP_004298668.1|  PREDICTED: legumain                                177   5e-48    Fragaria vesca subsp. vesca
sp|O24326.1|VPE2_PHAVU  RecName: Full=Vacuolar-processing enzyme;...    177   5e-48    Phaseolus vulgaris [French bean]
ref|XP_007209951.1|  hypothetical protein PRUPE_ppa004795mg             177   7e-48    Prunus persica
ref|XP_003608766.1|  Vacuolar-processing enzyme                         176   7e-48    
gb|AES90963.2|  vacuolar processing enzyme                              177   7e-48    Medicago truncatula
ref|XP_010418271.1|  PREDICTED: vacuolar-processing enzyme beta-i...    176   8e-48    Camelina sativa [gold-of-pleasure]
emb|CBX26638.1|  vacuolar processing enzyme 2b                          176   8e-48    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011018251.1|  PREDICTED: vacuolar-processing enzyme              176   9e-48    Populus euphratica
ref|XP_004515742.1|  PREDICTED: vacuolar-processing enzyme-like         176   1e-47    Cicer arietinum [garbanzo]
ref|XP_010553469.1|  PREDICTED: vacuolar-processing enzyme beta-i...    176   1e-47    Tarenaya hassleriana [spider flower]
ref|XP_008238625.1|  PREDICTED: LOW QUALITY PROTEIN: legumain           176   2e-47    Prunus mume [ume]
ref|XP_006368681.1|  hypothetical protein POPTR_0001s07710g             169   2e-47    
ref|NP_001291333.1|  vacuolar-processing enzyme precursor               175   2e-47    Sesamum indicum [beniseed]
ref|XP_004147613.1|  PREDICTED: vacuolar-processing enzyme-like         175   2e-47    Cucumis sativus [cucumbers]
ref|XP_009762559.1|  PREDICTED: vacuolar-processing enzyme-like         174   3e-47    Nicotiana sylvestris
ref|XP_006355318.1|  PREDICTED: vacuolar-processing enzyme-like         174   3e-47    Solanum tuberosum [potatoes]
emb|CDY03258.1|  BnaC09g10900D                                          175   3e-47    
dbj|BAD94396.1|  beta-VPE                                               169   4e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112700.1|  PREDICTED: vacuolar-processing enzyme beta-i...    174   4e-47    Brassica rapa
emb|CDY39808.1|  BnaA09g10600D                                          174   4e-47    Brassica napus [oilseed rape]
emb|CDP09908.1|  unnamed protein product                                175   4e-47    Coffea canephora [robusta coffee]
sp|P49046.1|LEGU_CANEN  RecName: Full=Legumain; AltName: Full=Asp...    174   4e-47    Canavalia ensiformis [horse bean]
ref|XP_006355317.1|  PREDICTED: vacuolar-processing enzyme-like         174   5e-47    Solanum tuberosum [potatoes]
ref|XP_007216154.1|  hypothetical protein PRUPE_ppa015210mg             174   6e-47    Prunus persica
ref|XP_006355331.1|  PREDICTED: vacuolar-processing enzyme-like         174   7e-47    Solanum tuberosum [potatoes]
ref|XP_002960690.1|  hypothetical protein SELMODRAFT_75074              174   7e-47    
ref|XP_002304429.2|  hypothetical protein POPTR_0003s11280g             174   7e-47    
gb|AGC54786.1|  beta vacuolar processing enzyme                         174   8e-47    Vitis vinifera
ref|XP_009616669.1|  PREDICTED: vacuolar-processing enzyme-like         172   9e-47    
gb|KHN09785.1|  Vacuolar-processing enzyme                              174   9e-47    Glycine soja [wild soybean]
ref|XP_002983346.1|  hypothetical protein SELMODRAFT_445464             173   1e-46    
emb|CAA07639.1|  cysteine proteinase precursor                          173   1e-46    Vicia sativa [spring vetch]
ref|XP_006838617.1|  hypothetical protein AMTR_s00002p00230280          172   1e-46    
ref|XP_008228013.1|  PREDICTED: vacuolar-processing enzyme-like         172   2e-46    Prunus mume [ume]
ref|XP_006579475.1|  PREDICTED: seed maturation protein PM40 isof...    173   2e-46    
ref|NP_001238297.1|  seed maturation protein PM40 precursor             173   2e-46    
emb|CAB16318.1|  cysteine proteinase precursor                          172   2e-46    
ref|XP_006302155.1|  hypothetical protein CARUB_v10020164mg             172   3e-46    
emb|CAN76990.1|  hypothetical protein VITISV_028106                     171   3e-46    
ref|XP_010325045.1|  PREDICTED: vacuolar-processing enzyme-like         172   3e-46    
gb|AFK40405.1|  unknown                                                 169   4e-46    
emb|CAB42651.2|  putative preprolegumain                                172   4e-46    
ref|XP_011033921.1|  PREDICTED: vacuolar-processing enzyme-like         172   4e-46    
ref|NP_001236678.1|  vacuolar-processing enzyme precursor               172   5e-46    
ref|XP_002266627.1|  PREDICTED: vacuolar-processing enzyme              171   6e-46    
ref|XP_010325261.1|  PREDICTED: vacuolar-processing enzyme-like         171   7e-46    
ref|XP_009783281.1|  PREDICTED: vacuolar-processing enzyme-like         171   7e-46    
ref|XP_010646818.1|  PREDICTED: vacuolar-processing enzyme              171   8e-46    
ref|NP_176458.1|  vacuolar-processing enzyme beta                       171   1e-45    
ref|XP_009592399.1|  PREDICTED: vacuolar-processing enzyme              171   1e-45    
gb|AFK44184.1|  unknown                                                 160   1e-45    
emb|CAE03020.3|  OSJNBa0091D06.13                                       171   1e-45    
ref|XP_010053430.1|  PREDICTED: vacuolar-processing enzyme isofor...    169   1e-45    
ref|XP_011467518.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    171   1e-45    
ref|XP_006355496.1|  PREDICTED: vacuolar-processing enzyme beta-i...    170   2e-45    
ref|XP_009794187.1|  PREDICTED: vacuolar-processing enzyme-like         169   2e-45    
ref|XP_009771365.1|  PREDICTED: vacuolar-processing enzyme beta-i...    170   2e-45    
emb|CBI28507.3|  unnamed protein product                                171   3e-45    
emb|CAE84598.1|  putative legumain                                      169   3e-45    
gb|AAF19550.1|AC007190_18  F23N19.7                                     170   3e-45    
ref|XP_004245733.1|  PREDICTED: vacuolar-processing enzyme beta-i...    170   3e-45    
ref|XP_009616671.1|  PREDICTED: vacuolar-processing enzyme-like         168   8e-45    
ref|XP_010053427.1|  PREDICTED: vacuolar-processing enzyme isofor...    168   9e-45    
emb|CAB51545.1|  vacuolar processing enzyme                             167   1e-44    
ref|XP_006355330.1|  PREDICTED: vacuolar-processing enzyme-like         167   1e-44    
ref|XP_004245120.1|  PREDICTED: vacuolar-processing enzyme gamma-...    167   2e-44    
dbj|BAA09615.1|  vacuolar processing enzyme                             167   3e-44    
ref|XP_010676183.1|  PREDICTED: vacuolar-processing enzyme              166   3e-44    
ref|XP_006355332.1|  PREDICTED: vacuolar-processing enzyme-like         166   3e-44    
gb|KJB44527.1|  hypothetical protein B456_007G257800                    159   3e-44    
ref|XP_010695188.1|  PREDICTED: vacuolar-processing enzyme-like         165   5e-44    
ref|XP_001755207.1|  predicted protein                                  165   8e-44    
gb|EMT28199.1|  Vacuolar-processing enzyme beta-isozyme                 164   2e-43    
ref|XP_010112450.1|  Vacuolar-processing enzyme                         164   2e-43    
gb|KJB44946.1|  hypothetical protein B456_007G281200                    158   3e-43    
ref|XP_004245378.1|  PREDICTED: vacuolar-processing enzyme-like         166   3e-43    
ref|XP_006355333.1|  PREDICTED: vacuolar-processing enzyme-like         163   5e-43    
ref|XP_008654306.1|  PREDICTED: uncharacterized protein LOC100192...    163   5e-43    
ref|XP_010264202.1|  PREDICTED: vacuolar-processing enzyme-like         163   6e-43    
gb|KHG10620.1|  Vacuolar-processing enzyme                              162   7e-43    
ref|NP_001131347.1|  uncharacterized protein LOC100192667 precursor     163   1e-42    
gb|ACF83132.1|  unknown                                                 152   1e-42    
ref|XP_004245377.1|  PREDICTED: vacuolar-processing enzyme-like         162   1e-42    
gb|KHG10619.1|  Vacuolar-processing enzyme                              162   1e-42    
ref|XP_006573955.1|  PREDICTED: vacuolar-processing enzyme-like         153   2e-42    
ref|XP_001769381.1|  predicted protein                                  161   3e-42    
ref|XP_009371110.1|  PREDICTED: vacuolar-processing enzyme-like         160   4e-42    
ref|XP_009371107.1|  PREDICTED: vacuolar-processing enzyme-like         160   5e-42    
ref|XP_004499511.1|  PREDICTED: vacuolar-processing enzyme gamma-...    159   7e-42    
gb|KJB54732.1|  hypothetical protein B456_009G046900                    153   3e-41    
ref|XP_008361289.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    157   5e-41    
ref|XP_008337584.1|  PREDICTED: vacuolar-processing enzyme-like         157   5e-41    
ref|XP_010112451.1|  Vacuolar-processing enzyme                         161   7e-41    
ref|XP_008370166.1|  PREDICTED: vacuolar-processing enzyme-like         157   8e-41    
ref|XP_008367906.1|  PREDICTED: vacuolar-processing enzyme-like         157   1e-40    
gb|KHG20621.1|  Vacuolar-processing enzyme                              157   1e-40    
ref|XP_001784456.1|  predicted protein                                  155   3e-40    
ref|XP_010669190.1|  PREDICTED: vacuolar-processing enzyme-like         155   3e-40    
ref|XP_002310920.1|  hypothetical protein POPTR_0008s00410g             155   4e-40    
dbj|BAK05633.1|  predicted protein                                      146   5e-40    
gb|KJB35711.1|  hypothetical protein B456_006G124900                    155   5e-40    
gb|KJB35710.1|  hypothetical protein B456_006G124900                    155   5e-40    
ref|XP_008352319.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    155   6e-40    
ref|XP_008337582.1|  PREDICTED: vacuolar-processing enzyme-like         154   8e-40    
ref|XP_011033074.1|  PREDICTED: vacuolar-processing enzyme alpha-...    154   9e-40    
ref|XP_008337583.1|  PREDICTED: vacuolar-processing enzyme-like         154   1e-39    
gb|EPS73966.1|  asparaginyl endopeptidase                               153   2e-39    
ref|XP_008463400.1|  PREDICTED: vacuolar-processing enzyme gamma-...    146   2e-39    
ref|XP_009371106.1|  PREDICTED: vacuolar-processing enzyme-like         153   2e-39    
ref|XP_007023637.1|  Delta vacuolar processing enzyme, putative         153   3e-39    
ref|XP_007216228.1|  hypothetical protein PRUPE_ppa016772mg             151   6e-39    
emb|CDP09909.1|  unnamed protein product                                151   2e-38    
ref|XP_004303795.1|  PREDICTED: vacuolar-processing enzyme-like         150   2e-38    
gb|ABK25457.1|  unknown                                                 149   5e-38    
ref|XP_011465105.1|  PREDICTED: vacuolar-processing enzyme-like         149   7e-38    
ref|XP_003622265.1|  Vacuolar processing enzyme-1b                      149   8e-38    
ref|XP_006450041.1|  hypothetical protein CICLE_v10013934mg             148   1e-37    
ref|XP_008380412.1|  PREDICTED: vacuolar-processing enzyme              148   1e-37    
ref|XP_002987841.1|  hypothetical protein SELMODRAFT_126781             147   2e-37    
ref|XP_006296792.1|  hypothetical protein CARUB_v10016221mg             147   3e-37    
ref|XP_002993765.1|  hypothetical protein SELMODRAFT_137569             145   8e-37    
gb|EAY99261.1|  hypothetical protein OsI_21225                          145   1e-36    
ref|NP_001056504.1|  Os05g0593900                                       145   1e-36    
ref|XP_010669185.1|  PREDICTED: vacuolar-processing enzyme gamma-...    143   8e-36    
ref|XP_006450035.1|  hypothetical protein CICLE_v10013957mg             142   2e-35    
ref|XP_010034095.1|  PREDICTED: vacuolar-processing enzyme-like         142   2e-35    
ref|XP_004491990.1|  PREDICTED: vacuolar-processing enzyme-like         142   4e-35    
ref|XP_009379206.1|  PREDICTED: vacuolar-processing enzyme-like         140   6e-35    
ref|XP_010669196.1|  PREDICTED: vacuolar-processing enzyme gamma-...    140   1e-34    
ref|XP_006599066.1|  PREDICTED: vacuolar-processing enzyme-like         139   2e-34    
gb|KHN27584.1|  Vacuolar-processing enzyme                              139   3e-34    
ref|XP_010034096.1|  PREDICTED: vacuolar-processing enzyme-like         139   3e-34    
gb|KCW53993.1|  hypothetical protein EUGRSUZ_J03190                     139   3e-34    
ref|XP_008353892.1|  PREDICTED: vacuolar-processing enzyme-like         132   4e-34    
ref|XP_008240642.1|  PREDICTED: vacuolar-processing enzyme-like         138   5e-34    
ref|XP_004499586.1|  PREDICTED: vacuolar-processing enzyme-like         138   5e-34    
ref|XP_010034097.1|  PREDICTED: vacuolar-processing enzyme alpha-...    138   6e-34    
ref|XP_010508646.1|  PREDICTED: vacuolar-processing enzyme-like i...    137   1e-33    
ref|XP_004491991.1|  PREDICTED: vacuolar-processing enzyme-like         136   3e-33    
ref|XP_004499587.1|  PREDICTED: vacuolar-processing enzyme gamma-...    135   4e-33    
gb|EYU21190.1|  hypothetical protein MIMGU_mgv1a005661mg                135   6e-33    
ref|XP_008392598.1|  PREDICTED: vacuolar-processing enzyme-like         135   7e-33    
ref|XP_010487991.1|  PREDICTED: vacuolar-processing enzyme gamma-...    135   7e-33    
ref|XP_010325264.1|  PREDICTED: vacuolar-processing enzyme-like         135   8e-33    
dbj|BAD94082.1|  vacuolar processing enzyme/asparaginyl endopepti...    130   9e-33    
ref|XP_009344982.1|  PREDICTED: vacuolar-processing enzyme-like         135   9e-33    
ref|XP_010034886.1|  PREDICTED: vacuolar-processing enzyme-like         135   2e-32    
ref|XP_004305798.1|  PREDICTED: vacuolar-processing enzyme-like         134   2e-32    
ref|XP_002883236.1|  DELTA-VPE                                          134   2e-32    
ref|XP_010508655.1|  PREDICTED: vacuolar-processing enzyme alpha-...    134   4e-32    
ref|XP_007202848.1|  hypothetical protein PRUPE_ppa014701mg             132   6e-32    
ref|XP_004516951.1|  PREDICTED: vacuolar-processing enzyme-like         132   8e-32    
ref|XP_002869166.1|  hypothetical protein ARALYDRAFT_912980             132   9e-32    
ref|NP_188656.1|  delta vacuolar processing enzyme                      130   3e-31    
gb|AAM60827.1|  vacuolar processing enzyme/asparaginyl endopeptid...    130   3e-31    
ref|XP_010487992.1|  PREDICTED: vacuolar-processing enzyme alpha-...    131   3e-31    
gb|KJB54731.1|  hypothetical protein B456_009G046900                    123   4e-31    
gb|EMT07410.1|  Vacuolar-processing enzyme beta-isozyme                 129   6e-31    
ref|XP_006654878.1|  PREDICTED: vacuolar-processing enzyme-like         128   2e-30    
ref|XP_003581699.2|  PREDICTED: vacuolar-processing enzyme-like         120   3e-30    
ref|XP_010466201.1|  PREDICTED: vacuolar-processing enzyme alpha-...    127   1e-29    
ref|NP_001189938.1|  delta vacuolar processing enzyme                   126   1e-29    
emb|CDY25397.1|  BnaA05g18870D                                          125   1e-29    
ref|XP_009111229.1|  PREDICTED: vacuolar-processing enzyme-like         125   2e-29    
gb|EEC79833.1|  hypothetical protein OsI_21296                          122   7e-29    
ref|XP_010545489.1|  PREDICTED: vacuolar-processing enzyme gamma-...    122   2e-28    
ref|XP_009145662.1|  PREDICTED: vacuolar-processing enzyme              122   2e-28    
dbj|BAA90621.1|  putative asparagine-specific endopeptidase precu...    122   2e-28    
emb|CDY12724.1|  BnaC04g29170D                                          122   3e-28    
emb|CDY42232.1|  BnaA01g25630D                                          121   6e-28    
emb|CDY29802.1|  BnaC05g31880D                                          120   1e-27    
ref|XP_006406410.1|  hypothetical protein EUTSA_v10020662mg             119   2e-27    
ref|XP_010545490.1|  PREDICTED: vacuolar-processing enzyme alpha-...    119   5e-27    
gb|KHG28226.1|  Vacuolar-processing enzyme                              115   3e-26    
ref|XP_008343246.1|  PREDICTED: vacuolar-processing enzyme-like         110   4e-26    
gb|AES80307.2|  vacuolar processing enzyme                              115   8e-26    
gb|KFK39346.1|  vacuolar processing enzyme                              113   4e-25    
gb|EMS59602.1|  Vacuolar-processing enzyme                              110   7e-25    
gb|AAP80637.1|AF475115_1  c13 endopeptidase precursor                   104   1e-24    
ref|XP_007217118.1|  hypothetical protein PRUPE_ppa017978m1g            107   2e-24    
ref|XP_003624089.1|  Vacuolar processing enzyme-1a                      109   6e-24    
ref|XP_004491693.1|  PREDICTED: vacuolar-processing enzyme-like         109   8e-24    
gb|AES79969.2|  vacuolar processing enzyme                              103   6e-22    
gb|EMT15482.1|  Vacuolar-processing enzyme                              101   8e-21    
ref|XP_003623751.1|  Vacuolar processing enzyme-1b                    99.4    3e-20    
gb|KCW53989.1|  hypothetical protein EUGRSUZ_J03187                   97.1    4e-20    
ref|XP_004491696.1|  PREDICTED: vacuolar-processing enzyme-like       97.4    1e-19    
ref|XP_004491695.1|  PREDICTED: vacuolar-processing enzyme-like       96.7    2e-19    
ref|XP_011461721.1|  PREDICTED: vacuolar-processing enzyme-like       94.4    2e-19    
emb|CDY63560.1|  BnaCnng42290D                                        92.4    2e-19    
emb|CDY69360.1|  BnaCnng63150D                                        92.0    3e-19    
ref|XP_004491694.1|  PREDICTED: vacuolar-processing enzyme-like       96.3    4e-19    
gb|KCW53994.1|  hypothetical protein EUGRSUZ_J03190                   89.7    5e-17    
gb|KCW53995.1|  hypothetical protein EUGRSUZ_J03190                   87.4    3e-16    
ref|XP_009123145.1|  PREDICTED: vacuolar-processing enzyme-like       81.3    6e-16    
gb|KCW53991.1|  hypothetical protein EUGRSUZ_J03188                   85.9    1e-15    
ref|XP_009778553.1|  PREDICTED: vacuolar-processing enzyme-like       79.0    1e-15    
ref|XP_007136808.1|  hypothetical protein PHAVU_009G076000g           80.9    2e-15    
gb|EMT26708.1|  Protein BUD31-1-like protein                          79.3    2e-14    
ref|XP_002455803.1|  hypothetical protein SORBIDRAFT_03g025445        76.6    3e-14    
ref|XP_005846964.1|  hypothetical protein CHLNCDRAFT_24292            81.6    3e-14    
ref|XP_003621160.1|  Vacuolar processing enzyme-1b                    73.6    2e-13    
emb|CDY50097.1|  BnaC01g32720D                                        73.2    8e-13    
gb|ADD54615.1|  vacuolar processing enzyme                            68.9    6e-12    
emb|CAD24776.1|  asparaginyl endopeptidase-like protein               70.1    6e-12    
gb|KJB65607.1|  hypothetical protein B456_010G103000                  73.6    1e-11    
gb|KJB06490.1|  hypothetical protein B456_001G023700                  73.2    2e-11    
emb|CDY63564.1|  BnaCnng42320D                                        69.7    2e-11    
gb|KDO80010.1|  hypothetical protein CISIN_1g011066mg                 72.8    2e-11    
emb|CDY70209.1|  BnaUnng03710D                                        67.0    4e-11    
ref|XP_005651789.1|  hypothetical protein COCSUDRAFT_64138            72.4    5e-11    
ref|XP_003621012.1|  Vacuolar processing enzyme-1a                    69.3    6e-10    
ref|XP_011396954.1|  Vacuolar-processing enzyme beta-isozyme          65.5    9e-09    
ref|XP_004499640.1|  PREDICTED: vacuolar-processing enzyme-like       64.7    1e-08    
emb|CDY63558.1|  BnaCnng42270D                                        60.8    2e-08    
ref|XP_002953557.1|  hypothetical protein VOLCADRAFT_38723            56.6    2e-07    
ref|XP_006450039.1|  hypothetical protein CICLE_v100139431mg          56.2    3e-07    
emb|CDY63561.1|  BnaCnng42300D                                        57.4    4e-07    
gb|ABN08935.1|  hypothetical protein MtrDRAFT_AC168204g21v2           53.5    5e-06    
ref|XP_001703162.1|  vacuolar processing enzyme                       55.1    3e-05    
ref|XP_004349412.1|  asparaginyl endopeptidase                        52.4    2e-04    
dbj|BAD51741.1|  vacuolar processing enzyme 1b                        51.6    3e-04    



>gb|AAF69014.1|AF260827_1 cysteine protease [Ipomoea batatas]
Length=492

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/180 (94%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE N DSLF+YMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA
Sbjct  313  LELNADSLFMYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  372

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RKSEAQKQFTEAI+HRTHLDNSI+LVGKLLFG+EKGPEVL+S+RATGLPLVDDWSCLKS+
Sbjct  373  RKSEAQKQFTEAITHRTHLDNSIALVGKLLFGMEKGPEVLSSVRATGLPLVDDWSCLKSY  432

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFETHCGSLSQYGMKHMRSIANICNAGISEERM EASAQACP+FPSYSWSSLRGGFSA
Sbjct  433  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMAEASAQACPTFPSYSWSSLRGGFSA  492



>ref|XP_009780274.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana sylvestris]
Length=481

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 158/180 (88%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ ++DSLF+YMGTNPAN+N+T+VD+ SL  S+  +AVNQRDADLLHFWDKFR APEGSA
Sbjct  304  LQLSMDSLFIYMGTNPANDNYTYVDDNSLWASS--KAVNQRDADLLHFWDKFRKAPEGSA  361

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQKQFTEA+SHR HLDNS++LVGKLLFGI+KGPEVL  +R  G PLVDDW+CLKSF
Sbjct  362  RKVEAQKQFTEAMSHRMHLDNSMALVGKLLFGIQKGPEVLKRVRPVGQPLVDDWTCLKSF  421

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMRSIANICN GI  E+MVEASAQACPS PS +WSSL  GFSA
Sbjct  422  VRTFETHCGSLSQYGMKHMRSIANICNDGIKMEQMVEASAQACPSVPSNTWSSLHRGFSA  481



>ref|XP_009616632.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
 dbj|BAC54830.1| vacuolar processing enzyme-3 [Nicotiana tabacum]
Length=481

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+  +DSLF+YMGTNPAN+N+T+VD+ SL+ S+  +AVNQRDADLLHFWDKFR APEGSA
Sbjct  304  LQLGMDSLFMYMGTNPANDNYTYVDDNSLRASS--KAVNQRDADLLHFWDKFRKAPEGSA  361

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQKQFTEA+SHR HLDNS++LVGKLLFGI+KGPEVL  +R  G PLVDDW+CLK F
Sbjct  362  RKVEAQKQFTEAMSHRMHLDNSMALVGKLLFGIQKGPEVLKRVRPVGQPLVDDWTCLKYF  421

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMRSIANICNAGI  E+MVEAS QACPS P+  WSSL  GFSA
Sbjct  422  VRTFETHCGSLSQYGMKHMRSIANICNAGIKMEQMVEASTQACPSVPTNIWSSLHRGFSA  481



>gb|ACB30368.1| vascular processing enzyme-3 [Capsicum annuum]
Length=484

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 159/180 (88%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ +++SLF +MGTNPAN+N+T+VD+ SL  S+  RAVNQRDADLLHFWDKFR APEGSA
Sbjct  307  LQLSMESLFSFMGTNPANDNYTYVDDNSLWASS--RAVNQRDADLLHFWDKFRKAPEGSA  364

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQKQFTEA+SHR HLDNSI+LVGKLLFGI+KGPEVL  +R+ G PLVDDW+CLKSF
Sbjct  365  RKVEAQKQFTEAMSHRMHLDNSIALVGKLLFGIQKGPEVLKRVRSAGQPLVDDWACLKSF  424

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMRSIANICNAGI  E+MVEASAQACPS P+ +WSSL  GFSA
Sbjct  425  VRTFETHCGSLSQYGMKHMRSIANICNAGIHTEQMVEASAQACPSIPANTWSSLHRGFSA  484



>ref|XP_009616670.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
 dbj|BAC54828.1| vacuolar processing enzyme-1b [Nicotiana tabacum]
Length=489

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 153/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D+L+LYMGTNPAN+N+TF+D+ SL++S   +AVNQRDADLLHFW KFR APEGS RK EA
Sbjct  318  DALYLYMGTNPANDNYTFMDDNSLRVS---KAVNQRDADLLHFWHKFRTAPEGSVRKIEA  374

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EAISHR HLDNS++LVGKLLFGIEKGPEVL+ +R  G PLVDDW CLKSFVR FE
Sbjct  375  QKQLNEAISHRVHLDNSVALVGKLLFGIEKGPEVLSGVRPAGQPLVDDWDCLKSFVRTFE  434

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRSIANICNAGI +E+MVEASAQACPS PS +WSSL  GFSA
Sbjct  435  THCGSLSQYGMKHMRSIANICNAGIKKEQMVEASAQACPSVPSNTWSSLHRGFSA  489



>ref|XP_004253098.1| PREDICTED: vacuolar-processing enzyme [Solanum lycopersicum]
Length=480

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ +++SLF +MGTNPAN+N+T+VD+ SL  S+  +AVNQRDADLLHFWDKFR APEGSA
Sbjct  303  LQLSMESLFRFMGTNPANDNYTYVDDNSLLASS--KAVNQRDADLLHFWDKFRKAPEGSA  360

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQKQFTEA+SHR HLD  I+LVGKLLFGI+KGPEVL  +R+ G PLVDDW+CLKSF
Sbjct  361  RKVEAQKQFTEAMSHRMHLDERIALVGKLLFGIQKGPEVLKHVRSAGQPLVDDWACLKSF  420

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+HCGSLSQYGMKHMRSIANICNAGI  E+MVEASAQACPS PS  WSSL  GFSA
Sbjct  421  VRTFESHCGSLSQYGMKHMRSIANICNAGIQMEQMVEASAQACPSIPSNIWSSLHRGFSA  480



>emb|CAH56498.1| cysteine protease [Solanum lycopersicum]
Length=480

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ +++SLF +MGTNPAN+N+T+VD+ SL  S+  +AVNQRDADLLHFWDKFR APEGSA
Sbjct  303  LQLSMESLFRFMGTNPANDNYTYVDDNSLLASS--KAVNQRDADLLHFWDKFRKAPEGSA  360

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQKQFTEA+SHR HLD  I+LVGKLLFGI+KGPEVL  +R+ G PLVDDW+CLKSF
Sbjct  361  RKVEAQKQFTEAMSHRMHLDERIALVGKLLFGIQKGPEVLKHVRSAGQPLVDDWACLKSF  420

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+HCGSLSQYGMKHMRSIANICNAGI  E+MVEASAQACPS PS  WSSL  GFSA
Sbjct  421  VRTFESHCGSLSQYGMKHMRSIANICNAGIQMEQMVEASAQACPSIPSNIWSSLHRGFSA  480



>ref|XP_009762556.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana sylvestris]
 dbj|BAC54827.1| vacuolar processing enzyme-1a [Nicotiana tabacum]
Length=490

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D+L+LYMGTNPAN+N+TF+D+ SL++S   +AVNQRDADLLHFW KFR APEGS RK EA
Sbjct  319  DALYLYMGTNPANDNYTFMDDNSLRVS---KAVNQRDADLLHFWYKFRKAPEGSVRKIEA  375

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EAISHR HLDNSI+LVGKLLFGI+KGPEVL+S+R  G PLVDDW CLKSFVR FE
Sbjct  376  QKQLNEAISHRVHLDNSIALVGKLLFGIKKGPEVLSSVRPAGQPLVDDWDCLKSFVRTFE  435

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRSIANICN GI   +MVEASAQACPSF S +WSSL+ GFSA
Sbjct  436  THCGSLSQYGMKHMRSIANICNVGIKMAQMVEASAQACPSFASNTWSSLQRGFSA  490



>ref|XP_006342509.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=480

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ +++SLF +MGTNPAN+N+T+VD+ SL  S+  +AVNQRDADLLHFWDKFR APEGSA
Sbjct  303  LQLSMESLFRFMGTNPANDNYTYVDDNSLWASS--KAVNQRDADLLHFWDKFRKAPEGSA  360

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQKQFTEA+SHR HLD  I+LVGKLLFGI+KGPEVL  +R+ G PLVDDW+CLKSF
Sbjct  361  RKVEAQKQFTEAMSHRMHLDERIALVGKLLFGIQKGPEVLKHVRSAGQPLVDDWACLKSF  420

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+HCGSLSQYGMKHMRSIANICNAG+  E+MVEAS QACPS PS +WSSL  GFSA
Sbjct  421  VRTFESHCGSLSQYGMKHMRSIANICNAGVQMEQMVEASVQACPSIPSNTWSSLHRGFSA  480



>emb|CDP08231.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 153/180 (85%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ +++ LFLYMGTNPAN+N+TFVDE SL+ S+  +AVNQRDADLLHFWDKFR APEGSA
Sbjct  311  LKLSLEDLFLYMGTNPANDNYTFVDENSLRPSS--KAVNQRDADLLHFWDKFRKAPEGSA  368

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQKQ  EA+SHR H+DNS+ L+GKLLFGIEKG E+LNS+R  G PL DDW CLKS 
Sbjct  369  RKVEAQKQVVEAMSHRMHIDNSVKLIGKLLFGIEKGSEILNSVRPAGHPLADDWDCLKSL  428

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMRSIANICNAGI +++M EA+AQAC S PS SWSSL  GFSA
Sbjct  429  VRTFETHCGSLSQYGMKHMRSIANICNAGIKKDQMAEAAAQACVSLPSNSWSSLHRGFSA  488



>ref|XP_011096125.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
Length=491

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ +VD LF YMGTNPAN+NFTFVD  SL+LS+  RAVNQRDADL+HFWDKFR APEGSA
Sbjct  313  LKLSVDHLFSYMGTNPANDNFTFVDGNSLRLSS-SRAVNQRDADLVHFWDKFRKAPEGSA  371

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQKQ  EA++HR+H+DNSI L+GKLLFGIEKGP+VLN++R  G PLVDDW+CLK  
Sbjct  372  RKVEAQKQLAEAMAHRSHIDNSIQLIGKLLFGIEKGPQVLNTVRPAGEPLVDDWNCLKLL  431

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMRSIANICNAG+++E+M E SAQAC + PS SWSSL  G+SA
Sbjct  432  VRTFETHCGSLSQYGMKHMRSIANICNAGVNKEQMGEVSAQACTNVPSNSWSSLHRGYSA  491



>ref|XP_006355320.1| PREDICTED: vacuolar-processing enzyme [Solanum tuberosum]
Length=482

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLYMGT+PAN+N TF+D+ S+++S   +AVNQRDADL+HFW KF  APEGS RK+EA
Sbjct  311  DVLFLYMGTDPANDNSTFMDDNSMRVS---KAVNQRDADLVHFWYKFHKAPEGSVRKTEA  367

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EAISHR HLDNSI+LVGKLLFGI+KGPEVL S+R  G PLVDDW CLKS+VR FE
Sbjct  368  QKQLNEAISHRMHLDNSIALVGKLLFGIKKGPEVLTSVRPAGQPLVDDWDCLKSYVRTFE  427

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAGI  E+MVEASAQACPS PS +WSSL+ GFSA
Sbjct  428  THCGSLSQYGMKHMRSVANICNAGIKMEQMVEASAQACPSVPSNTWSSLQRGFSA  482



>gb|ACC68680.1| vacoular processing enzyme 1 [Solanum tuberosum]
Length=482

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLYMGT+PAN+N TF+D+ S+++S   +AVNQRDADL+HFW KF  APEGS RK+EA
Sbjct  311  DVLFLYMGTDPANDNSTFMDDNSMRVS---KAVNQRDADLVHFWYKFHKAPEGSVRKTEA  367

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EAISHR HLDNSI+LVGKLLFGI+KGPEVL S+R  G PLVDDW CLKS+VR FE
Sbjct  368  QKQLNEAISHRMHLDNSIALVGKLLFGIKKGPEVLTSVRPAGQPLVDDWDCLKSYVRTFE  427

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAGI  E+MVEASAQACPS PS +WSSL+ GFSA
Sbjct  428  THCGSLSQYGMKHMRSVANICNAGIKMEQMVEASAQACPSVPSNTWSSLQRGFSA  482



>ref|XP_004245113.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=482

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D++FLYMGT+PAN+N TF+D+ SL++S   +AVNQRDADL+HFW KF  APEGS  K+EA
Sbjct  311  DAVFLYMGTDPANDNSTFMDDNSLRVS---KAVNQRDADLVHFWYKFHKAPEGSVSKTEA  367

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK+  EAISHR HLDNSI+LVGKLLFGI+KGPEVL S+R  G PLVD+W CLKS+VR FE
Sbjct  368  QKRLNEAISHRMHLDNSIALVGKLLFGIKKGPEVLTSVRPAGQPLVDNWDCLKSYVRTFE  427

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAGI  E+MVEASAQACPS PSY+WSSL  GFSA
Sbjct  428  THCGSLSQYGMKHMRSVANICNAGIKMEQMVEASAQACPSVPSYTWSSLHRGFSA  482



>gb|KDO80008.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=309

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF Y+GTNPAN+N+TFVDE SL+ ++  +AVNQRDADLLHFWDK+R APEG+ RK+EA
Sbjct  137  NNLFTYLGTNPANDNYTFVDENSLRPAS--KAVNQRDADLLHFWDKYRKAPEGTPRKAEA  194

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEKGPE+LN++R  G PLVDDW CLKS VR FE
Sbjct  195  QKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFE  254

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG+LSQYGMKHMRS+ANICN GI +E+M EASAQAC + PS  WSSL  GFSA
Sbjct  255  SHCGALSQYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWSSLDKGFSA  309



>gb|KJB65608.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=302

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            DSLF Y+GTNPAN+NFTFVDE SL    P +AVNQRDADL+HFW K+R APEGS RK+EA
Sbjct  130  DSLFAYLGTNPANDNFTFVDENSL--VPPTKAVNQRDADLVHFWYKYRKAPEGSVRKTEA  187

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+S+ L+GKLLFGIE+G EVLN++R  G PLVDDW CLK  VR FE
Sbjct  188  QKQFVEAMSHRMHIDHSVKLIGKLLFGIERGLEVLNTVRPAGQPLVDDWKCLKKMVRTFE  247

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQAC S P+  WSSL+ GFSA
Sbjct  248  THCGSLAQYGMKHMRSLANICNAGIQTEQMAEASAQACVSVPTGRWSSLQKGFSA  302



>gb|KDP34125.1| hypothetical protein JCGZ_07696 [Jatropha curcas]
Length=493

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D+LFLYMGTNPANEN+TFVDE SL+   P +AVNQRDADL+HFWDK+R AP+GS RK +A
Sbjct  321  DNLFLYMGTNPANENYTFVDENSLR--PPSKAVNQRDADLVHFWDKYRKAPDGSTRKIQA  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR HLD+S+ L+GKLLFGI KG EVLN+IR  G PLVDDW CLK+ VR FE
Sbjct  379  QKQFVEAMSHRMHLDHSMKLIGKLLFGIGKGSEVLNAIRPAGQPLVDDWVCLKTLVRTFE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+AN+CNAGI E++M EASAQAC S PS  WSSL  GFSA
Sbjct  439  THCGSLSQYGMKHMRSLANLCNAGIREDQMAEASAQACVSIPSGPWSSLHKGFSA  493



>ref|XP_004498922.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=492

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            LF+Y+GTNPAN+N +FVDE SL L +P  AVNQRDADL+HFWDKFR APEGSARK+EA+K
Sbjct  320  LFIYLGTNPANDNISFVDESSLTLRSPSAAVNQRDADLIHFWDKFRKAPEGSARKNEAEK  379

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
            Q  EA+SHR H+DNS+ L+GKLLFGIEKGPE+ N++R  GLPLVD+W CLK+ VR FETH
Sbjct  380  QVLEAMSHRKHVDNSVELIGKLLFGIEKGPELFNTVRPAGLPLVDNWDCLKTMVRTFETH  439

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            CGSLSQYGMKHMRS ANICNAGI  E+M EASAQAC + P+  WSSL  GFSA
Sbjct  440  CGSLSQYGMKHMRSFANICNAGIQNEQMAEASAQACSNIPANPWSSLHRGFSA  492



>ref|XP_006450793.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|ESR64033.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
Length=370

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF Y+GTNPAN+N+TFVDE SL+ ++  +AVNQRDADLLHFWDK+R APEG+ RK+EA
Sbjct  198  NNLFTYLGTNPANDNYTFVDENSLRPAS--KAVNQRDADLLHFWDKYRKAPEGTPRKAEA  255

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEKGPE+LN++R  G PLVDDW CLKS VR FE
Sbjct  256  QKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFE  315

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG+LSQYGMKHMRS+ANICN GI +E+M EASAQAC + PS  WSSL  GFSA
Sbjct  316  SHCGALSQYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWSSLDKGFSA  370



>gb|KJB65604.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=394

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            DSLF Y+GTNPAN+NFTFVDE SL    P +AVNQRDADL+HFW K+R APEGS RK+EA
Sbjct  222  DSLFAYLGTNPANDNFTFVDENSL--VPPTKAVNQRDADLVHFWYKYRKAPEGSVRKTEA  279

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+S+ L+GKLLFGIE+G EVLN++R  G PLVDDW CLK  VR FE
Sbjct  280  QKQFVEAMSHRMHIDHSVKLIGKLLFGIERGLEVLNTVRPAGQPLVDDWKCLKKMVRTFE  339

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQAC S P+  WSSL+ GFSA
Sbjct  340  THCGSLAQYGMKHMRSLANICNAGIQTEQMAEASAQACVSVPTGRWSSLQKGFSA  394



>ref|XP_006450794.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|ESR64034.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|KDO80006.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=394

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF Y+GTNPAN+N+TFVDE SL+ ++  +AVNQRDADLLHFWDK+R APEG+ RK+EA
Sbjct  222  NNLFTYLGTNPANDNYTFVDENSLRPAS--KAVNQRDADLLHFWDKYRKAPEGTPRKAEA  279

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEKGPE+LN++R  G PLVDDW CLKS VR FE
Sbjct  280  QKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFE  339

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG+LSQYGMKHMRS+ANICN GI +E+M EASAQAC + PS  WSSL  GFSA
Sbjct  340  SHCGALSQYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWSSLDKGFSA  394



>ref|XP_007012236.1| Gamma vacuolar processing enzyme [Theobroma cacao]
 gb|EOY29855.1| Gamma vacuolar processing enzyme [Theobroma cacao]
Length=487

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D +F+Y+GTNPAN+NFTFVDE SL+   P +AVNQRDADL+HFWDK+R AP+GS RK EA
Sbjct  315  DIVFVYLGTNPANDNFTFVDENSLQ--PPTKAVNQRDADLVHFWDKYRKAPDGSVRKLEA  372

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+DNS+ L+GKLLFGIEKGPEV+ ++R  G PLVDDW CLK  VR FE
Sbjct  373  QKQFVEAMSHRMHIDNSMKLIGKLLFGIEKGPEVMKTVRPAGQPLVDDWKCLKKMVRTFE  432

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQAC S PS  WSS++ GFSA
Sbjct  433  THCGSLAQYGMKHMRSLANICNAGIQTEQMAEASAQACVSIPSGHWSSVQKGFSA  487



>gb|KJB65606.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=395

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            DSLF Y+GTNPAN+NFTFVDE SL    P +AVNQRDADL+HFW K+R APEGS RK+EA
Sbjct  223  DSLFAYLGTNPANDNFTFVDENSL--VPPTKAVNQRDADLVHFWYKYRKAPEGSVRKTEA  280

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+S+ L+GKLLFGIE+G EVLN++R  G PLVDDW CLK  VR FE
Sbjct  281  QKQFVEAMSHRMHIDHSVKLIGKLLFGIERGLEVLNTVRPAGQPLVDDWKCLKKMVRTFE  340

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQAC S P+  WSSL+ GFSA
Sbjct  341  THCGSLAQYGMKHMRSLANICNAGIQTEQMAEASAQACVSVPTGRWSSLQKGFSA  395



>ref|XP_011019533.1| PREDICTED: vacuolar-processing enzyme isoform X2 [Populus euphratica]
Length=395

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLYMGTNPAN+NFTFV++ SL+  +  +AVNQRDADL+HFW K+R APEGS RK EA
Sbjct  223  DDLFLYMGTNPANDNFTFVEDNSLRPHS--KAVNQRDADLVHFWAKYRKAPEGSTRKIEA  280

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEK  EVLN++R  G PLVDDW CLK+ VR FE
Sbjct  281  QKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEVLNTVRPAGQPLVDDWVCLKTLVRTFE  340

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGS+SQYGMKHMRS+AN+CNAGI +E+M EASAQAC SFPS SWSSL  GFSA
Sbjct  341  THCGSISQYGMKHMRSLANLCNAGIVKEQMAEASAQACVSFPSGSWSSLHKGFSA  395



>ref|XP_009783032.1| PREDICTED: vacuolar-processing enzyme-like, partial [Nicotiana 
sylvestris]
Length=331

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L LYMGTNPAN+N+TF+DE S  LSA  + VNQRDADLLHFWDKF  AP+GS RK EA
Sbjct  159  DPLSLYMGTNPANDNYTFLDENSSLLSA--KPVNQRDADLLHFWDKFLKAPQGSIRKIEA  216

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ TEA+SHR H+D+SI+LVGKLLFGIEKGPEVL  +R TG PLVDDW CLKSFVR FE
Sbjct  217  QKQLTEAMSHRMHIDDSIALVGKLLFGIEKGPEVLIRVRPTGEPLVDDWDCLKSFVRTFE  276

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMR++ANICN+GI  E++ +ASAQAC S PS SWSSL  GFSA
Sbjct  277  THCGSLSQYGMKHMRAVANICNSGIKMEQIAKASAQACVSIPSNSWSSLDEGFSA  331



>gb|KDO80007.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=413

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF Y+GTNPAN+N+TFVDE SL+ ++  +AVNQRDADLLHFWDK+R APEG+ RK+EA
Sbjct  241  NNLFTYLGTNPANDNYTFVDENSLRPAS--KAVNQRDADLLHFWDKYRKAPEGTPRKAEA  298

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEKGPE+LN++R  G PLVDDW CLKS VR FE
Sbjct  299  QKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFE  358

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG+LSQYGMKHMRS+ANICN GI +E+M EASAQAC + PS  WSSL  GFSA
Sbjct  359  SHCGALSQYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWSSLDKGFSA  413



>ref|XP_006382031.1| hypothetical protein POPTR_0006s24900g [Populus trichocarpa]
 gb|ERP59828.1| hypothetical protein POPTR_0006s24900g [Populus trichocarpa]
Length=310

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LF YMGTNPAN+N+TFV+E SL+  +  + VNQRDADL+HFW K+R APEGS+RK EA
Sbjct  138  DDLFQYMGTNPANDNYTFVEENSLRPHS--KVVNQRDADLVHFWTKYRKAPEGSSRKVEA  195

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEK  E LN++R  G PLVDDW CLK+ VR FE
Sbjct  196  QKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEALNTVRPAGQPLVDDWVCLKTLVRTFE  255

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGS+SQYGMKHMRS+AN+CNAGI +E+M EASAQAC SFPS SWSSL  GFSA
Sbjct  256  THCGSISQYGMKHMRSLANLCNAGIVKEQMAEASAQACVSFPSGSWSSLHKGFSA  310



>ref|XP_002324151.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
 gb|EEF02716.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPR-RAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            D++FLYMGTNPAN+NFTF+DE  L+   PR +AVNQRDADL+HFWDK+R APEGS+RK E
Sbjct  317  DNIFLYMGTNPANDNFTFMDENLLR---PRSKAVNQRDADLVHFWDKYRKAPEGSSRKVE  373

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQF EA+SHR H+D+SI L+GKLLFGIEK  EVLN+IR  G PLVDDW CLK+ VR F
Sbjct  374  AQKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEVLNAIRPAGQPLVDDWDCLKTLVRTF  433

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ETHCGS+SQYGMKHMRS+AN+CNAGI +E+M EASAQAC SFPS  WS+L  GFSA
Sbjct  434  ETHCGSVSQYGMKHMRSLANLCNAGIGKEQMAEASAQACVSFPSGPWSTLHKGFSA  489



>ref|XP_002516472.1| Vacuolar-processing enzyme precursor, putative [Ricinus communis]
 gb|EEF45813.1| Vacuolar-processing enzyme precursor, putative [Ricinus communis]
Length=492

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LFLYMGTNPAN+N+TFVDE SL  + P +AVNQRDADL+HFWDK+R AP+GSARK +A
Sbjct  320  ENLFLYMGTNPANDNYTFVDENSL--TPPSKAVNQRDADLVHFWDKYRKAPDGSARKDQA  377

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+S+ L+GKLLFG+EK  EVL+++R  G PLVDDW CLK  VR FE
Sbjct  378  QKQFVEAMSHRMHIDHSVKLIGKLLFGLEKASEVLSTVRPAGQPLVDDWDCLKKLVRTFE  437

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGS+SQYGMKHMRS+AN+CNAGI EE+M EASAQAC +FPS  WSSL  GFSA
Sbjct  438  THCGSISQYGMKHMRSLANLCNAGIREEQMAEASAQACITFPSGPWSSLHKGFSA  492



>ref|NP_001275777.1| vacuolar-processing enzyme precursor [Citrus sinensis]
 sp|P49043.1|VPE_CITSI RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Citrus sinensis]
 emb|CAA87720.1| cystein proteinase (by similarity) [Citrus sinensis]
 prf||2208463A vascular processing protease
Length=494

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF Y+GTNPAN+N+TFVDE SL+ ++  +AVNQRDADLLHFWDK+R APEG+ RK+EA
Sbjct  322  NNLFTYLGTNPANDNYTFVDENSLRPAS--KAVNQRDADLLHFWDKYRKAPEGTPRKAEA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEKGPE+LN++R  G PLVDDW CLKS VR FE
Sbjct  380  QKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG+LSQYGMKHMRS+ANICN GI +E+M EASAQAC + PS  WSSL  GFSA
Sbjct  440  SHCGALSQYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWSSLDKGFSA  494



>ref|XP_006450795.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|ESR64035.1| hypothetical protein CICLE_v10008097mg [Citrus clementina]
 gb|KDO80005.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=494

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF Y+GTNPAN+N+TFVDE SL+ ++  +AVNQRDADLLHFWDK+R APEG+ RK+EA
Sbjct  322  NNLFTYLGTNPANDNYTFVDENSLRPAS--KAVNQRDADLLHFWDKYRKAPEGTPRKAEA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEKGPE+LN++R  G PLVDDW CLKS VR FE
Sbjct  380  QKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG+LSQYGMKHMRS+ANICN GI +E+M EASAQAC + PS  WSSL  GFSA
Sbjct  440  SHCGALSQYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWSSLDKGFSA  494



>gb|KJB65602.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=488

 Score =   276 bits (706),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            DSLF Y+GTNPAN+NFTFVDE SL    P +AVNQRDADL+HFW K+R APEGS RK+EA
Sbjct  316  DSLFAYLGTNPANDNFTFVDENSL--VPPTKAVNQRDADLVHFWYKYRKAPEGSVRKTEA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+S+ L+GKLLFGIE+G EVLN++R  G PLVDDW CLK  VR FE
Sbjct  374  QKQFVEAMSHRMHIDHSVKLIGKLLFGIERGLEVLNTVRPAGQPLVDDWKCLKKMVRTFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQAC S P+  WSSL+ GFSA
Sbjct  434  THCGSLAQYGMKHMRSLANICNAGIQTEQMAEASAQACVSVPTGRWSSLQKGFSA  488



>emb|CAH59407.1| endopeptidase 1 [Plantago major]
Length=165

 Score =   265 bits (677),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -1

Query  738  PANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQKQFTEAISH  559
            PAN+NFTF  + SL+   P +AVNQRDADL+HFWDKFR APEGSARK+EAQKQ  EA++H
Sbjct  3    PANDNFTFAPDNSLR--PPSKAVNQRDADLVHFWDKFRKAPEGSARKAEAQKQLAEAMAH  60

Query  558  RTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETHCGSLSQYG  379
            RTH+DNSI L+GKLLFGIEKGPEVL  ++  G PLV DWSCLKS VR FETHCGSLSQYG
Sbjct  61   RTHIDNSIKLIGKLLFGIEKGPEVLKGVQPAGEPLVYDWSCLKSLVRTFETHCGSLSQYG  120

Query  378  MKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            MKHMRSIANICNAG+++E+M EASAQAC + PS SWSSL  GFSA
Sbjct  121  MKHMRSIANICNAGVTKEQMTEASAQACTTLPSNSWSSLHRGFSA  165



>gb|KEH39941.1| vacuolar processing enzyme [Medicago truncatula]
Length=493

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            LFLY+GTNPAN+N +FVDE SLKL +P  AVNQRDADL+HFWDKFR APEGS RK+EAQK
Sbjct  321  LFLYLGTNPANDNISFVDESSLKLRSPSTAVNQRDADLIHFWDKFRKAPEGSLRKNEAQK  380

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
            +  EA+SHR H+DNS+ L+GKLLFGIEKG E+L+++R  G PLVD+W CLK+ V+ FETH
Sbjct  381  EVLEAMSHRMHVDNSVKLIGKLLFGIEKGTELLDNVRPAGSPLVDNWDCLKTMVKTFETH  440

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            CGSLSQYGMKHMRS ANICNAGI  E+M EASAQAC S P+  WSSL+ GFSA
Sbjct  441  CGSLSQYGMKHMRSFANICNAGIQTEQMAEASAQACASIPANPWSSLQRGFSA  493



>ref|XP_011019532.1| PREDICTED: vacuolar-processing enzyme isoform X1 [Populus euphratica]
Length=493

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLYMGTNPAN+NFTFV++ SL+  +  +AVNQRDADL+HFW K+R APEGS RK EA
Sbjct  321  DDLFLYMGTNPANDNFTFVEDNSLRPHS--KAVNQRDADLVHFWAKYRKAPEGSTRKIEA  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEK  EVLN++R  G PLVDDW CLK+ VR FE
Sbjct  379  QKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEVLNTVRPAGQPLVDDWVCLKTLVRTFE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGS+SQYGMKHMRS+AN+CNAGI +E+M EASAQAC SFPS SWSSL  GFSA
Sbjct  439  THCGSISQYGMKHMRSLANLCNAGIVKEQMAEASAQACVSFPSGSWSSLHKGFSA  493



>gb|KJB06489.1| hypothetical protein B456_001G023700 [Gossypium raimondii]
Length=488

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = -1

Query  771  VDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            +D+LF Y+GTNPAN+NF F+DE SL    P +AVNQRDADL+HFWDK+R AP+GS RK E
Sbjct  315  MDNLFTYLGTNPANDNFKFIDENSLL--PPTKAVNQRDADLVHFWDKYRKAPDGSVRKVE  372

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQ  EA+SHR H+DNSI L+GKLLFG+E+GPEVLN++R TG PLVDDW CLK  VR F
Sbjct  373  AQKQVMEAMSHRMHVDNSIQLIGKLLFGVERGPEVLNTVRPTGQPLVDDWKCLKKMVRTF  432

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ETHCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQAC + PS  W S+  GFSA
Sbjct  433  ETHCGSLAQYGMKHMRSLANICNAGIETEKMGEASAQACVNIPSGHWGSVEKGFSA  488



>emb|CBI20614.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  N + L LYMGTNPAN+N+TFVD  SL+L  P +AVNQRDADL+HFWDKFR APEGS 
Sbjct  316  LGLNKEDLVLYMGTNPANDNYTFVDNNSLRL--PSKAVNQRDADLVHFWDKFRKAPEGSP  373

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK+EAQKQF EA+SHRTH+D++I LVG+LLFG++KG EVL ++R  G PLVDDW CLK+ 
Sbjct  374  RKAEAQKQFLEAMSHRTHIDHAIKLVGRLLFGMKKGSEVLKTVRPAGQPLVDDWHCLKTL  433

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE HCGSLSQYGMKHMRSIANICNAGI +E+M EASAQAC + P   WSSL  GFSA
Sbjct  434  VRTFEAHCGSLSQYGMKHMRSIANICNAGIEKEQMAEASAQACVTIPPGPWSSLDKGFSA  493



>gb|KJB06487.1| hypothetical protein B456_001G023700 [Gossypium raimondii]
Length=487

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = -1

Query  771  VDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            +D+LF Y+GTNPAN+NF F+DE SL    P +AVNQRDADL+HFWDK+R AP+GS RK E
Sbjct  314  MDNLFTYLGTNPANDNFKFIDENSLL--PPTKAVNQRDADLVHFWDKYRKAPDGSVRKVE  371

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQ  EA+SHR H+DNSI L+GKLLFG+E+GPEVLN++R TG PLVDDW CLK  VR F
Sbjct  372  AQKQVMEAMSHRMHVDNSIQLIGKLLFGVERGPEVLNTVRPTGQPLVDDWKCLKKMVRTF  431

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ETHCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQAC + PS  W S+  GFSA
Sbjct  432  ETHCGSLAQYGMKHMRSLANICNAGIETEKMGEASAQACVNIPSGHWGSVEKGFSA  487



>emb|CAN70603.1| hypothetical protein VITISV_040193 [Vitis vinifera]
Length=493

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  N + L LYMGTNPAN+N+TFVD  SL+L  P +AVNQRDADL+HFWDKFR APEGS 
Sbjct  316  LGLNKEDLVLYMGTNPANDNYTFVDNNSLRL--PSKAVNQRDADLVHFWDKFRKAPEGSP  373

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK+EAQKQF EA+SHRTH+D++I LVG+LLFG++KG EVL ++R  G PLVDDW CLK+ 
Sbjct  374  RKAEAQKQFLEAMSHRTHIDHAIKLVGRLLFGMKKGSEVLKTVRPAGQPLVDDWHCLKTL  433

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE HCGSLSQYGMKHMRSIANICNAGI +E+M EASAQAC + P   WSSL  GFSA
Sbjct  434  VRTFEAHCGSLSQYGMKHMRSIANICNAGIEKEQMAEASAQACVTIPPGPWSSLDKGFSA  493



>ref|XP_002276759.2| PREDICTED: vacuolar-processing enzyme [Vitis vinifera]
Length=526

 Score =   275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  N + L LYMGTNPAN+N+TFVD  SL+L  P +AVNQRDADL+HFWDKFR APEGS 
Sbjct  349  LGLNKEDLVLYMGTNPANDNYTFVDNNSLRL--PSKAVNQRDADLVHFWDKFRKAPEGSP  406

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK+EAQKQF EA+SHRTH+D++I LVG+LLFG++KG EVL ++R  G PLVDDW CLK+ 
Sbjct  407  RKAEAQKQFLEAMSHRTHIDHAIKLVGRLLFGMKKGSEVLKTVRPAGQPLVDDWHCLKTL  466

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE HCGSLSQYGMKHMRSIANICNAGI +E+M EASAQAC + P   WSSL  GFSA
Sbjct  467  VRTFEAHCGSLSQYGMKHMRSIANICNAGIEKEQMAEASAQACVTIPPGPWSSLDKGFSA  526



>ref|XP_010526156.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Tarenaya 
hassleriana]
Length=496

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L+LYMGTNPAN+NFTFV+E SLKL  P R  NQRDADL+HFWDK+R APEGS RK +A
Sbjct  324  DHLYLYMGTNPANDNFTFVEENSLKL--PSRVTNQRDADLVHFWDKYRKAPEGSVRKVQA  381

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK+  EA++HR H+DNS+ L+GKLLFG+ KGPEVL+ +R +G PLVDDW CLK+ VRAFE
Sbjct  382  QKEVLEAMAHRLHIDNSVKLIGKLLFGMIKGPEVLDHVRPSGQPLVDDWDCLKTMVRAFE  441

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYGMKHMRSIANICNAG+   +M +A+AQACP+ P+  WSSLR GFSA
Sbjct  442  RHCGSLSQYGMKHMRSIANICNAGVQVTQMEDAAAQACPTLPAGPWSSLRRGFSA  496



>ref|XP_010049168.1| PREDICTED: vacuolar-processing enzyme-like [Eucalyptus grandis]
 gb|KCW81642.1| hypothetical protein EUGRSUZ_C03004 [Eucalyptus grandis]
Length=488

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLYMGTNPAN+N +FVD+ SL+   P++AVNQRDADLLHFW KFR APEGS+RK EA
Sbjct  316  EDLFLYMGTNPANDNSSFVDDNSLR--PPQKAVNQRDADLLHFWHKFRKAPEGSSRKLEA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+S+ L+GKLLFGI+KGPEVLN++R  G PLVDDW+CL+S VR FE
Sbjct  374  QKQFFEAMSHRMHIDHSVKLIGKLLFGIKKGPEVLNAVRPAGQPLVDDWACLRSLVRTFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS ANICNAGI  E+M EAS QAC   PS  WSSL  GFSA
Sbjct  434  THCGSLSQYGMKHMRSFANICNAGIRTEQMTEASGQACAHIPSGPWSSLSRGFSA  488



>gb|ACJ84443.1| unknown [Medicago truncatula]
Length=493

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            LFLY+GTNPAN+N +FVDE SLKL +P  AVNQRDADL+HFWDKFR APEGS RK+EAQK
Sbjct  321  LFLYLGTNPANDNISFVDESSLKLRSPSTAVNQRDADLIHFWDKFRKAPEGSLRKNEAQK  380

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
            +  EA+SHR H+DNS  L+GKLLFGIEKG E+L ++R  G PLVD+W CLK+ V+ FETH
Sbjct  381  EVLEAMSHRMHVDNSAKLIGKLLFGIEKGTELLGNVRPAGSPLVDNWDCLKTMVKTFETH  440

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            CGSLSQYGMKHMRS ANICNAGI  E+M EASAQAC S P+  WSSL+ GFSA
Sbjct  441  CGSLSQYGMKHMRSFANICNAGIQTEQMAEASAQACASIPANPWSSLQRGFSA  493



>gb|KFK32531.1| hypothetical protein AALP_AA6G255400 [Arabis alpina]
Length=484

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -1

Query  774  NVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKS  595
            ++D L LYMGTNP NENFTFVDE  L+   P R  NQRDADL+HFWDK+R APEGSARK 
Sbjct  310  SIDKLVLYMGTNPDNENFTFVDENLLR--PPSRVTNQRDADLVHFWDKYRKAPEGSARKV  367

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQKQ  E +SHR H+DNSI L+GKLLFGI +GPEVLN +R +G PLVDDW CLK+ VRA
Sbjct  368  EAQKQVLEVMSHRLHVDNSIQLIGKLLFGISEGPEVLNKVRPSGKPLVDDWDCLKTLVRA  427

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            FE HCGSLSQYG+KHMRSIANICN GI  E M EA+ QACP+ P+  WSSL  GFSA
Sbjct  428  FERHCGSLSQYGIKHMRSIANICNVGIQMEEMEEAAMQACPTIPAGPWSSLHRGFSA  484



>ref|XP_009337146.1| PREDICTED: vacuolar-processing enzyme-like [Pyrus x bretschneideri]
Length=495

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPANENFTF+ + SL+ S+  +AVNQRDADL+HFW K+R APEGS RK +A
Sbjct  323  NNLFVYMGTNPANENFTFLGQNSLRPSS--KAVNQRDADLVHFWHKYRKAPEGSPRKVQA  380

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK+F EA+SHR H+D ++ L+GKLLFGIEKGPEVLN++R  G PLVDDW CLK+ VR+FE
Sbjct  381  QKEFVEAMSHRMHIDETMKLIGKLLFGIEKGPEVLNAVRPAGQPLVDDWDCLKTMVRSFE  440

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WSSL  GFSA
Sbjct  441  THCGSLSQYGMKHMRSLANICNAGMTKEQMAEASAQACVSVPSGRWSSLHMGFSA  495



>ref|XP_009361606.1| PREDICTED: vacuolar-processing enzyme-like [Pyrus x bretschneideri]
Length=494

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ E SL+ S+  +AVNQRDADLLHFW K+R APEGSARK +A
Sbjct  322  NNLFVYMGTNPANDNYTFLGENSLRPSS--KAVNQRDADLLHFWHKYRKAPEGSARKVQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR H+D ++ L+GKLLFGIEKGP+VLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKDFVEAMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WSSL  GFSA
Sbjct  440  THCGSLSQYGMKHMRSLANICNAGMTQEQMAEASAQACVSAPSSRWSSLHRGFSA  494



>gb|AGC94758.1| vacuolar processing enzyme [Malus hupehensis]
Length=494

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ E SL+ S+  +AVNQRDADLLHFW K+R APEGSARK +A
Sbjct  322  NNLFVYMGTNPANDNYTFLGENSLRPSS--KAVNQRDADLLHFWHKYRKAPEGSARKIQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR H+D ++ L+GKLLFGIEKGP+VLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKDFVEAMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WSSL  GFSA
Sbjct  440  THCGSLSQYGMKHMRSLANICNAGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>gb|AGC94759.1| vacuolar processing enzyme [Malus micromalus]
Length=494

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ E SL+ S+  +AVNQRDADLLHFW K+R APEGSARK +A
Sbjct  322  NNLFVYMGTNPANDNYTFLGENSLRPSS--KAVNQRDADLLHFWHKYRKAPEGSARKIQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR H+D ++ L+GKLLFGIEKGP+VLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKDFVEAMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WSSL  GFSA
Sbjct  440  THCGSLSQYGMKHMRSLANICNAGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>ref|XP_008393660.1| PREDICTED: vacuolar-processing enzyme [Malus domestica]
 ref|XP_008360960.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
Length=494

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ E SL+ S+  +AVNQRDADLLHFW K+R APEGSARK +A
Sbjct  322  NNLFVYMGTNPANDNYTFLGENSLRPSS--KAVNQRDADLLHFWHKYRKAPEGSARKIQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR H+D ++ L+GKLLFGIEKGP+VLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKDFVEAMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WSSL  GFSA
Sbjct  440  THCGSLSQYGMKHMRSLANICNAGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>ref|XP_006412409.1| hypothetical protein EUTSA_v10025034mg [Eutrema salsugineum]
 gb|ESQ53862.1| hypothetical protein EUTSA_v10025034mg [Eutrema salsugineum]
Length=488

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L LYMGTNPAN+NFTFVDE SL  + P R  NQRDADL+HFWDK+R APEGS RK+EA
Sbjct  316  DKLDLYMGTNPANDNFTFVDENSL--TPPSRVTNQRDADLVHFWDKYRKAPEGSTRKTEA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ LVGKLLFGI +GPEVLN +R+ G PLVDDW+CLK+ VRAFE
Sbjct  374  QKQVLEAMSHRLHVDNSVKLVGKLLFGISEGPEVLNKVRSAGQPLVDDWNCLKNLVRAFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRS ANICNAGI  E+M EAS+QAC + P   WSSL  GFSA
Sbjct  434  RHCGSLSQYGIKHMRSFANICNAGIQMEQMEEASSQACTTIPPGPWSSLHRGFSA  488



>ref|XP_010097094.1| Vacuolar-processing enzyme [Morus notabilis]
 gb|EXB66895.1| Vacuolar-processing enzyme [Morus notabilis]
Length=484

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 147/176 (84%), Gaps = 4/176 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPR-RAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            ++LFLY+GTNPAN+NFTFVDE SL+   PR +AVNQRDADL+HFW KFR APEGS RK +
Sbjct  312  NNLFLYLGTNPANDNFTFVDENSLR---PRTKAVNQRDADLVHFWVKFRKAPEGSPRKIK  368

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQK+F EA+SHR H+D+S+ L+GKLL GIEK PE+LN++R  GLPLVDDW CLK+ VR F
Sbjct  369  AQKEFVEAMSHRMHIDDSVKLIGKLLVGIEKAPELLNAVRPAGLPLVDDWDCLKTLVRTF  428

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ETHCGSLSQYGMKHMRS ANICNAGI  E+M EASAQAC + P   WSSL+ GFSA
Sbjct  429  ETHCGSLSQYGMKHMRSFANICNAGIRNEKMAEASAQACVNVPRSRWSSLQKGFSA  484



>gb|KHN37015.1| Vacuolar-processing enzyme [Glycine soja]
Length=474

 Score =   271 bits (692),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LF Y+GT+PAN+NFTFVDE SL   +P + VNQRDADL+HFWDKFR APEGS RK+ A
Sbjct  302  DVLFHYLGTDPANDNFTFVDENSLW--SPSKPVNQRDADLIHFWDKFRKAPEGSLRKNAA  359

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ L+GKLLFGIEKGPEVLN++R  G  LVDDW CLK+ VR FE
Sbjct  360  QKQVLEAMSHRMHVDNSVKLIGKLLFGIEKGPEVLNAVRPAGSALVDDWHCLKTMVRTFE  419

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS ANICN GI  E+M EASAQAC S PS  WSSL+ GFSA
Sbjct  420  THCGSLSQYGMKHMRSFANICNVGIKNEQMAEASAQACVSIPSNPWSSLQRGFSA  474



>gb|ACQ91103.1| vacuolar processing enzyme a [Populus tomentosa]
Length=493

 Score =   271 bits (693),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LF YMGTNPAN+NFTF+++ SL+   P +AVNQRDADL+HFW K+R APEGS+RK EA
Sbjct  321  EDLFQYMGTNPANDNFTFLEDNSLR--PPSKAVNQRDADLVHFWAKYRKAPEGSSRKVEA  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEK  EVLN++R  G PLVDDW CLK+ VR FE
Sbjct  379  QKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEVLNNVRPAGQPLVDDWVCLKTLVRTFE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGS+SQYGMKHMRS+AN+CNAGI +E+M EASAQAC S PS SWSSL  GFSA
Sbjct  439  THCGSISQYGMKHMRSLANLCNAGIVKEQMAEASAQACVSIPSGSWSSLHKGFSA  493



>ref|XP_010526069.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Tarenaya 
hassleriana]
Length=498

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLYMGTNPAN+NFTF+DE SL L  P R  NQRDADL+HFWDK+R APEGS RK ++
Sbjct  326  DQLFLYMGTNPANDNFTFMDENSLTL--PSRVTNQRDADLVHFWDKYRKAPEGSVRKVQS  383

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  E +SHR H+DNSI L+GKLLFGIEKGPEVL+ +R  G P+VDDWSCLK+ VRA+E
Sbjct  384  QKQVIEVMSHRMHVDNSIKLIGKLLFGIEKGPEVLDHVRPAGQPVVDDWSCLKAMVRAYE  443

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYGMK MRSIANICNAG+  ++M +A++QACP  PS  WSSL  GFSA
Sbjct  444  KHCGSLSQYGMKQMRSIANICNAGVHVDQMDDAASQACPMVPSGPWSSLHRGFSA  498



>ref|NP_001236564.1| vacuolar processing enzyme 2 precursor [Glycine max]
 gb|AAL58570.1| vacuolar processing enzyme 2 [Glycine max]
Length=482

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LF Y+GT+PAN+NFTFVDE SL   +P + VNQRDADL+HFWDKFR APEGS RK+ A
Sbjct  310  DVLFHYLGTDPANDNFTFVDENSLW--SPSKPVNQRDADLIHFWDKFRKAPEGSLRKNTA  367

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ L+GKLLFGIEKGPEVLN++R  G  LVDDW CLK+ VR FE
Sbjct  368  QKQVLEAMSHRMHVDNSVKLIGKLLFGIEKGPEVLNAVRPAGSALVDDWHCLKTMVRTFE  427

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS ANICN GI  E+M EASAQAC S PS  WSSL+ GFSA
Sbjct  428  THCGSLSQYGMKHMRSFANICNVGIKNEQMAEASAQACVSIPSNPWSSLQRGFSA  482



>ref|XP_002308580.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
 gb|EEE92103.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
Length=493

 Score =   271 bits (692),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LF YMGTNPAN+N+TFV+E SL+  +  + VNQRDADL+HFW K+R APEGS+RK EA
Sbjct  321  DDLFQYMGTNPANDNYTFVEENSLRPHS--KVVNQRDADLVHFWTKYRKAPEGSSRKVEA  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+SI L+GKLLFGIEK  E LN++R  G PLVDDW CLK+ VR FE
Sbjct  379  QKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEALNTVRPAGQPLVDDWVCLKTLVRTFE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGS+SQYGMKHMRS+AN+CNAGI +E+M EASAQAC SFPS SWSSL  GFSA
Sbjct  439  THCGSISQYGMKHMRSLANLCNAGIVKEQMAEASAQACVSFPSGSWSSLHKGFSA  493



>ref|XP_003550283.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
Length=481

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LF Y+GT+PAN+NFTFVDE SL   +P + VNQRDADL+HFWDKFR APEGS RK+ A
Sbjct  309  DVLFHYLGTDPANDNFTFVDENSLW--SPSKPVNQRDADLIHFWDKFRKAPEGSLRKNAA  366

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ L+GKLLFGIEKGPEVLN++R  G  LVDDW CLK+ VR FE
Sbjct  367  QKQVLEAMSHRMHVDNSVKLIGKLLFGIEKGPEVLNAVRPAGSALVDDWHCLKTMVRTFE  426

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS ANICN GI  E+M EASAQAC S PS  WSSL+ GFSA
Sbjct  427  THCGSLSQYGMKHMRSFANICNVGIKNEQMAEASAQACVSIPSNPWSSLQRGFSA  481



>gb|AGC94756.1| vacuolar processing enzyme [Malus sieversii]
Length=494

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ E SL+ S+  +AVNQRDADLLHFW K+R APEGSARK +A
Sbjct  322  NNLFVYMGTNPANDNYTFLGENSLRPSS--KAVNQRDADLLHFWHKYRKAPEGSARKIQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F E +SHR H+D ++ L+GKLLFGIEKGP+VLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKDFVEVMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WSSL  GFSA
Sbjct  440  THCGSLSQYGMKHMRSLANICNAGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>gb|KHG30636.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=488

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 143/176 (81%), Gaps = 2/176 (1%)
 Frame = -1

Query  771  VDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            +D+LF Y+GTNPAN+NF  VDE SL    P +AVNQRDADL+HFWDK+R AP+GS RK E
Sbjct  315  MDNLFTYLGTNPANDNFKSVDENSLL--PPTKAVNQRDADLVHFWDKYRKAPDGSVRKVE  372

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQ  EA+SHR H+DNSI L+GKLLFG+E+GPEVLN++R TG PLVDDW CLK  VR F
Sbjct  373  AQKQVMEAMSHRMHVDNSIQLIGKLLFGVERGPEVLNTVRPTGQPLVDDWKCLKKMVRTF  432

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ETHCGSL+QYGMKHMRS+ANICNAGI  E+M E SAQAC + PS  W S+  GFSA
Sbjct  433  ETHCGSLAQYGMKHMRSLANICNAGIETEKMGEVSAQACVNIPSGHWGSVEKGFSA  488



>gb|EYU20379.1| hypothetical protein MIMGU_mgv1a005412mg [Erythranthe guttata]
Length=484

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 149/180 (83%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            ++ N +SLF Y+GT+PAN+N TFVDE S   S+  + VNQRDADLLHFW KFR APEGS 
Sbjct  307  VKLNAESLFTYLGTDPANDNLTFVDENSPLPSS--KPVNQRDADLLHFWHKFRRAPEGSD  364

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK  AQKQ +EA++HRTH+D+SI L+GKLLFGI+KGP++L ++R +G PLVDDW CLKS 
Sbjct  365  RKFAAQKQLSEAMAHRTHVDSSIKLIGKLLFGIDKGPQMLKAMRPSGQPLVDDWDCLKSL  424

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMRSIANICNAG++ E+M EAS QAC SFPS SWSSL  GFSA
Sbjct  425  VRTFETHCGSLSQYGMKHMRSIANICNAGVTREQMAEASGQACTSFPSNSWSSLHRGFSA  484



>ref|XP_010669172.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
 emb|CAC43295.1| putative vacuolar processing enzyme [Beta vulgaris]
Length=486

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = -1

Query  780  EQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSAR  601
            E   D L+LYMGTNP NEN+T+VD+ SL  ++   AVNQRDADL+HFW+KFR A EGS R
Sbjct  309  ELTQDMLYLYMGTNPNNENYTYVDDNSLHPTS-SNAVNQRDADLIHFWNKFRKASEGSQR  367

Query  600  KSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFV  421
            K  AQKQF E +SHR HLD+SI L+GKLLFGIEKG  VL ++R TG PLVDDW+CLK+ V
Sbjct  368  KINAQKQFMEVMSHRVHLDDSIKLIGKLLFGIEKGLGVLQTVRPTGQPLVDDWNCLKTLV  427

Query  420  RAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            R FE HCGSLSQYGMKHMRSIANICNAGI+  +M EASAQACPSFPS  WSSL  GFSA
Sbjct  428  RTFEKHCGSLSQYGMKHMRSIANICNAGITTNQMAEASAQACPSFPSGPWSSLHRGFSA  486



>ref|XP_010447316.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme [Camelina 
sativa]
Length=491

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 142/177 (80%), Gaps = 2/177 (1%)
 Frame = -1

Query  774  NVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKS  595
            N D L LYMGTNPANENFTFVD  SLK   P R  NQRDADL+HFW+K+R APEGSARK+
Sbjct  317  NKDLLDLYMGTNPANENFTFVDTNSLK--PPSRVTNQRDADLVHFWEKYRKAPEGSARKT  374

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQKQ  E +SHR H+DNS+ LVGK+LFGI  GP VLN +R+ G PLVDDWSCLK+ VRA
Sbjct  375  EAQKQLLEVMSHRLHVDNSVMLVGKILFGISDGPIVLNKVRSAGKPLVDDWSCLKNMVRA  434

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            FE HCGSLSQYGMKHMRS ANICNAGI  E+M EA++QAC + P   WSSLR GFSA
Sbjct  435  FERHCGSLSQYGMKHMRSFANICNAGIQMEQMEEAASQACTTIPPGPWSSLRRGFSA  491



>ref|XP_010417372.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme [Camelina 
sativa]
Length=484

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L LYMGTNPANENFTFVDE +  L  P R  NQRDADL+HFWDK+R APEGSARK EA
Sbjct  312  EKLVLYMGTNPANENFTFVDENA-SLRPPSRVTNQRDADLVHFWDKYRKAPEGSARKVEA  370

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ L+GKLLFG+E GPE+LN +R +G PLVDDW CLKS VRAFE
Sbjct  371  QKQVIEAMSHRLHVDNSVLLIGKLLFGLE-GPEILNKVRPSGKPLVDDWDCLKSMVRAFE  429

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRSIANICNAGI   +M EA+ QACPS P+  WSSL  GFSA
Sbjct  430  RHCGSLSQYGIKHMRSIANICNAGIQMTQMEEAAMQACPSIPAGPWSSLHRGFSA  484



>ref|XP_010429611.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like isoform 
X2 [Camelina sativa]
Length=479

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L LYMGTNPANENFTFVDE +L L  P R  NQRDADL+HFWDK+R APEGSARK EA
Sbjct  307  EKLVLYMGTNPANENFTFVDE-NLLLRPPSRVTNQRDADLVHFWDKYRKAPEGSARKVEA  365

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ L+GKLLFG+E GPE+LN +R  G PLVDDW CLKS VRAFE
Sbjct  366  QKQVIEAMSHRLHVDNSVLLIGKLLFGLE-GPEILNKVRTYGKPLVDDWDCLKSMVRAFE  424

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRSIANICNAGI   +M EA+ QACPS P+  WSSL  GFSA
Sbjct  425  RHCGSLSQYGIKHMRSIANICNAGIQMVQMEEAAMQACPSIPAGPWSSLHRGFSA  479



>ref|XP_010429610.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like isoform 
X1 [Camelina sativa]
Length=484

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L LYMGTNPANENFTFVDE +L L  P R  NQRDADL+HFWDK+R APEGSARK EA
Sbjct  312  EKLVLYMGTNPANENFTFVDE-NLLLRPPSRVTNQRDADLVHFWDKYRKAPEGSARKVEA  370

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ L+GKLLFG+E GPE+LN +R  G PLVDDW CLKS VRAFE
Sbjct  371  QKQVIEAMSHRLHVDNSVLLIGKLLFGLE-GPEILNKVRTYGKPLVDDWDCLKSMVRAFE  429

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRSIANICNAGI   +M EA+ QACPS P+  WSSL  GFSA
Sbjct  430  RHCGSLSQYGIKHMRSIANICNAGIQMVQMEEAAMQACPSIPAGPWSSLHRGFSA  484



>gb|ACR24644.1| vacuolar processing enzyme [Malus hupehensis var. mengshanensis]
Length=494

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ E SL+ S+  +AVNQRDADLL FW K+R APEGSARK +A
Sbjct  322  NNLFVYMGTNPANDNYTFLGENSLRPSS--KAVNQRDADLLRFWHKYRKAPEGSARKIQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR H+D ++ L+GKLLFGIEKGP+VLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKDFVEAMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WSSL  GFSA
Sbjct  440  THCGSLSQYGMKHMRSLANICNAGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA  494



>gb|AGC94757.1| vacuolar processing enzyme [Malus sikkimensis]
Length=494

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N TF+ E SL+ S+  +AVNQRDADLLHFW K+R APEGSARK +A
Sbjct  322  NNLFVYMGTNPANDNHTFLGENSLRPSS--KAVNQRDADLLHFWHKYRKAPEGSARKIQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR H+D ++ L+GKLLFGIEKGP+VLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKDFVEAMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++++M EASAQAC S PS  WSSL  GFSA
Sbjct  440  THCGSLSQYGMKHMRSLANICNAGMTQDQMAEASAQACVSAPSGRWSSLHRGFSA  494



>gb|KHG13131.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=488

 Score =   268 bits (686),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            DSLF Y+GTNPAN+NFTFVDE SL    P +AVNQRDADL+HFW K+R APEGS RK+EA
Sbjct  316  DSLFAYLGTNPANDNFTFVDENSL--VPPTKAVNQRDADLVHFWYKYRKAPEGSVRKTEA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+S R H+D+S+ L+GKLLFGIE+G EVLN++R  G PLVDDW CLK  VR FE
Sbjct  374  QKQFVEAMSLRMHIDHSVKLIGKLLFGIERGSEVLNTVRPAGQPLVDDWKCLKKVVRTFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMRS+ANICNA I  E+M EASAQAC S P+  WSSL+ GFSA
Sbjct  434  THCGSLAQYGMKHMRSLANICNARIQTEQMAEASAQACVSVPTGRWSSLQKGFSA  488



>ref|XP_004501477.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=488

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            +SLFLY+GTNPANENFTFV   SL    P +AVNQRDADL+HFWDKFR AP+GS RK+ A
Sbjct  316  NSLFLYLGTNPANENFTFVGRNSL--VPPSKAVNQRDADLVHFWDKFRKAPQGSPRKAAA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            +KQ  EA+SHR H+D+SI LVGKLLFG+EKGPEVL S+R  G PL DDW+CLK+ VR FE
Sbjct  374  EKQVLEAMSHRMHIDDSIKLVGKLLFGMEKGPEVLTSVRPAGQPLADDWNCLKTLVRTFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            T+CGSLSQYGMKHMRS AN CNAGI +E+M EASAQAC + P+  WSSLR GFSA
Sbjct  434  TYCGSLSQYGMKHMRSFANFCNAGIHKEQMAEASAQACVNVPANPWSSLRSGFSA  488



>ref|XP_007222246.1| hypothetical protein PRUPE_ppa004713mg [Prunus persica]
 gb|EMJ23445.1| hypothetical protein PRUPE_ppa004713mg [Prunus persica]
Length=494

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ E SL+ S   +AVNQRDADL+HFW K+R APEGS RK +A
Sbjct  322  ENLFVYMGTNPANDNYTFLGENSLRPST--KAVNQRDADLVHFWHKYRKAPEGSPRKIQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR H+D ++ L+GKLLFGI+KGPEVLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKDFVEAMSHRMHMDQTMKLIGKLLFGIKKGPEVLNTVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            T+CGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WSSL  GFSA
Sbjct  440  TYCGSLSQYGMKHMRSLANICNAGMTKEQMTEASAQACTSVPSSRWSSLHRGFSA  494



>ref|XP_009607675.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
Length=484

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L LYMGTNPAN+N+TF+DE S  LSA  + VNQRDADLLHFWDKF  AP+GS RK EA
Sbjct  312  DPLSLYMGTNPANDNYTFLDENSSLLSA--KPVNQRDADLLHFWDKFLKAPQGSVRKVEA  369

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ +EA+SHR H+D+SI LVG+LLFGIEKGP+VL  +R TG PLVDDW+CLKSFVR FE
Sbjct  370  QKQLSEAMSHRMHIDDSIVLVGRLLFGIEKGPDVLIRVRPTGEPLVDDWNCLKSFVRTFE  429

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            T CGSLSQYGMKHMR++ANICN+GI+ E++ + SAQAC S PS SWSSL  GFSA
Sbjct  430  TRCGSLSQYGMKHMRAVANICNSGITMEQIAKVSAQACVSIPSNSWSSLDEGFSA  484



>ref|XP_002867219.1| GAMMA-VPE [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43478.1| GAMMA-VPE [Arabidopsis lyrata subsp. lyrata]
Length=494

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D+L LYMGTNPAN+NFTF D  SLK   P R  NQRDADL+HFW+K+R APEGSARK+EA
Sbjct  322  DNLDLYMGTNPANDNFTFADANSLK--PPSRVTNQRDADLVHFWEKYRKAPEGSARKTEA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ LVGK+LFGI +GPEVLN +R+ G PLVDDW+CLK+ VRAFE
Sbjct  380  QKQVLEAMSHRLHVDNSVILVGKILFGISEGPEVLNKVRSAGQPLVDDWNCLKNLVRAFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRS ANICNAGI  E+M EA++QAC S P   WSSL  GFSA
Sbjct  440  RHCGSLSQYGIKHMRSFANICNAGIRTEQMEEAASQACTSIPPGPWSSLHRGFSA  494



>ref|NP_195020.1| vacuolar-processing enzyme gamma [Arabidopsis thaliana]
 sp|Q39119.2|VPEG_ARATH RecName: Full=Vacuolar-processing enzyme gamma-isozyme; AltName: 
Full=Asparaginyl endopeptidase gamma-VPE; AltName: Full=Gamma-VPE; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK43975.1|AF370160_1 putative vacuolar processing enzyme gamma-VPE [Arabidopsis thaliana]
 gb|AAL11612.1|AF424619_1 AT4g32940/F26P21_60 [Arabidopsis thaliana]
 emb|CAA21203.1| gamma-VPE (vacuolar processing enzyme) [Arabidopsis thaliana]
 emb|CAB80011.1| gamma-VPE (vacuolar processing enzyme) [Arabidopsis thaliana]
 gb|AAL15210.1| putative vacuolar processing enzyme gamma-VPE [Arabidopsis thaliana]
 gb|AAM91361.1| At4g32940/F26P21_60 [Arabidopsis thaliana]
 gb|AEE86150.1| vacuolar-processing enzyme gamma [Arabidopsis thaliana]
Length=494

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D+L LYMGTNPAN+NFTF D  SLK   P R  NQRDADL+HFW+K+R APEGSARK+EA
Sbjct  322  DNLDLYMGTNPANDNFTFADANSLK--PPSRVTNQRDADLVHFWEKYRKAPEGSARKTEA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ LVGK+LFGI +GPEVLN +R+ G PLVDDW+CLK+ VRAFE
Sbjct  380  QKQVLEAMSHRLHIDNSVILVGKILFGISRGPEVLNKVRSAGQPLVDDWNCLKNQVRAFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRS ANICNAGI  E+M EA++QAC + P+  WSSL  GFSA
Sbjct  440  RHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQACTTLPTGPWSSLNRGFSA  494



>dbj|BAA18924.1| gamma-VPE [Arabidopsis thaliana]
Length=490

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D+L LYMGTNPAN+NFTF D  SLK   P R  NQRDADL+HFW+K+R APEGSARK+EA
Sbjct  318  DNLDLYMGTNPANDNFTFADANSLK--PPSRVTNQRDADLVHFWEKYRKAPEGSARKTEA  375

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ LVGK+LFGI +GPEVLN +R+ G PLVDDW+CLK+ VRAFE
Sbjct  376  QKQVLEAMSHRLHIDNSVILVGKILFGISRGPEVLNKVRSAGQPLVDDWNCLKNQVRAFE  435

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRS ANICNAGI  E+M EA++QAC + P+  WSSL  GFSA
Sbjct  436  RHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQACTTLPTGPWSSLNRGFSA  490



>ref|XP_006296251.1| hypothetical protein CARUB_v10025418mg [Capsella rubella]
 gb|EOA29149.1| hypothetical protein CARUB_v10025418mg [Capsella rubella]
Length=481

 Score =   265 bits (678),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L LYMGTNPANENFTFVDE S  L  P R  NQRDADL+HFWDK+R APEGSARK EA
Sbjct  309  EKLVLYMGTNPANENFTFVDENS-SLRLPSRVTNQRDADLVHFWDKYRKAPEGSARKVEA  367

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ L+GKLLFG+E GP VLN +R +G PLVDDW CLKS VRAFE
Sbjct  368  QKQVLEAMSHRLHVDNSVLLIGKLLFGLE-GPAVLNKVRPSGRPLVDDWDCLKSMVRAFE  426

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRSIANICNAGI    M EA+ QACPS P+  WSSL  GFSA
Sbjct  427  RHCGSLSQYGIKHMRSIANICNAGIQMGLMEEAAKQACPSIPAGPWSSLHRGFSA  481



>ref|XP_010432633.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Camelina 
sativa]
Length=492

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 140/175 (80%), Gaps = 1/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L LYMGTNPANENFTFVD  SLK   P R  NQRDADL+HFW+K+R APEGSARK+EA
Sbjct  319  DLLDLYMGTNPANENFTFVDANSLK-PPPSRVTNQRDADLVHFWEKYRKAPEGSARKTEA  377

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ  E +SHR H+DNS+ LVGK+LFGI  GP VLN +R+ G PLVDDW+CLK+ VRAFE
Sbjct  378  HKQLLEVMSHRLHVDNSVMLVGKILFGISDGPIVLNKVRSAGQPLVDDWNCLKNMVRAFE  437

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYGMKHMRS ANICNAGI  E+M EA++QAC + P   WSSLR GFSA
Sbjct  438  RHCGSLSQYGMKHMRSFANICNAGIQMEQMEEAASQACTTIPPGPWSSLRRGFSA  492



>dbj|BAC54829.1| vacuolar processing enzyme-2 [Nicotiana tabacum]
Length=484

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L LYMGTNPAN+N+TF+DE S  LSA  + VNQRDADLLHFWDKF  AP+GS RK EA
Sbjct  312  DPLSLYMGTNPANDNYTFLDENSSLLSA--KPVNQRDADLLHFWDKFLKAPQGSVRKVEA  369

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ +EA+SHR H+D+SI+LVG+LLFGIEKGP+VL  +R TG PLVDDW+CLKSFVR FE
Sbjct  370  QKQLSEAMSHRMHIDDSIALVGRLLFGIEKGPDVLIRVRPTGEPLVDDWNCLKSFVRTFE  429

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            T CGSLSQYGMKHMR++ANICN+ I+ E++ +ASAQAC S PS SWSSL  GFSA
Sbjct  430  TRCGSLSQYGMKHMRAVANICNSCITMEQIAKASAQACVSIPSNSWSSLDEGFSA  484



>ref|XP_003603121.1| Vacuolar processing enzyme [Medicago truncatula]
 gb|AES73372.1| vacuolar processing enzyme [Medicago truncatula]
Length=484

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            DSLFLY+G+NPANENFTF+   SL    P + VNQRDADL+HFWDKFR AP+GS RK  A
Sbjct  312  DSLFLYLGSNPANENFTFMGRNSL--VPPSKTVNQRDADLIHFWDKFRKAPQGSPRKVAA  369

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+D SI LVGKLLFG++KGPEVL S+R  G P+VDDW CLKS VR FE
Sbjct  370  QKQVLEAMSHRMHIDESIKLVGKLLFGMKKGPEVLASVRPAGQPVVDDWDCLKSLVRTFE  429

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            T+CGSLSQYGMKHMRS AN CNAGI  E+M EASAQAC + P+  WSSL GGFSA
Sbjct  430  TYCGSLSQYGMKHMRSFANFCNAGIHSEQMAEASAQACINIPANPWSSLHGGFSA  484



>ref|XP_010472621.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like [Camelina 
sativa]
Length=485

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L LYMGTNPANENFTFVDE +L L  P R  NQRDADL+HFWDK+R APEGSARK EA
Sbjct  313  EKLVLYMGTNPANENFTFVDE-NLLLRPPSRVTNQRDADLVHFWDKYRKAPEGSARKVEA  371

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ L+GKLLFG+E GP +LN +R +G PLVDDW  LKS VRAFE
Sbjct  372  QKQVIEAMSHRLHVDNSVLLIGKLLFGLE-GPAILNKVRPSGKPLVDDWDLLKSMVRAFE  430

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRSIANICNAGI   +M EA+ QACPS P+  WSSL  GFSA
Sbjct  431  RHCGSLSQYGIKHMRSIANICNAGIQMTQMEEAAMQACPSIPAGPWSSLHRGFSA  485



>ref|XP_004291017.1| PREDICTED: vacuolar-processing enzyme [Fragaria vesca subsp. 
vesca]
Length=494

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ +  L+ S+  +AVNQRDADL+HFW K+R APEGSARK++A
Sbjct  321  NNLFMYMGTNPANDNYTFMPQNFLRPSS-SKAVNQRDADLVHFWHKYRKAPEGSARKAQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK+F EA+SHR H+D S+ L+GKLLFGI+KGPEVL+++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKEFLEAMSHRMHIDESVKLIGKLLFGIKKGPEVLSAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            T+CGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC + PS  WSSL  GFSA
Sbjct  440  TYCGSLSQYGMKHMRSLANICNAGMTKEQMAEASAQACVNVPSGRWSSLHRGFSA  494



>ref|XP_006408834.1| hypothetical protein EUTSA_v10001970mg [Eutrema salsugineum]
 gb|ESQ50287.1| hypothetical protein EUTSA_v10001970mg [Eutrema salsugineum]
Length=490

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 141/173 (82%), Gaps = 2/173 (1%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            L LYMGTNP NEN+TFVD+ SL+   P R  NQRDADL+HFWDK++ APEGSARK+EAQK
Sbjct  320  LVLYMGTNPDNENYTFVDKNSLR--PPSRVTNQRDADLVHFWDKYQKAPEGSARKAEAQK  377

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
            Q  EA+SHR H+DNS  ++GKLLFGI +GP VLN +R +G PLVDDW CLK+ VRA+E H
Sbjct  378  QVLEAMSHRLHIDNSFLMIGKLLFGISEGPLVLNKVRPSGKPLVDDWDCLKTLVRAYERH  437

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            CGSLSQYG+KHMRSIANICNAGI  E+M EA+ QACP+ P+  WSSL  GFSA
Sbjct  438  CGSLSQYGIKHMRSIANICNAGIQVEQMEEAAMQACPTIPAGPWSSLHRGFSA  490



>sp|P49044.1|VPE_VICSA RecName: Full=Vacuolar-processing enzyme; Short=VPE; AltName: 
Full=Proteinase B; Flags: Precursor [Vicia sativa]
 emb|CAA84383.1| cysteine proteinase [Vicia sativa]
Length=493

 Score =   263 bits (673),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDE--KSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKS  595
            + L+ Y+GTNPAN+N +FVDE   SLKL  P  AVNQRDADL+HFW+KFR APEGS++K+
Sbjct  317  NDLYQYLGTNPANDNNSFVDETENSLKLRTPSAAVNQRDADLIHFWEKFRKAPEGSSQKN  376

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EA+KQ  EA+SHR H+DNS+ L+G+LLFGIEKG E+L+ +R  G PLVD+W CLK+ V+ 
Sbjct  377  EAEKQVLEAMSHRKHIDNSVKLIGQLLFGIEKGTELLDVVRPAGSPLVDNWDCLKTMVKT  436

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            FETHCGSLSQYGMKHMRS ANICNAGI  E M EASAQAC S P+  WSSL+GGFSA
Sbjct  437  FETHCGSLSQYGMKHMRSFANICNAGIPNEPMAEASAQACASIPANPWSSLQGGFSA  493



>ref|XP_002880728.1| alpha-vacuolar processing enzyme [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56987.1| alpha-vacuolar processing enzyme [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 141/175 (81%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L LYMGTNPANENFTFV+E SL+   P R  NQRDADL+HFWDK+R APEGSARK EA
Sbjct  308  EKLVLYMGTNPANENFTFVNENSLR--PPSRVTNQRDADLVHFWDKYRKAPEGSARKVEA  365

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNSI L+GKLLFG++  P VLN++R +G PLVDDW CLKS VR FE
Sbjct  366  QKQVLEAMSHRLHVDNSILLIGKLLFGLDS-PAVLNNVRPSGTPLVDDWDCLKSLVRVFE  424

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRSIANICNAGI   +M EA+ QACP+ P+  WSSL  GFSA
Sbjct  425  MHCGSLSQYGIKHMRSIANICNAGIQMGQMEEAAMQACPTIPASPWSSLERGFSA  479



>ref|XP_003525979.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
 gb|KHN32223.1| Vacuolar-processing enzyme [Glycine soja]
Length=484

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 145/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++L LY+GTNPAN+NFTFV + SL    P +AVNQRDADL+HFWDKFR AP GS+RK+ A
Sbjct  312  NNLVLYLGTNPANDNFTFVHKNSL--VPPSKAVNQRDADLIHFWDKFRKAPVGSSRKAAA  369

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            +K+  EA+SHR H+D+++ L+GKLLFGIEKGPE+L+S+R  G PLVDDW CLK+ VR FE
Sbjct  370  EKEILEAMSHRMHIDDNMKLIGKLLFGIEKGPELLSSVRPAGQPLVDDWDCLKTLVRTFE  429

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS AN CNAGI +E+M EASAQAC S P+ SWSSL  GFSA
Sbjct  430  THCGSLSQYGMKHMRSFANFCNAGIRKEQMAEASAQACVSIPASSWSSLHRGFSA  484



>emb|CDX68923.1| BnaC01g05300D [Brassica napus]
Length=487

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -1

Query  774  NVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKS  595
            N D L LYMGTNPAN+NFTFVD  SL  + P    NQRDADL+HFWDK+R APEGS RK+
Sbjct  313  NKDKLDLYMGTNPANDNFTFVDANSL--TPPSGVTNQRDADLVHFWDKYRKAPEGSTRKT  370

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQKQ  EA+SHR H+DNS+ LVGKLLFGI +G EVLN +R  G PL DDW+CLK+ VRA
Sbjct  371  EAQKQVLEAMSHRLHVDNSVKLVGKLLFGISEGSEVLNKVRPAGQPLADDWTCLKNTVRA  430

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            FE HCGSLSQYG+KHMRS ANICNAGI  E+M EA++QAC S PS  WSSL  GFSA
Sbjct  431  FERHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQACTSIPSGPWSSLHRGFSA  487



>ref|XP_010437829.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Camelina 
sativa]
Length=491

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L LYMGTNPANENFTFVD  SLK   P R  NQRDADL+HFW+K+R APEGSARK+EA
Sbjct  319  DLLDLYMGTNPANENFTFVDANSLK--PPSRVTNQRDADLVHFWEKYRKAPEGSARKTEA  376

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ  E +SHR H+DNS+ LVGK+LFGI  GP VLN +R+ G PLVDDW+CLK+ VRAFE
Sbjct  377  HKQLLEVMSHRLHVDNSVMLVGKILFGISDGPIVLNKVRSAGKPLVDDWNCLKNMVRAFE  436

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYGMKHMRS ANICNAGI  E+M EA++QAC + P   WSSL  GFSA
Sbjct  437  RHCGSLSQYGMKHMRSFANICNAGIQMEQMEEAASQACTTIPPGPWSSLHRGFSA  491



>gb|KFK29905.1| hypothetical protein AALP_AA7G193600 [Arabis alpina]
Length=488

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++L +YMGTNPAN+NFTFVD  SL    P R  NQRDADL+HFWDK+R APEGS RK+EA
Sbjct  316  NNLDIYMGTNPANDNFTFVDANSLM--PPSRVTNQRDADLVHFWDKYRKAPEGSTRKTEA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ LVGKLLFGI +G EVLN +R+ G PLVDDW CLK+ VRAFE
Sbjct  374  QKQVLEAMSHRLHVDNSVKLVGKLLFGISEGSEVLNKVRSAGQPLVDDWKCLKNMVRAFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRS ANICNAGI  E+M EA++QAC + PS  WSSL  GFSA
Sbjct  434  RHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQACTTIPSGHWSSLHRGFSA  488



>gb|AAK15049.1|AF238384_1 asparaginyl endopeptidase [Vigna radiata]
Length=483

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            +E + D+LFLY+GT+PAN+N TFVDE SL  S+   AVNQRDADL+HFW KFR APEGS 
Sbjct  306  VEFSKDTLFLYLGTDPANDNLTFVDENSLWSSS--TAVNQRDADLVHFWHKFRKAPEGSP  363

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K+EA+KQ  E +SHR H+D+S+ LVGKLLFG EK PEVLN++R  G  LVDDW+CLK+ 
Sbjct  364  KKNEARKQVLEVMSHRMHIDDSVKLVGKLLFGFEKAPEVLNAVRPAGSALVDDWACLKTM  423

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMRS ANICN GI +E+M EASAQAC + P+ SWSSL+ GFSA
Sbjct  424  VRTFETHCGSLSQYGMKHMRSFANICNVGIKKEQMAEASAQACVTVPASSWSSLQRGFSA  483



>gb|AEO79971.1| vacuolar processing enzyme [Arachis diogoi]
Length=487

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 141/173 (82%), Gaps = 2/173 (1%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            LF Y+GTNPAN+N+TFVDE SL+   P +AVNQRDADL+HFW+KFR APEGS+ K  AQK
Sbjct  317  LFQYLGTNPANDNYTFVDENSLR--TPSKAVNQRDADLIHFWEKFRKAPEGSSSKITAQK  374

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
            Q  E +SHR H+DNS+ L+G LLFG EKGPE+L+++R  G PLVDDW CLK+ VR FETH
Sbjct  375  QVVEVMSHRMHIDNSVKLIGNLLFGTEKGPELLSAVRPAGKPLVDDWDCLKNMVRTFETH  434

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            CGSLSQYGMKHMR+ ANICNAGI +++M EA+AQAC S PS  WSSL  GFSA
Sbjct  435  CGSLSQYGMKHMRTFANICNAGIHKDQMDEATAQACVSIPSNPWSSLERGFSA  487



>ref|XP_010244352.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=485

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            LFLYMGTNPAN+N+TF+DE   KL +  + VNQRDADLLHFW KFR APEGS +K +AQK
Sbjct  315  LFLYMGTNPANDNYTFIDEN--KLPSSIQTVNQRDADLLHFWHKFRKAPEGSPKKFKAQK  372

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
            QF + +SHR H+D+S+ L+GKLLFG EKGPEVL ++R  G PLVDDW CLK+ VRAFETH
Sbjct  373  QFLDMMSHRMHIDHSMMLIGKLLFGYEKGPEVLKTVRPAGQPLVDDWDCLKTMVRAFETH  432

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            CGSLSQYGMKHMRS+ANICNAG+++E M  AS+QAC S P  SWSSL  GFSA
Sbjct  433  CGSLSQYGMKHMRSLANICNAGVTKEMMAGASSQACTSIPINSWSSLSKGFSA  485



>ref|XP_009125229.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme [Brassica 
rapa]
Length=487

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -1

Query  774  NVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKS  595
            N D L LYMGTNPAN+NFTFVD  SL  + P    NQRDADL+HFWDK+R APEGS RK+
Sbjct  313  NKDKLDLYMGTNPANDNFTFVDANSL--TPPSGVTNQRDADLVHFWDKYRKAPEGSTRKT  370

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQKQ  EA+SHR H+DNS+ LVGKLLFGI +G EVLN +R  G PL DDW+CLK+ VRA
Sbjct  371  EAQKQVLEAMSHRLHVDNSVKLVGKLLFGISEGSEVLNKVRPAGQPLADDWTCLKNMVRA  430

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            FE HCGSLSQYG+KHMRS ANICNAGI   +M EA++QAC S PS  WSSL  GFSA
Sbjct  431  FERHCGSLSQYGIKHMRSFANICNAGIQMRQMEEAASQACTSIPSGPWSSLHRGFSA  487



>emb|CDX75302.1| BnaA01g04000D [Brassica napus]
Length=487

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -1

Query  774  NVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKS  595
            N D L LYMGTNPAN+NFTFVD  SL  + P    NQRDADL+HFWDK+R APEGS RK+
Sbjct  313  NKDKLDLYMGTNPANDNFTFVDANSL--TPPSGVTNQRDADLVHFWDKYRKAPEGSTRKT  370

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQKQ  EA+SHR H+DNS+ L+GKLLFGI +G EVLN +R  G PL DDW+CLK+ VRA
Sbjct  371  EAQKQVLEAMSHRLHVDNSVKLIGKLLFGISEGSEVLNKVRPAGQPLADDWTCLKNMVRA  430

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            FE HCGSLSQYG+KHMRS ANICNAGI   +M EA++QAC S PS  WSSL  GFSA
Sbjct  431  FERHCGSLSQYGIKHMRSFANICNAGIQMRQMEEAASQACTSIPSGPWSSLHRGFSA  487



>gb|KHN29737.1| Vacuolar-processing enzyme [Glycine soja]
Length=483

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++L LY+GTNPAN+NFTFV + SL    P +AVNQRDADL+HFWDKFR AP GS+RK+ A
Sbjct  311  NNLVLYLGTNPANDNFTFVHKNSL--VPPSKAVNQRDADLIHFWDKFRKAPVGSSRKAAA  368

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            +KQ  EA+SHR H+D+S+  +GKLLFGIEKGPE+L+S+R  G PLVDDW CLK+ VR FE
Sbjct  369  EKQILEAMSHRMHIDDSMKRIGKLLFGIEKGPELLSSVRPAGQPLVDDWDCLKTLVRTFE  428

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS AN CNAGI +E+M EASAQAC + P+ SWSS+  GFSA
Sbjct  429  THCGSLSQYGMKHMRSFANFCNAGIRKEQMAEASAQACVNIPASSWSSMHRGFSA  483



>ref|XP_008377927.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
 ref|XP_008357361.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
Length=492

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 147/175 (84%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPANENFTF+ + SL+ S+  +AVNQRDADL+HFW K+  APEGS RK +A
Sbjct  322  NNLFVYMGTNPANENFTFLGQNSLRPSS--KAVNQRDADLVHFWHKYSKAPEGSPRKVQA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK+F EA+SHR H+D ++ L+GKLLFGIEKGP VLN++R  G PLVDDW CLK+ VR+FE
Sbjct  380  QKEFVEAMSHRMHIDETMKLIGKLLFGIEKGPXVLNAVRPAGQPLVDDWDCLKTMVRSFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS+ANICNAG+++E+M EASAQAC S PS  WS +  GFSA
Sbjct  440  THCGSLSQYGMKHMRSLANICNAGMTKEQMAEASAQACVSAPSXRWSHM--GFSA  492



>ref|XP_006285517.1| hypothetical protein CARUB_v10006959mg [Capsella rubella]
 gb|EOA18415.1| hypothetical protein CARUB_v10006959mg [Capsella rubella]
Length=482

 Score =   261 bits (666),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L +YMGTNPANEN TFVD  SLKL  P R  NQRDADL+HFW+K+R APEGS+RK+EA
Sbjct  310  DKLEIYMGTNPANENSTFVDSNSLKL--PSRVTNQRDADLVHFWEKYRKAPEGSSRKAEA  367

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  E +SHR H+DNS+ LVGK+LFGI KGP+VLN +R+ G PLVDDW+CLK+ VRAFE
Sbjct  368  QKQVLEVMSHRLHVDNSVILVGKILFGISKGPQVLNEVRSAGQPLVDDWNCLKNMVRAFE  427

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRS AN CN+GI  E+M EA++QAC + P   WSSL  GFSA
Sbjct  428  RHCGSLSQYGIKHMRSFANFCNSGIQMEQMEEAASQACTTIPPGPWSSLHRGFSA  482



>ref|XP_007136809.1| hypothetical protein PHAVU_009G076100g [Phaseolus vulgaris]
 gb|ESW08803.1| hypothetical protein PHAVU_009G076100g [Phaseolus vulgaris]
Length=483

 Score =   260 bits (665),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++L LY+GTNPAN+NF F ++ SL    P +AVNQRDADL+H WDK+R AP GS+RKS A
Sbjct  311  NNLSLYLGTNPANDNFAFREKNSL--VPPSKAVNQRDADLVHLWDKYRKAPVGSSRKSVA  368

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+D+S+ L+GKLLFGIE+GP++LNS+R  G PLVDDW CLK+ VR FE
Sbjct  369  QKQILEAMSHRMHIDDSMKLIGKLLFGIEEGPKLLNSVRPAGQPLVDDWDCLKTLVRTFE  428

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS AN CNAGI +E+M EASAQAC S P+  WSSLR GFSA
Sbjct  429  THCGSLSQYGMKHMRSFANFCNAGIGKEQMAEASAQACVSIPATPWSSLRSGFSA  483



>ref|XP_010911246.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
Length=491

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N + LFLY+G+NPAN+N TF+D+ +L   +  RAVNQRDADLL+FW K+R +PEGS+
Sbjct  314  LDLNAEQLFLYIGSNPANDNATFIDDNALP--SFSRAVNQRDADLLYFWHKYRESPEGSS  371

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K EAQKQ  E +SHR H+DNS+ L+GKLLFG E+GP+VL+++R TG PLVDDW CLKS 
Sbjct  372  KKLEAQKQLLEVMSHRLHVDNSMELIGKLLFGSEEGPKVLSTVRPTGQPLVDDWDCLKSL  431

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSL+QYGMKHMRS+ANICNAGI +E M E SAQAC   PS  WSSL GGFSA
Sbjct  432  VRTFETHCGSLAQYGMKHMRSLANICNAGIKKETMAEVSAQACFRVPSNPWSSLHGGFSA  491



>gb|EYU29312.1| hypothetical protein MIMGU_mgv1a005315mg [Erythranthe guttata]
Length=489

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ +VD+LF+YMGTNPAN+NFT+    SL+ S+  + VNQRDADL+HFWDKFR AP+GS 
Sbjct  312  LKLSVDNLFMYMGTNPANDNFTYAVSNSLRPSS--KTVNQRDADLIHFWDKFRKAPQGST  369

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK EAQK   EA++HRTH+DNSI L+GKLLFG +KGP+VL ++R  G PLVDDW+CLKS 
Sbjct  370  RKYEAQKDLAEAMAHRTHIDNSIKLIGKLLFGFQKGPQVLKTVRPAGKPLVDDWTCLKSL  429

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMRSIANICNAG+S E+M E SAQAC SFPS SWSSL  GFSA
Sbjct  430  VRTFETHCGSLSQYGMKHMRSIANICNAGVSIEQMAEVSAQACTSFPSSSWSSLHRGFSA  489



>ref|XP_007160985.1| hypothetical protein PHAVU_001G033500g [Phaseolus vulgaris]
 gb|ESW32979.1| hypothetical protein PHAVU_001G033500g [Phaseolus vulgaris]
Length=484

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LF Y+GT+PANEN TFVDE SL  S+  +AVNQRDADL+HFWDKFR APEGS +K+EA
Sbjct  312  DILFHYLGTDPANENLTFVDENSLWSSS--KAVNQRDADLVHFWDKFRKAPEGSPKKNEA  369

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            +KQ  E +SHR H+D+S+ LVGKLLFGIEK PE+LN++R  G  LVDDW CLK+ VR FE
Sbjct  370  RKQVLEVMSHRMHIDDSVELVGKLLFGIEKAPELLNAVRPAGSALVDDWDCLKTMVRTFE  429

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS AN+CN GI +E+M EASAQAC + P+  WSSL+ GFSA
Sbjct  430  THCGSLSQYGMKHMRSFANMCNVGIKKEQMREASAQACVTIPANPWSSLQRGFSA  484



>sp|O24325.1|VPE1_PHAVU RecName: Full=Vacuolar-processing enzyme; Short=VPE; AltName: 
Full=Legumain-like proteinase; Short=LLP; Flags: Precursor 
[Phaseolus vulgaris]
 emb|CAB17078.1| asparagine-specific endopeptidase precursor [Phaseolus vulgaris]
Length=484

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LF Y+GT+PANEN TFVDE SL  S+  +AVNQRDADL+HFWDKFR APEGS +K+EA
Sbjct  312  DILFHYLGTDPANENLTFVDENSLWSSS--KAVNQRDADLVHFWDKFRKAPEGSPKKNEA  369

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            +KQ  E +SHR H+D+S+ LVGKLLFGIEK PE+LN++R  G  LVDDW CLK+ VR FE
Sbjct  370  RKQVLEVMSHRMHIDDSVELVGKLLFGIEKAPELLNAVRPAGSALVDDWDCLKTMVRTFE  429

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS AN+CN GI +E+M EASAQAC + P+  WSSL+ GFSA
Sbjct  430  THCGSLSQYGMKHMRSFANMCNVGIKKEQMREASAQACVTIPANPWSSLQRGFSA  484



>ref|XP_006578073.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
Length=483

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++L LY+GTNPAN+NFTFV + SL    P +AVNQRDADL+HFWDKFR AP GS+RK+ A
Sbjct  311  NNLVLYLGTNPANDNFTFVLKNSL--VPPSKAVNQRDADLIHFWDKFRKAPVGSSRKAAA  368

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            +KQ  EA+SHR H+D+S+  +GKL FGIEKGPE+L+S+R  G PLVDDW CLK+ VR FE
Sbjct  369  EKQILEAMSHRMHIDDSMKRIGKLFFGIEKGPELLSSVRPAGQPLVDDWDCLKTLVRTFE  428

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS AN CNAGI +E+M EASAQAC + P+ SWSS+  GFSA
Sbjct  429  THCGSLSQYGMKHMRSFANFCNAGIRKEQMAEASAQACVNIPASSWSSMHRGFSA  483



>dbj|BAC86022.1| unnamed protein product [Homo sapiens]
Length=483

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++L LY+GTNPAN+NFTFV + SL    P +AVNQRDADL+HFWDKFR AP GS+RK+ A
Sbjct  311  NNLVLYLGTNPANDNFTFVLKNSL--VPPSKAVNQRDADLIHFWDKFRKAPVGSSRKAAA  368

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            +KQ  EA+SHR H+D+S+  +GKL FGIEKGPE+L+S+R  G PLVDDW CLK+ VR FE
Sbjct  369  EKQILEAMSHRMHIDDSMKRIGKLFFGIEKGPELLSSVRPAGQPLVDDWDCLKTLVRTFE  428

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS AN CNAGI +E+M EASAQAC + P+ SWSS+  GFSA
Sbjct  429  THCGSLSQYGMKHMRSFANFCNAGIRKEQMAEASAQACVNIPASSWSSMHRGFSA  483



>dbj|BAJ33795.1| unnamed protein product [Thellungiella halophila]
Length=478

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 2/162 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L LYMGTNPAN+NFTFVDE SL  + P R  NQRDADL+HFWDK+R APEGS RK+EA
Sbjct  316  DKLDLYMGTNPANDNFTFVDENSL--TPPSRVTNQRDADLVHFWDKYRKAPEGSTRKTEA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNS+ LVGKLLFGI +GPEVLN +R+ G PLVDDW+CLK+ VRAFE
Sbjct  374  QKQVLEAMSHRLHVDNSVKLVGKLLFGISEGPEVLNKVRSAGQPLVDDWNCLKNLVRAFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFP  283
             HCGSLSQYG+KHMRS ANICNAGI  E+M EAS+QAC + P
Sbjct  434  RHCGSLSQYGIKHMRSFANICNAGIQMEQMEEASSQACTTIP  475



>ref|XP_008797891.1| PREDICTED: vacuolar-processing enzyme [Phoenix dactylifera]
Length=486

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 143/180 (79%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N   LFLYMG+NPANEN TF+D+ +L   +  RAVNQRDADLL+FW K+R +PEGS+
Sbjct  309  LDLNAHQLFLYMGSNPANENATFIDDNALP--SFSRAVNQRDADLLYFWHKYRKSPEGSS  366

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K EAQKQ  E +SHR H+D+S+ L+GKLLFG E+GP+VL ++R  G PLVDDW CLKS 
Sbjct  367  KKLEAQKQLLEVMSHRLHVDSSMELIGKLLFGSEEGPKVLGTVRPAGQPLVDDWDCLKSM  426

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSL+QYGMKHMRS+ANICN GI +E M E SAQAC   PS SWSSL GGFSA
Sbjct  427  VRTFETHCGSLAQYGMKHMRSLANICNTGIKKETMAEVSAQACFRVPSNSWSSLHGGFSA  486



>dbj|BAA76744.1| asparaginyl endopeptidase (VmPE-1) [Vigna mungo]
Length=483

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            +++ LY+GTNPAN+NF F ++ SL    P +AVNQRDADL+HFWDKF  AP GS+RKS A
Sbjct  311  NNVSLYLGTNPANDNFPFREKNSL--VPPSKAVNQRDADLVHFWDKFPKAPLGSSRKSVA  368

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+D+S++L+GKLLFGIE+GPE+L+S+R  G PLVDDW CLK+ VR FE
Sbjct  369  QKQILEAMSHRMHIDDSVTLIGKLLFGIEEGPELLSSVRPAGQPLVDDWDCLKTLVRTFE  428

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLSQYGMKHMRS AN+CNAGI +E+M EASAQAC S P+  WSSL  GFSA
Sbjct  429  THCGSLSQYGMKHMRSFANLCNAGIRKEQMAEASAQACVSIPATPWSSLSSGFSA  483



>dbj|BAA76745.1| asparaginyl endopeptidase (VmPE-1A) [Vigna mungo]
Length=482

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 145/180 (81%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            +E + D+LFLY+GT+PAN+N TFVDE SL  S+   AVNQRDADL+HFW KFR APEGS 
Sbjct  305  VEFSKDALFLYLGTDPANDNLTFVDENSLWSSS--TAVNQRDADLVHFWHKFRKAPEGSP  362

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K+EA+KQ  E +SHR H+D+S+ LVGKLLFG EK PEVLN++R  G  LVDDW+CLK+ 
Sbjct  363  KKNEARKQVLEVMSHRMHIDDSVKLVGKLLFGFEKAPEVLNAVRPAGSALVDDWACLKTM  422

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHM   ANICN GI +E+M EASAQAC + P+ SWSSL+ GFSA
Sbjct  423  VRTFETHCGSLSQYGMKHMSPFANICNVGIKKEQMAEASAQACVTVPASSWSSLQRGFSA  482



>gb|AIB06797.1| cte peptide ligase [Clitoria ternatea]
Length=482

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 142/174 (82%), Gaps = 2/174 (1%)
 Frame = -1

Query  765  SLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQ  586
            +LF+YMGT+PAN+N TF D+ SL    PR+AV+QRDADL+H+W+K+R APEGS+RK+EA+
Sbjct  311  TLFVYMGTDPANDNNTFTDKNSL--GTPRKAVSQRDADLIHYWEKYRRAPEGSSRKAEAK  368

Query  585  KQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFET  406
            KQ  E ++HR H+DNS+  +GKLLFGIEKG ++LN++R  GLP+VDDW C K+ +R FET
Sbjct  369  KQLREVMAHRMHIDNSVKHIGKLLFGIEKGHKMLNNVRPAGLPVVDDWDCFKTLIRTFET  428

Query  405  HCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            HCGSLS+YGMKHMRS AN+CNAGI +E+M EASAQAC S P   WSSL  GFS 
Sbjct  429  HCGSLSEYGMKHMRSFANLCNAGIRKEQMAEASAQACVSIPDNPWSSLHAGFSV  482



>ref|XP_008444493.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis melo]
Length=493

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N ++LF Y+GT+PANEN TFV+E SL+ +   +  NQRDADL+HFW+KFR APEGS 
Sbjct  316  LKLNKNALFSYLGTDPANENNTFVEENSLRPAT--KFTNQRDADLVHFWEKFRKAPEGSL  373

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K EAQK+F EA+SHR H+DNS+ LVGKLLFGI++GPEVL ++R TG P+VDDW CL++ 
Sbjct  374  TKVEAQKKFVEAMSHRAHIDNSVMLVGKLLFGIKEGPEVLEAVRPTGRPVVDDWDCLRNM  433

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR+FE  CGSLSQYGMKHMRS ANICNAGIS+E+M EASAQAC S P   WSSL  GF+A
Sbjct  434  VRSFEARCGSLSQYGMKHMRSFANICNAGISKEQMAEASAQACVSVPPGPWSSLHKGFTA  493



>emb|CDX76736.1| BnaC08g33220D [Brassica napus]
Length=486

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 4/176 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAV-NQRDADLLHFWDKFRNAPEGSARKSE  592
            + L LY+GTNP NEN TF DE SL+   P   V NQRDADL+HFW+K++ APEGSARK+E
Sbjct  314  EKLVLYLGTNPDNENATFADENSLR---PFSGVTNQRDADLVHFWEKYKKAPEGSARKAE  370

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQ  EA+SHR H+DNS+ L+GKLLFGI +GP VLN +R  G PLVDDW CLK+ VRAF
Sbjct  371  AQKQVLEAMSHRLHVDNSLLLIGKLLFGISEGPAVLNKVRPCGKPLVDDWDCLKTLVRAF  430

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            E HCGSLSQYG+KHMRSIANICNAGI  E+M EA+ QACP+ P+  WSSL  GFSA
Sbjct  431  EKHCGSLSQYGLKHMRSIANICNAGIRMEQMEEAAIQACPTIPTGPWSSLHQGFSA  486



>emb|CDY11506.1| BnaA09g40720D [Brassica napus]
Length=489

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 140/176 (80%), Gaps = 3/176 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLK-LSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            + L LY+GTNP NEN TF DE SL+ LS      NQRDADL+HFW+K++ APEGS+RK+E
Sbjct  316  EKLVLYLGTNPDNENATFADENSLRPLSG--GVTNQRDADLVHFWEKYKKAPEGSSRKAE  373

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQ  EA+SHR H+DNS+ L+GKLLFGI +GP VLN +R  G PLVDDW CLK+ VRAF
Sbjct  374  AQKQVLEAMSHRLHVDNSVLLIGKLLFGISEGPAVLNKVRPGGKPLVDDWECLKTLVRAF  433

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            E HCGSLSQYG+KHMRSIANICNAGI  E+M EA+ QACP+ P+  WSSL  GFSA
Sbjct  434  EKHCGSLSQYGLKHMRSIANICNAGIQMEQMEEAAIQACPTIPTGPWSSLHQGFSA  489



>ref|XP_009117035.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme [Brassica 
rapa]
Length=489

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 141/176 (80%), Gaps = 3/176 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLK-LSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            + L LY+GT P NEN TF DE SL+ LS      NQRDADL+HFW+K++ APEGSARK+E
Sbjct  316  EKLVLYLGTIPDNENATFADEISLRPLSG--GVTNQRDADLVHFWEKYKKAPEGSARKAE  373

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQ  EA+SHR H+DNS+ L+GKLLFGI +GP VLN +R++G PLVDDW CLK+ VRAF
Sbjct  374  AQKQVLEAMSHRLHVDNSVLLIGKLLFGISEGPAVLNKVRSSGKPLVDDWDCLKTLVRAF  433

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            E HCGSLSQYG+KHMRSIANICNAGI  E+M EA+ QACP+ P+  WSSL  GFSA
Sbjct  434  EKHCGSLSQYGLKHMRSIANICNAGIQMEQMEEAAIQACPTIPTGPWSSLHQGFSA  489



>ref|XP_004159537.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
Length=493

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 145/180 (81%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  N ++LF Y+GT+PANEN TFV+E SL+ +   +  NQRDADL+HFW+KFR APEGS 
Sbjct  316  LMLNKNALFSYLGTDPANENNTFVEENSLRPAT--KFTNQRDADLVHFWEKFRKAPEGSL  373

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K EAQK+F EA+SHR H+DNS+ LVGKLLFGI++GPEVL +IR  G PLVDDW+CL++ 
Sbjct  374  TKVEAQKKFVEAMSHRAHIDNSVKLVGKLLFGIKEGPEVLEAIRPAGRPLVDDWNCLRNM  433

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR+FE  CGSLSQYGMKHMRS AN+CNAGIS+E+M EASAQAC S P   WSSL  GF+A
Sbjct  434  VRSFEARCGSLSQYGMKHMRSFANLCNAGISKEQMAEASAQACMSVPPGPWSSLLKGFTA  493



>ref|XP_004142919.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 gb|KGN62401.1| Vacuolar processing enzyme [Cucumis sativus]
Length=493

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 145/180 (81%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  N ++LF Y+GT+PANEN TFV+E SL+ +   +  NQRDADL+HFW+KFR APEGS 
Sbjct  316  LMLNKNALFSYLGTDPANENNTFVEENSLRPAT--KFTNQRDADLVHFWEKFRKAPEGSL  373

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K EAQK+F EA+SHR H+DNS+ LVGKLLFGI++GPEVL +IR  G PLVDDW+CL++ 
Sbjct  374  TKVEAQKKFVEAMSHRAHIDNSVKLVGKLLFGIKEGPEVLEAIRPAGRPLVDDWNCLRNM  433

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR+FE  CGSLSQYGMKHMRS AN+CNAGIS+E+M EASAQAC S P   WSSL  GF+A
Sbjct  434  VRSFEARCGSLSQYGMKHMRSFANLCNAGISKEQMAEASAQACMSVPPGPWSSLLKGFTA  493



>ref|XP_010669169.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L++YMG+NPANENFT+VD  SL   +  +AVNQRDADL+HFW+KFR APEGS RK EA
Sbjct  315  DKLYMYMGSNPANENFTYVDNNSLHPPS-SKAVNQRDADLVHFWEKFRKAPEGSQRKMEA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR HLD+SI LVGKLLFGIEKGPE+L ++R  G PLVDDW+CL++ VR FE
Sbjct  374  QKLFMEAMSHRIHLDHSIKLVGKLLFGIEKGPEILETVRPAGQPLVDDWTCLRTLVRTFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYGMKHMRSIAN+CNAG + ++M EASAQACPS PS  WSSL  GFSA
Sbjct  434  MHCGSLSQYGMKHMRSIANLCNAGTTADQMSEASAQACPSVPSSPWSSLHRGFSA  488



>ref|XP_009407316.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=488

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE N+  LFLY+G+NP NEN TFVD+ SL LS  + AVNQRDADL++FW K+R APEGS+
Sbjct  310  LELNMKDLFLYLGSNPLNENATFVDDNSL-LSFSKAAVNQRDADLVYFWHKYRRAPEGSS  368

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K  AQK   E +SHR H+DNSI L+GKLLFG  K  E+L S+R  G PLVDDWSCLKS 
Sbjct  369  HKLNAQKDLLEVMSHRLHIDNSIELIGKLLFGSGKASELLKSVRTAGQPLVDDWSCLKSM  428

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+HCGSLSQYGMKHMRS+ANICNAG+S+E M E +AQAC + PS  WSSL  GFSA
Sbjct  429  VRTFESHCGSLSQYGMKHMRSLANICNAGVSKETMAEVAAQACTAVPSNRWSSLHRGFSA  488



>emb|CBM41515.1| legumain/vacuolar processing enzyme [Papaver rhoeas]
Length=490

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSL-KLSAPRRAVNQRDADLLHFWDKFRNAPEGS  607
            LE + + LFLYMGTNPAN+N  F+++ SL  LS    +VNQR+ADL+HFW K+R APEGS
Sbjct  313  LEVSKEDLFLYMGTNPANDNNKFIEQNSLPSLSG---SVNQREADLIHFWQKYRKAPEGS  369

Query  606  ARKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKS  427
             RK++AQKQF E ++HR H+D+SI L+GKLLFG EKGP+VL ++R  G PLVDDW CLK+
Sbjct  370  QRKADAQKQFVEVMAHRMHVDHSIKLIGKLLFGFEKGPQVLEAVRPAGQPLVDDWDCLKT  429

Query  426  FVRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFS  247
             VR FE  CGSLSQYGMKHMRS+ANICNAGI +E+M EA++QAC + P+ SWSS   GFS
Sbjct  430  MVRTFEAQCGSLSQYGMKHMRSVANICNAGIKKEQMAEAASQACVTIPNGSWSSTHQGFS  489

Query  246  A  244
            A
Sbjct  490  A  490



>ref|XP_003589032.1| Vacuolar-processing enzyme, partial [Medicago truncatula]
Length=460

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            LFLY+GTNPAN+N +FVDE SLKL +P  AVNQRDADL+HFWDKFR APEGS RK+EAQK
Sbjct  308  LFLYLGTNPANDNISFVDESSLKLRSPSTAVNQRDADLIHFWDKFRKAPEGSLRKNEAQK  367

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
            +  EA+SHR H+DNS+ L+GKLLFGIEKG E+L+++R  G PLVD+W CLK+ V+ FETH
Sbjct  368  EVLEAMSHRMHVDNSVKLIGKLLFGIEKGTELLDNVRPAGSPLVDNWDCLKTMVKTFETH  427

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASA  304
            CGSLSQYGMKHMRS ANICNAGI  E+M EASA
Sbjct  428  CGSLSQYGMKHMRSFANICNAGIQTEQMAEASA  460



>ref|XP_008220440.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-processing enzyme-like 
[Prunus mume]
Length=520

 Score =   251 bits (641),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF+YMGTNPAN+N+TF+ E SL+ S   +AVNQRDADL+HFW K+R APEGS RK +A
Sbjct  348  ENLFVYMGTNPANDNYTFLGENSLRPST--KAVNQRDADLVHFWHKYRKAPEGSPRKIQA  405

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK F EA+SHR H+D ++ L+GKLLFGI+KGPEVLN++R  G PLVDDW CLK+ VR+FE
Sbjct  406  QKDFVEAMSHRMHMDQTMKLIGKLLFGIKKGPEVLNTVRPAGQPLVDDWDCLKTMVRSFE  465

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            T+CGSLSQYGMKHMRS+ANICNAG+++E+M +ASAQAC S PS  WSSL  GFSA
Sbjct  466  TYCGSLSQYGMKHMRSLANICNAGMTKEQMADASAQACSSVPSSRWSSLHRGFSA  520



>ref|XP_009420869.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE N+ +LFLY+G+NPANEN TF+D+ SL  S    AVNQRDADL++FW K++ A EGS+
Sbjct  301  LELNMQNLFLYVGSNPANENATFIDDNSLS-SFSNAAVNQRDADLIYFWHKYQKAREGSS  359

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K  AQK+  E ISHR H+DNSI  +GKLLFG ++G EVL ++R  G PLVDDWSCLKS 
Sbjct  360  HKRNAQKELLEVISHRLHIDNSIEFIGKLLFGSKQGSEVLKTVRPAGQPLVDDWSCLKSM  419

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE HCGSLSQYGMKHMRS+ANICNAGIS+E M E SA+AC S P+  WSSL+ GFSA
Sbjct  420  VRTFEAHCGSLSQYGMKHMRSLANICNAGISKEMMAEVSAEACISIPAGQWSSLQKGFSA  479



>ref|XP_009410798.1| PREDICTED: vacuolar-processing enzyme [Musa acuminata subsp. 
malaccensis]
Length=488

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 135/180 (75%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N   L  Y+G+NPAN+N T+VD  SL       AVNQRDADL+HFW KF  APEGS 
Sbjct  311  LDLNAKKLVSYVGSNPANDNPTYVDYNSLPPLP--EAVNQRDADLIHFWHKFHRAPEGSH  368

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K  AQK   E + HR H+D SI L+GKLLFG E+GPEVL S+R  G PLVDDWSCLKS 
Sbjct  369  QKLNAQKHLLEVMEHRLHIDTSIQLIGKLLFGSEQGPEVLESVRPAGQPLVDDWSCLKSM  428

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFET+CGSLSQYGMKHMRS+ANICNAGI EE M E SAQAC  FPS SWSSL  GFS+
Sbjct  429  VRAFETYCGSLSQYGMKHMRSLANICNAGIREETMAEVSAQACLRFPSNSWSSLHRGFSS  488



>ref|NP_001043344.1| Os01g0559600 [Oryza sativa Japonica Group]
 dbj|BAA84650.1| asparaginyl endopeptidase [Oryza sativa]
 dbj|BAB85400.1| putative C13 endopeptidase NP1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF05258.1| Os01g0559600 [Oryza sativa Japonica Group]
 dbj|BAG90492.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70891.1| hypothetical protein OsI_02429 [Oryza sativa Indica Group]
Length=501

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 138/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE N   +F+YMG+NPAN+N TFV++ SL   +  RAVNQRDADL++FW K+R  PE S 
Sbjct  324  LELNAHHVFMYMGSNPANDNATFVEDNSLPSFS--RAVNQRDADLVYFWQKYRKLPESSP  381

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+KQ  E ++HR+H+DNS+ L+G LLFG E+GP VL ++RATG PLVDDWSCLKS 
Sbjct  382  EKNEARKQLLEMMAHRSHVDNSVELIGNLLFGSEEGPRVLKAVRATGEPLVDDWSCLKSM  441

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS ANICNAGIS E M + +AQAC S PS  WSS   GFSA
Sbjct  442  VRTFEAQCGSLAQYGMKHMRSFANICNAGISAEAMAKVAAQACTSIPSNPWSSTHRGFSA  501



>gb|EEE54813.1| hypothetical protein OsJ_02232 [Oryza sativa Japonica Group]
Length=503

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 138/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE N   +F+YMG+NPAN+N TFV++ SL   +  RAVNQRDADL++FW K+R  PE S 
Sbjct  326  LELNAHHVFMYMGSNPANDNATFVEDNSLPSFS--RAVNQRDADLVYFWQKYRKLPESSP  383

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+KQ  E ++HR+H+DNS+ L+G LLFG E+GP VL ++RATG PLVDDWSCLKS 
Sbjct  384  EKNEARKQLLEMMAHRSHVDNSVELIGNLLFGSEEGPRVLKAVRATGEPLVDDWSCLKSM  443

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS ANICNAGIS E M + +AQAC S PS  WSS   GFSA
Sbjct  444  VRTFEAQCGSLAQYGMKHMRSFANICNAGISAEAMAKVAAQACTSIPSNPWSSTHRGFSA  503



>ref|XP_006646004.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=516

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 138/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            +E N   LFLYMG+NPAN+N TFV++ SL   +  RAVNQRDADL++FW K+R   EGS 
Sbjct  339  IELNAHHLFLYMGSNPANDNSTFVEDNSLPSFS--RAVNQRDADLVYFWQKYRKLAEGSP  396

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+KQ  E ++HR+H+DNS+ L+G LLFG E+GP VL ++RATG PL+DDWSCLKS 
Sbjct  397  EKNEARKQLLEMMAHRSHVDNSVELIGNLLFGSEEGPRVLKAVRATGEPLIDDWSCLKSM  456

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFE  CGSL+QYGMKHMRS ANIC AGIS E M + +AQAC S PS  WSS   GFSA
Sbjct  457  VRAFEAQCGSLAQYGMKHMRSFANICIAGISAEEMAKVAAQACTSIPSNPWSSTHRGFSA  516



>gb|KJB70141.1| hypothetical protein B456_011G060200 [Gossypium raimondii]
Length=475

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 138/198 (70%), Gaps = 24/198 (12%)
 Frame = -1

Query  771  VDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            +D+LF  +GTNPAN+NF FV+  SL    P +AVNQR+ADL HFWDK+  AP+   RK E
Sbjct  280  MDNLFTCLGTNPANDNFKFVNGNSLL--PPTKAVNQRNADLAHFWDKYCKAPDVLVRKVE  337

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLK------  430
            AQKQ  EA+SHR H+DN I L+GKLLFG+E+GPEVLN++R  G PLVDDW CLK      
Sbjct  338  AQKQVLEAMSHRMHVDNGIQLIGKLLFGVERGPEVLNTVRPAGQPLVDDWKCLKKMSLFL  397

Query  429  ----------------SFVRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQA  298
                            + VR FETHCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQA
Sbjct  398  IFLFLIMQLTKMLCSSTHVRTFETHCGSLAQYGMKHMRSLANICNAGIETEKMGEASAQA  457

Query  297  CPSFPSYSWSSLRGGFSA  244
            C + PS  W SL  GFSA
Sbjct  458  CFNIPSGHWGSLGKGFSA  475



>gb|EPS65165.1| vacuolar processing enzyme-1b, partial [Genlisea aurea]
Length=478

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 140/181 (77%), Gaps = 2/181 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ ++++LFLY+GT+PAN+N+TFV+  SL  S P   VNQRDADLLHFW KF  APE S+
Sbjct  299  LKLDLENLFLYLGTDPANDNYTFVEGNSLSTS-PSGRVNQRDADLLHFWHKFWKAPERSS  357

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K EAQ++  E +SHR+H+D+SI L+G LLFG  +G  VL  +R +G P+VDDW CL+S 
Sbjct  358  EKDEAQRRLAEVVSHRSHIDDSIELIGDLLFGSTEGTRVLKHVRPSGRPVVDDWDCLRSL  417

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYS-WSSLRGGFS  247
            VR FET+CGSLSQYGMKHMRS ANICN+G+  E+M EA+ Q C +FPS++ WSSL  GFS
Sbjct  418  VRTFETYCGSLSQYGMKHMRSFANICNSGVKAEKMGEATQQVCTAFPSHNPWSSLHRGFS  477

Query  246  A  244
            A
Sbjct  478  A  478



>gb|AIT97058.1| vacuolar processing enzyme [Triticum aestivum]
Length=311

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 134/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N   LFLY+G+NPAN+N TFV++ SL   +  RAVNQRDADL++FW K++   E S 
Sbjct  134  LDLNDQHLFLYIGSNPANDNTTFVEDNSLP--SFSRAVNQRDADLVYFWRKYQKLAESST  191

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E +SHR+H+DNS+ L+G LLFG   GP VL ++R  G PL DDWSCLKS 
Sbjct  192  EKNDARKQLLEMMSHRSHIDNSVELIGNLLFGFADGPMVLKTVRPAGEPLADDWSCLKSM  251

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFE+ CGSL+QYGMKHMRS ANICNAGI  E MV+ +AQAC S P+  WS+   GFSA
Sbjct  252  VRAFESQCGSLAQYGMKHMRSFANICNAGILPEAMVKMAAQACTSIPTNPWSATHNGFSA  311



>gb|ABF00019.1| legumain precursor [Saccharum officinarum]
Length=488

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GTNPAN+  TFV++ SL   +  +AVNQRDADL++FW K+R   +GS+
Sbjct  311  LELNVQKLFSYIGTNPANDGNTFVEDNSLP--SFSKAVNQRDADLVYFWQKYRKLADGSS  368

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K+EA+K+  E +SHR+H+DNS+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  369  KKNEARKELLEVMSHRSHVDNSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSM  428

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMR+ ANICNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  429  VRTFEAQCGSLAQYGMKHMRTFANICNAGILPEAVSKVAAQACTSIPSNPWSSIDKGFSA  488



>gb|EMS54452.1| Vacuolar-processing enzyme [Triticum urartu]
Length=422

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N   LFLY+G+NPAN N TFV++ SL   +  RAVNQRDADL++FW K+R   E S 
Sbjct  245  LDLNAQQLFLYIGSNPANNNTTFVEDNSLP--SFSRAVNQRDADLVYFWHKYRKLAESSP  302

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E  SHR+H+DNS+ L+G LLFG   GP VL ++R  G PLVDDWSCLKS 
Sbjct  303  EKNDARKQLLEMTSHRSHIDNSVELIGNLLFGFADGPMVLKTVRPAGEPLVDDWSCLKST  362

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFE+ CGSL+QYGMKHMRS ANICNAG+  E MV+ +AQAC S P+  WS+   GFSA
Sbjct  363  VRAFESQCGSLAQYGMKHMRSFANICNAGVLPEAMVKVAAQACKSIPTNPWSATHKGFSA  422



>ref|XP_006853917.1| hypothetical protein AMTR_s00036p00187360 [Amborella trichopoda]
 gb|ERN15384.1| hypothetical protein AMTR_s00036p00187360 [Amborella trichopoda]
Length=469

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L LYMG+NPAN+N TF+     +L +  +AVNQRDADL++FW+K+R +P GS +K  A
Sbjct  307  EQLVLYMGSNPANDNSTFISRN--ELPSFSKAVNQRDADLVYFWNKYRKSPVGSIKKRNA  364

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QK+  + ++HR HLDNSI L+GKLLFG EKGPE+L ++R TGLPLVDDW CLK+ VR FE
Sbjct  365  QKELFDVMAHRLHLDNSIELIGKLLFGSEKGPEILKTVRTTGLPLVDDWDCLKAMVRTFE  424

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYS  274
            T CGS+SQYGMKHMRS+ANICNAGIS+E M EASA+AC   P+ S
Sbjct  425  TKCGSISQYGMKHMRSMANICNAGISKEVMAEASAEACTRIPTTS  469



>ref|NP_180165.1| alpha-vacuolar processing enzyme [Arabidopsis thaliana]
 sp|P49047.2|VPEA_ARATH RecName: Full=Vacuolar-processing enzyme alpha-isozyme; AltName: 
Full=Alpha-VPE; AltName: Full=Asparaginyl endopeptidase 
alpha-VPE; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC31241.1| putative vacuolar processing enzyme [Arabidopsis thaliana]
 dbj|BAA09614.2| alpha-VPE [Arabidopsis thaliana]
 gb|AAL24163.1| At2g25940/F17H15.3 [Arabidopsis thaliana]
 gb|AAL90957.1| At2g25940/F17H15.3 [Arabidopsis thaliana]
 gb|AAM15043.1| putative vacuolar processing enzyme [Arabidopsis thaliana]
 gb|AEC07775.1| alpha-vacuolar processing enzyme [Arabidopsis thaliana]
Length=478

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 139/175 (79%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L L+MGTNPA+ENFTFV+E S++   P R  NQRDADL+HFW K++ APEGSARK EA
Sbjct  307  EKLVLFMGTNPADENFTFVNENSIR--PPSRVTNQRDADLVHFWHKYQKAPEGSARKVEA  364

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQ  EA+SHR H+DNSI L+G LLFG+E G  VLN +R +G PLVDDW CLKS VRAFE
Sbjct  365  QKQVLEAMSHRLHVDNSILLIGILLFGLE-GHAVLNKVRPSGEPLVDDWDCLKSLVRAFE  423

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSLSQYG+KHMRSIAN+CNAGI   +M EA+ QACP+ P+  WSSL  GFSA
Sbjct  424  RHCGSLSQYGIKHMRSIANMCNAGIQMRQMEEAAMQACPTIPTSPWSSLDRGFSA  478



>ref|XP_002455802.1| hypothetical protein SORBIDRAFT_03g025440 [Sorghum bicolor]
 gb|EES00922.1| hypothetical protein SORBIDRAFT_03g025440 [Sorghum bicolor]
Length=481

 Score =   229 bits (585),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GTNPAN+  TFV++ SL   +  +AVNQRDADL++FW K+R   + S+
Sbjct  304  LELNVQKLFSYIGTNPANDGNTFVEDNSLP--SFSKAVNQRDADLVYFWQKYRKLADDSS  361

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K+EA+K+  E ++HR+H+DNS+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  362  KKNEARKELLEVMAHRSHVDNSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSM  421

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS ANICNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  422  VRTFEAQCGSLAQYGMKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIDKGFSA  481



>gb|EMT06287.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=424

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N   LFLY+G+NPAN+N TFV++ SL   +  RAVNQRDADL++FW K++   E S 
Sbjct  247  LDLNDQHLFLYIGSNPANDNTTFVEDNSLP--SFSRAVNQRDADLVYFWRKYQKLAESST  304

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E + HR+H+DNS+ L+G LLFG   GP VL ++R  G PL DDWSCLKS 
Sbjct  305  EKNDARKQLLEMMGHRSHIDNSVELIGNLLFGFADGPMVLKTVRPAGEPLADDWSCLKSM  364

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFE+ CGSL+QYGMKHMRS ANICNAGI  E MV+ +AQAC S P+  WS+   GFSA
Sbjct  365  VRAFESQCGSLAQYGMKHMRSFANICNAGILPEAMVKMAAQACTSIPTNPWSATHNGFSA  424



>gb|AEY68248.1| legumain [Saccharum hybrid cultivar SP80-3280]
Length=488

 Score =   229 bits (584),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 136/180 (76%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GTNPAN+  TFV++ SL   +  ++ NQRDADL++FW K+R   +GS+
Sbjct  311  LELNVQKLFSYIGTNPANDGNTFVEDNSLP--SFFKSCNQRDADLVYFWQKYRKLADGSS  368

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K+EA+K+  E +SHR+H+DNS+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  369  KKNEARKELLEVMSHRSHVDNSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSM  428

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMR+ ANICNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  429  VRTFEAQCGSLAQYGMKHMRTFANICNAGILPEAVSKVAAQACTSIPSNPWSSIDKGFSA  488



>ref|XP_004968980.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=487

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 134/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  NV  LF Y+GTNPAN++  FV+  SL   +  RAVNQRDADL++FW K+R   EGS 
Sbjct  310  LNLNVQHLFSYIGTNPANDDNKFVEGNSLP--SFTRAVNQRDADLVYFWQKYRKVAEGSP  367

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+K+  E ++HR+H+DNS+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  368  GKNDARKELLEVMAHRSHVDNSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKSM  427

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFE  CGSLSQYGMKHMRS ANICNAGI  + + + +AQAC S PS  WSS+  GFSA
Sbjct  428  VRAFEAQCGSLSQYGMKHMRSFANICNAGILPDAVSKVAAQACTSIPSNPWSSIHMGFSA  487



>ref|XP_010049768.1| PREDICTED: vacuolar-processing enzyme-like [Eucalyptus grandis]
Length=267

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 14/175 (8%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LFLYMGTN       FVD+ SL         NQ+DA+LL+FW +F  APEGS+RK EA
Sbjct  107  ENLFLYMGTNSP-----FVDDNSL---------NQQDANLLYFWLEFFEAPEGSSRKLEA  152

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+S+ L+GKLLFGI+KGPEVL ++R  G P VDDW+CLKS VR FE
Sbjct  153  QKQFFEALSHRMHIDHSVKLIGKLLFGIKKGPEVLKAVRPVGQPFVDDWACLKSLVRTFE  212

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLS+YG+K++RS AN+CNAGI  E+M E S +AC   P   WSSL  GFSA
Sbjct  213  THCGSLSEYGLKYVRSFANMCNAGIQTEQMTEVSGEACARNPYGPWSSLSRGFSA  267



>gb|EPS60990.1| vacuolar processing enzyme a, partial [Genlisea aurea]
Length=283

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 133/180 (74%), Gaps = 3/180 (2%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  +V+ LF Y+GT+PAN+N T   + SL  +   + VNQRDADL+HFW KFRNAPE SA
Sbjct  107  LGLDVEDLFRYIGTDPANDNLTATGDNSLVPALASKHVNQRDADLVHFWHKFRNAPERSA  166

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K EAQ+Q  +A+SHR H+D+S+ L+ KLLFG     E + SI   G P+VDDW CL+S 
Sbjct  167  KKVEAQQQLADAVSHRAHVDSSVDLIVKLLFG---NNEDVKSIIRAGKPVVDDWDCLRSL  223

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FETHCGSLSQYGMKHMR+  N+CNAG+++ERM  A+ Q C +FP+  WSSL+ G+SA
Sbjct  224  VRTFETHCGSLSQYGMKHMRTFGNMCNAGVNKERMDVATKQVCTNFPANPWSSLQRGYSA  283



>gb|KCW82539.1| hypothetical protein EUGRSUZ_C03943 [Eucalyptus grandis]
Length=259

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 14/175 (8%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LFLYMGTN       FVD+ SL         NQ+DA+LL+FW +F  APEGS+RK EA
Sbjct  99   ENLFLYMGTNSP-----FVDDNSL---------NQQDANLLYFWLEFFEAPEGSSRKLEA  144

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
            QKQF EA+SHR H+D+S+ L+GKLLFGI+KGPEVL ++R  G P VDDW+CLKS VR FE
Sbjct  145  QKQFFEALSHRMHIDHSVKLIGKLLFGIKKGPEVLKAVRPVGQPFVDDWACLKSLVRTFE  204

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSLS+YG+K++RS AN+CNAGI  E+M E S +AC   P   WSSL  GFSA
Sbjct  205  THCGSLSEYGLKYVRSFANMCNAGIQTEQMTEVSGEACARNPYGPWSSLSRGFSA  259



>emb|CDM87100.1| unnamed protein product [Triticum aestivum]
Length=478

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N   LFLY+G+NPAN+N TFV++ SL   +  RAVNQRDADL++FW K++   E S 
Sbjct  301  LDLNDQHLFLYIGSNPANDNTTFVEDNSLP--SFSRAVNQRDADLVYFWHKYQKLAESSP  358

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E + HR+H+DNS+ L+G LLFG   GP VL +IR  G PL DDWSCLKS 
Sbjct  359  EKNDARKQLLEMMGHRSHIDNSVELIGNLLFGFADGPMVLKTIRPAGEPLADDWSCLKST  418

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFE+ CGSL+QYGMKHMRS ANICNAGI  E MV+ +AQAC S P+  WS+   GFSA
Sbjct  419  VRAFESQCGSLAQYGMKHMRSFANICNAGILPEAMVKVAAQACTSIPTNPWSATHRGFSA  478



>ref|XP_003569218.1| PREDICTED: vacuolar-processing enzyme-like [Brachypodium distachyon]
Length=488

 Score =   227 bits (578),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N + LFLY+G+NPAN+N TFV+  SL   +  RAVNQRDADL++FW K+R   E S 
Sbjct  311  LDLNAEHLFLYIGSNPANDNTTFVEGNSLP--SFSRAVNQRDADLVYFWQKYRKLAESSP  368

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+K+  E ++HR+H+DNS+ L G LLFG E GP VL ++R  G PLVDDW CLKS 
Sbjct  369  AKNDARKELLEMMAHRSHVDNSVELTGNLLFGSEDGPMVLKTVRTAGEPLVDDWGCLKST  428

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFE+ CGSL+QYGMKHMRS ANICNAGI  E   + +AQACPS P+  WS+   GFSA
Sbjct  429  VRAFESQCGSLAQYGMKHMRSFANICNAGILPEATAKVAAQACPSIPANPWSATHKGFSA  488



>gb|KCW81647.1| hypothetical protein EUGRSUZ_C03009 [Eucalyptus grandis]
Length=276

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 134/177 (76%), Gaps = 9/177 (5%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVN--QRDADLLHFWDKFRNAPEGSARKS  595
            ++LFLYMGTN       FVD+  L+   P++ V+  Q+DA+LL+FW +F  APEGS+RK 
Sbjct  107  ENLFLYMGTNSP-----FVDDNCLR--PPQKGVDLDQQDANLLYFWLEFFEAPEGSSRKL  159

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQKQF EA+SHR H+D+S+ L+GKLLFGI+KGPEVL ++R  G P VDDW+CLKS VR 
Sbjct  160  EAQKQFFEALSHRMHIDHSVKLIGKLLFGIKKGPEVLKAVRPVGQPFVDDWACLKSLVRT  219

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            FETHCGSLS+YG+K++RS AN+CNAGI  E+M E S +AC   P   WSSL  GFSA
Sbjct  220  FETHCGSLSEYGLKYVRSFANMCNAGIQTEQMTEVSGEACARNPYGPWSSLSRGFSA  276



>dbj|BAJ95226.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N   LFLY+G+NPAN+N TFV+E SL   +  RAVNQRDADL++FW K+R   E S 
Sbjct  312  LDLNAQHLFLYIGSNPANDNATFVEENSLPSFS--RAVNQRDADLVYFWHKYRKLAESSP  369

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+ A+KQ  E + HR+H+DNS+ L+G LLFG   GP VL S+R  G PLVDDW+CLKS 
Sbjct  370  EKNNARKQLLEMMGHRSHVDNSVELIGNLLFGSADGPMVLKSVRPAGEPLVDDWNCLKST  429

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            V  FE+ CGSL+QYGMKHMRS ANICNAGI  E MV+ +AQAC S P+  WS    GFSA
Sbjct  430  VHTFESQCGSLAQYGMKHMRSFANICNAGILPETMVKVAAQACTSIPTNPWSGTHKGFSA  489



>gb|ACF79136.1| unknown [Zea mays]
 gb|ACF85763.1| unknown [Zea mays]
 gb|ACF88139.1| unknown [Zea mays]
 tpg|DAA58991.1| TPA: legumain-like protease Precursor [Zea mays]
Length=481

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 135/180 (75%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GTNPAN++ TF+++ SL   +  +AVNQRDADL++FW K+R   + S 
Sbjct  304  LELNVKHLFSYIGTNPANDDNTFIEDNSLPSFS--KAVNQRDADLVYFWQKYRKLADSSP  361

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+K+  E ++HR+H+D+S+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  362  EKNEARKELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKST  421

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS ANICNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  422  VRTFEAQCGSLAQYGMKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFSA  481



>ref|XP_011081710.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
Length=485

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ + ++L +YMGT+P  +N T V + S + S+    +NQRDAD+LHFW KFR AP+GSA
Sbjct  310  LKLSAETLSVYMGTHPNKDNHTIVYDNSPRPSS--GVINQRDADVLHFWHKFRGAPQGSA  367

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K EAQKQ   A++ RTH+D+SI L+GKL+FG +KGP+VLNS+R  G  LVDDW CLKS 
Sbjct  368  KKFEAQKQLAVAMAQRTHVDSSIQLIGKLIFGTDKGPQVLNSVRPAGQALVDDWDCLKSM  427

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC  295
            VR FETHCGSLSQYGM+HMRSIANICNAG+ +E+M EASAQAC
Sbjct  428  VRTFETHCGSLSQYGMRHMRSIANICNAGVKKEQMGEASAQAC  470



>ref|NP_001105613.1| LOC542609 precursor [Zea mays]
 gb|AAD04883.1| C13 endopeptidase NP1 precursor [Zea mays]
Length=485

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 135/180 (75%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GTNPAN++ TF+++ SL   +  +AVNQRDADL++FW K+R   + S 
Sbjct  308  LELNVKHLFSYIGTNPANDDNTFIEDNSLP--SLSKAVNQRDADLVYFWQKYRKLADSSP  365

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+++  E ++HR+H+D+S+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  366  EKNEARRELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKST  425

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS ANICNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  426  VRTFEAQCGSLAQYGMKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFSA  485



>gb|EMS65516.1| Vacuolar-processing enzyme [Triticum urartu]
Length=441

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 131/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N + LF Y+G+NPANEN TFV++ +L   +  RAVNQRDADL++FW K+R   E S 
Sbjct  264  LDLNAEHLFSYIGSNPANENTTFVEDNALPSFS--RAVNQRDADLVYFWQKYRKLAESSP  321

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E + HR+H+DNSI L+G LLFG   GP VL ++R  G PLVDDWSCLKS 
Sbjct  322  EKNDARKQLLEMMGHRSHIDNSIELIGNLLFGSAGGPMVLKAVRPAGEPLVDDWSCLKST  381

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+ CGSL+QYGMKHMRS ANICNAGI  E   + +AQAC S P+  WS+   GFSA
Sbjct  382  VRTFESQCGSLAQYGMKHMRSFANICNAGIVPEATAKVAAQACTSIPTNPWSATHKGFSA  441



>gb|EMT10444.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=532

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N + LF Y+G+NPANEN TFV++ +L   +  RAVNQRDADL++FW K+R   E S 
Sbjct  355  LDLNAEHLFSYIGSNPANENTTFVEDNALPSFS--RAVNQRDADLVYFWQKYRKLAESSP  412

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E + HR+H+DNS+ L+G LLFG   GP VL ++R  G PLVDDWSCLKS 
Sbjct  413  EKNDARKQLLEMMGHRSHIDNSVELIGNLLFGSAGGPMVLKAVRPAGEPLVDDWSCLKST  472

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+ CGSL+QYGMKHMRS ANICNAGI  E M + +AQAC S P+  WS+   GFSA
Sbjct  473  VRTFESQCGSLAQYGMKHMRSFANICNAGIVPEAMAKVAAQACTSIPTNPWSATHKGFSA  532



>emb|CAQ00099.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26641.1| vacuolar processing enzyme 3 [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N + LF Y+G+NPANEN TFV++ +L   +  RAVNQRDADL++FW K+R   E S 
Sbjct  307  LDLNAEHLFSYIGSNPANENTTFVEDNALP--SLSRAVNQRDADLVYFWQKYRKLAESSP  364

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+ A+KQ  E + HR+H+D+S+ L+G LLFG   GP VL ++R  G PLVDDWSCLKS 
Sbjct  365  AKNNARKQLLEMMGHRSHIDSSVELIGNLLFGSAGGPMVLKTVRPAGEPLVDDWSCLKST  424

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+ CGSL+QYGMKHMRS AN+CNAGI  E M + +AQAC SFP+  WS+   GFSA
Sbjct  425  VRTFESQCGSLAQYGMKHMRSFANMCNAGIVPEAMAKVAAQACTSFPTNPWSATHKGFSA  484



>gb|ACG34144.1| vacuolar processing enzyme precursor [Zea mays]
Length=486

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 134/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GT+PAN+  TF+++ SL   +  +AVNQRDADL++FW K+R   + S 
Sbjct  309  LELNVQRLFSYIGTDPANDGNTFIEDNSLPSFS--KAVNQRDADLVYFWQKYRKLADSSP  366

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             KSEA+K+  E ++HR+H+D+S+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  367  PKSEARKELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAPGEPLVDDWSCLKSI  426

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS AN+CNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  427  VRTFEARCGSLAQYGMKHMRSFANMCNAGILPEAVSKVTAQACSSIPSNPWSSIHKGFSA  486



>gb|AET08891.1| vacuolar processing enzyme 4 [Triticum monococcum]
 emb|CCC14976.1| VPE4A protein [Triticum urartu]
Length=493

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 131/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N + LF Y+G+NPANEN TFV++ +L   +  RAVNQRDADL++FW K+R   E S 
Sbjct  316  LDLNAEHLFSYIGSNPANENTTFVEDNALPSFS--RAVNQRDADLVYFWQKYRKLAESSP  373

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E + HR+H+DNS+ L+G LLFG   GP VL ++R  G PLVDDWSCLKS 
Sbjct  374  EKNDARKQLLEMMGHRSHIDNSVELIGNLLFGSAGGPMVLKAVRPAGEPLVDDWSCLKST  433

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+ CGSL+QYGMKHMRS ANICNAGI  E   + +AQAC S P+  WS+   GFSA
Sbjct  434  VRTFESQCGSLAQYGMKHMRSFANICNAGIVPEATAKVAAQACTSIPTNPWSATHKGFSA  493



>emb|CAB42655.1| putative preprolegumain [Vicia narbonensis]
Length=380

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            +E + DSLFLY+G+NP+NENFTFV   SL    P +A+NQRDADL+HFWDKFR AP+GS 
Sbjct  240  IELSKDSLFLYLGSNPSNENFTFVGRNSL--VPPSKAINQRDADLIHFWDKFRKAPQGSP  297

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            RK+ AQK+  EA+SHR H+D+SI LVGKLLFG++KGPEVL S+R  G PLVDDW CLK+ 
Sbjct  298  RKAAAQKEVLEAMSHRMHIDDSIKLVGKLLFGMKKGPEVLTSVRPAGQPLVDDWDCLKTL  357

Query  423  VRAFETHCGSLSQYGMKHMRSIA  355
            VR FET+CGSLSQYGMKHMRS A
Sbjct  358  VRTFETYCGSLSQYGMKHMRSFA  380



>gb|EMT02419.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=543

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 131/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N   LFLY+G+NPAN   TFV++ SL   +  R VNQRDADL++FW K+R   E S 
Sbjct  366  LDLNAQQLFLYIGSNPANNKTTFVEDNSLP--SFSRVVNQRDADLVYFWHKYRKLAESSP  423

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E +SHR+H+DNS+ L+G LLFG   GP VL ++R  G PLVDDWSCLKS 
Sbjct  424  EKNDARKQLLEMMSHRSHIDNSVELIGNLLFGSADGPMVLKTVRPAGEPLVDDWSCLKST  483

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFE+ CGSL+QYGMKHMRS ANICNAG+  E  V+ +AQAC S P+  WS+   GFSA
Sbjct  484  VRAFESQCGSLAQYGMKHMRSFANICNAGVLPEATVKVAAQACKSIPTNPWSATHKGFSA  543



>emb|CAB64545.1| legumain-like protease [Zea mays]
Length=481

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 134/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  NV  LF Y+GTNPAN++ TF+++ SL   +  +AVNQRDADL++FW K+R   + S 
Sbjct  304  LGLNVKHLFSYIGTNPANDDNTFIEDNSLPSFS--KAVNQRDADLVYFWQKYRKLADSSP  361

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+++  E ++HR+H+D+S+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  362  EKNEARRELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKST  421

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS ANICNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  422  VRTFEAQCGSLAQYGMKHMRSFANICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFSA  481



>ref|NP_001241716.1| uncharacterized protein LOC100856894 precursor [Zea mays]
 emb|CAC18099.1| putative legumain [Zea mays]
 gb|ACF88247.1| unknown [Zea mays]
 gb|AFW83035.1| putative uncharacterized protein Precursor [Zea mays]
Length=486

 Score =   221 bits (564),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 134/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GT+PAN+  TF+++ SL   +  +AVNQRDADL++FW K+R   + S 
Sbjct  309  LELNVQRLFSYIGTDPANDGNTFIEDNSLPSFS--KAVNQRDADLVYFWQKYRKLADSSH  366

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+K+  E ++HR+H+D+S+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  367  AKNEARKELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAPGEPLVDDWSCLKSI  426

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS AN+CNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  427  VRTFEARCGSLAQYGMKHMRSFANMCNAGILPEAVSKVAAQACSSIPSNPWSSIHKGFSA  486



>ref|NP_001105119.1| legumain-like protease precursor [Zea mays]
 emb|CAB64544.1| legumain-like protease [Zea mays]
Length=486

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GT+PAN+  TF+++ SL   +  +AVNQRDADL++FW K+R   +   
Sbjct  309  LELNVQHLFSYIGTDPANDGNTFIEDNSLPSFS--KAVNQRDADLVYFWQKYRKFADSPP  366

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             KSEA+K+  E ++HR+H+D+S+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  367  AKSEARKELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAPGEPLVDDWSCLKSI  426

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+QYGMKHMRS AN+CNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  427  VRTFEARCGSLAQYGMKHMRSFANMCNAGILPEAVSKVAAQACSSIPSNPWSSIHKGFSA  486



>gb|KHG17266.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=463

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 122/176 (69%), Gaps = 26/176 (15%)
 Frame = -1

Query  771  VDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            +D+LF Y+GTNPAN+NF  VDE SL    P +AVNQRDADL+HFWDK+R AP+GS RK E
Sbjct  314  MDNLFTYLGTNPANDNFKSVDENSLL--PPTKAVNQRDADLVHFWDKYRKAPDGSVRKVE  371

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQ  EA+SHR H+DN                        TG PLVDDW CLK  VR F
Sbjct  372  AQKQVMEAMSHRMHVDN------------------------TGQPLVDDWKCLKEMVRTF  407

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ETHCGSL+QYGMKHMRS+ANICNAGI  E+M EASAQAC + PS  W SL  GFSA
Sbjct  408  ETHCGSLAQYGMKHMRSLANICNAGIETEKMGEASAQACFNIPSGHWGSLGKGFSA  463



>gb|AET08893.1| vacuolar processing enzyme 4 [Aegilops speltoides]
 emb|CCC14971.1| VPE4B protein [Aegilops speltoides]
Length=493

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N + LF Y+G+NPANEN TFV++ +L   +   AVNQRDADL++FW K+R   E S 
Sbjct  316  LDLNAEHLFSYIGSNPANENTTFVEDNALP--SFSGAVNQRDADLVYFWQKYRKLAESSP  373

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E + HR+H+DNS+ L+G LLFG   GP VL ++R  G PLVDDWSCLKS 
Sbjct  374  EKNDARKQLLEMMGHRSHIDNSVELIGNLLFGSAGGPMVLKAVRPAGEPLVDDWSCLKST  433

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+ CGSL+QYGMKHMRS ANICN GI  E M + +AQAC + P+  WS+   GFSA
Sbjct  434  VRTFESQCGSLAQYGMKHMRSFANICNVGIVPEAMAKVAAQACTNIPTNPWSATHKGFSA  493



>gb|AET08896.1| vacuolar processing enzyme 4 [Aegilops tauschii]
 emb|CCC14982.1| VPE4D protein [Aegilops tauschii]
Length=493

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L+ N + LF Y+G+NPANEN TFV++ +L   +  RAVNQRDADL++FW K+R   E S 
Sbjct  316  LDLNAEHLFSYIGSNPANENTTFVEDNALPSFS--RAVNQRDADLVYFWQKYRKLAESSP  373

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K++A+KQ  E + HR+H+DNS+  +G LLFG   GP VL ++R  G PLVDDWSCLKS 
Sbjct  374  EKNDARKQLLEMMGHRSHIDNSVEPIGNLLFGSAGGPMVLKAVRPAGEPLVDDWSCLKST  433

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE+ CGSL+QYGMKHMRS ANICNAGI  E M + +AQA  S P+  WS+   GFSA
Sbjct  434  VRTFESQCGSLAQYGMKHMRSFANICNAGIVPEAMAKVAAQARTSIPTNPWSATHKGFSA  493



>gb|AAL69377.1|AF462214_1 putative asparaginyl endopeptidase [Narcissus pseudonarcissus]
Length=149

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = -1

Query  750  MGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQKQFTE  571
            +G+NPAN+N TF+++ +L   +  RAVNQRDADL+++W KFR +PEGSA K +AQ+   +
Sbjct  1    LGSNPANDNATFIEDNTLP--SFSRAVNQRDADLVYYWHKFRRSPEGSAEKLDAQRDLLD  58

Query  570  AISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETHCGSL  391
             ++HR H+DNS+ LV KLLFG E G EV+ ++R  G PLVDDW CLKS VR+FE HCGSL
Sbjct  59   VMNHRLHVDNSVGLVMKLLFGSEIGEEVMKTVRPAGQPLVDDWDCLKSMVRSFEAHCGSL  118

Query  390  SQYGMKHMRSIANICNAGISEERMVEASAQA  298
            SQYGMKHMRS+ANICNAG+ EE M E +AQA
Sbjct  119  SQYGMKHMRSLANICNAGVKEEAMAEVAAQA  149



>emb|CAC18100.1| putative legumain [Zea mays]
Length=485

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            LE NV  LF Y+GTNPAN++ T +++ SL   +  +AVNQRDADL++FW K+R   + S 
Sbjct  308  LELNVKHLFSYIGTNPANDDNTSIEDNSLPSFS--KAVNQRDADLVYFWQKYRKLADSSH  365

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+++  E ++HR+H+D+S+ L+G LLFG E GP VL ++RA G PLVDDWSCLKS 
Sbjct  366  EKNEARRELLEVMAHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAAGEPLVDDWSCLKST  425

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VR FE  CGSL+ YGMKHMRS  NICNAGI  E + + +AQAC S PS  WSS+  GFSA
Sbjct  426  VRTFEAQCGSLAHYGMKHMRSFPNICNAGILPEAVSKVAAQACTSIPSNPWSSIHKGFSA  485



>ref|XP_009396761.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 126/180 (70%), Gaps = 1/180 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  N   L LY+G +P+ +  T V    L  S     VNQRDA+L+HFW K   A EGS 
Sbjct  265  LRLNTQKLSLYVGFDPSGDGVTPV-ANPLPSSTQTVVVNQRDAELIHFWLKLHKASEGSP  323

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
            +K +AQKQ  + + HR+H+D S+ L+G LLFG E GP VL S+ A G PLVDDWSCLKS 
Sbjct  324  QKLDAQKQLLQVLEHRSHVDKSVRLIGNLLFGSENGPRVLESVGAAGQPLVDDWSCLKSM  383

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            VRAFET+CGSLS+YGMKH+RS+ANICNAG+  E M + +A+ACP+ PS +WS L  GFSA
Sbjct  384  VRAFETYCGSLSRYGMKHLRSLANICNAGVRVEAMTKVAAEACPNVPSNTWSLLPKGFSA  443



>gb|KJB54730.1| hypothetical protein B456_009G046800 [Gossypium raimondii]
Length=465

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 115/160 (72%), Gaps = 10/160 (6%)
 Frame = -1

Query  774  NVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKS  595
            ++D L +Y G N A  N          L  P  A+NQRDADL+HFW+K+R APEGSA+K+
Sbjct  309  SLDHLSVYFGENTAKYN----------LQPPTTAINQRDADLVHFWEKYRKAPEGSAKKA  358

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQKQ  E +SHR H+D S+ L+G LLFG E GP+VLN +R  G PLVDDW CLK  V+ 
Sbjct  359  EAQKQLVEIMSHRMHIDTSVKLIGNLLFGTEIGPDVLNVVRPAGQPLVDDWKCLKEMVKT  418

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC  295
            FETHCG L+QYGMK++RS ANICNAGI  E M EASAQAC
Sbjct  419  FETHCGKLAQYGMKYIRSFANICNAGIQIEHMAEASAQAC  458



>gb|ABR18199.1| unknown [Picea sitchensis]
Length=493

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPR-RAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            + L+LYMG + AN N + V E S  L     +A+NQRDADLL+ W K++ + E S  +  
Sbjct  318  EELYLYMGFDSANSNASLVLENSPLLEKTEAKAINQRDADLLYMWQKYKKSKEDSPERLT  377

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQ Q  E ++HR H+D S+ LVG LLFG EKGP V N++R  G PLVDDW CLK  VR F
Sbjct  378  AQTQLLEFMAHRMHVDKSVKLVGNLLFGPEKGPAVFNAVRPQGEPLVDDWDCLKKMVRTF  437

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            E HCGSL+QYGMKHMR++ANICN GIS + M   SA+AC  FP+ SWSSL+ GFSA
Sbjct  438  EGHCGSLAQYGMKHMRALANICNEGISMDTMATVSAEACTQFPAGSWSSLQRGFSA  493



>gb|ABR17022.1| unknown [Picea sitchensis]
Length=316

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 126/184 (68%), Gaps = 15/184 (8%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFV---------DEKSLKLSAPRRAVNQRDADLLHFWDKFRNAP  616
            + LFLY+G++PAN N TF+         DEK +      RAVNQRDADLL+ W K++ + 
Sbjct  139  EHLFLYIGSDPANANATFIYDNGFPEFPDEKDV------RAVNQRDADLLYLWQKYKRSK  192

Query  615  EGSARKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSC  436
            EGS  K E+QK   + ++HR HLD S++L+GKLLFG  +G  VLN++R  G PLV+DW C
Sbjct  193  EGSIEKLESQKHMVDLMTHRMHLDKSVNLIGKLLFGSVRGLNVLNTVRPPGQPLVNDWDC  252

Query  435  LKSFVRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRG  256
            LK+ VR FE HCGSLSQYGMKHMRS+ANICN G+++  M   SA+AC    S   +SL  
Sbjct  253  LKTMVRTFEKHCGSLSQYGMKHMRSLANICNEGVTKNTMAVVSAEACNQMSSRFRTSLHR  312

Query  255  GFSA  244
            GFSA
Sbjct  313  GFSA  316



>gb|EPS59704.1| hypothetical protein M569_15100, partial [Genlisea aurea]
Length=431

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 127/170 (75%), Gaps = 10/170 (6%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSA-----PRRAVNQRDADLLHFWDKFRNA  619
            L+ +VD LFLYMG+NP+N+N TF    S+ LS         AV+QRDAD+LHFWDKFR A
Sbjct  267  LKLSVDKLFLYMGSNPSNDNSTF--GGSVHLSGNSSWPSSMAVSQRDADVLHFWDKFRKA  324

Query  618  PEGSARKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWS  439
            PEGS+RK+EAQKQ  E +  R+ +D S+  +GKLLFG     E++N+IR +G  LVDDW 
Sbjct  325  PEGSSRKAEAQKQLAEVMVRRSRVDISVVSIGKLLFG---SSEIMNAIRPSGKSLVDDWD  381

Query  438  CLKSFVRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPS  289
            CLKS VR FET+C SLS YGMKHMRSIAN+CNAG+SEE+M EAS+Q C S
Sbjct  382  CLKSLVRIFETYCSSLSGYGMKHMRSIANMCNAGVSEEQMSEASSQVCSS  431



>ref|XP_010051267.1| PREDICTED: vacuolar-processing enzyme-like [Eucalyptus grandis]
Length=262

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 122/155 (79%), Gaps = 9/155 (6%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVN--QRDADLLHFWDKFRNAPEGSARKS  595
            ++LFLYMGTN       FVD+  L+   P++ V+  Q+DA+LL+FW +F  APEGS+RK 
Sbjct  107  ENLFLYMGTNSP-----FVDDNCLR--PPQKGVDLDQQDANLLYFWLEFFEAPEGSSRKL  159

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQKQF EA+SHR H+D+S+ L+GKLLFGI+KGPEVL ++R  G P VDDW+CLKS VR 
Sbjct  160  EAQKQFFEALSHRMHIDHSVKLIGKLLFGIKKGPEVLKAVRPVGQPFVDDWACLKSLVRT  219

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEA  310
            FETHCGSLS+YG+K++RS AN+CNAGI  E+M E+
Sbjct  220  FETHCGSLSEYGLKYVRSFANMCNAGIQTEQMTES  254



>emb|CAQ00100.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26642.1| vacuolar processing enzyme 4 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99424.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSA  604
            L  N  SLF Y+GTNPAN+N TFV   S     P   VNQRDADL+HFW K+R + EGSA
Sbjct  303  LGLNDQSLFQYIGTNPANDNATFVQSSSSSRQLPGARVNQRDADLVHFWHKYRRSAEGSA  362

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K EA+++  E ++ R+ +D+S+ L+G LLFG E+G +VL ++R  G P+VDDW CLKS 
Sbjct  363  EKVEARRRLVETMARRSRVDSSVELIGGLLFGSEEGAKVLGTVRPAGQPVVDDWGCLKSV  422

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPS  280
            VR FE  CG L+QYGMKHMRS+ANICNAG+ EE M +A++QAC + PS
Sbjct  423  VRRFEERCGPLTQYGMKHMRSLANICNAGVREEVMDKAASQACAASPS  470



>ref|XP_009764212.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana sylvestris]
Length=457

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 119/162 (73%), Gaps = 5/162 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENF--TFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKS  595
            D LF YMG+N A  ++  T  +++S     P R VNQRD  L+H W KFR+AP+GSARK+
Sbjct  299  DPLFRYMGSNSAKNSYYSTSTNDESW---LPSRTVNQRDVHLMHLWSKFRSAPKGSARKT  355

Query  594  EAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA  415
            EAQ+Q  EAIS R H+DNS+  +G++LFG+EKGPEVL ++R  G PLVDDW CLKSFV+ 
Sbjct  356  EAQRQLREAISQREHVDNSVRHIGEVLFGVEKGPEVLQTVRPAGQPLVDDWDCLKSFVKI  415

Query  414  FETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPS  289
            FE+ CG L+ YG KH+R  AN+CNAGI  E+M  A+ QACPS
Sbjct  416  FESQCGKLTPYGRKHVRGFANLCNAGIRREQMAAAAKQACPS  457



>gb|KDO48392.1| hypothetical protein CISIN_1g016176mg [Citrus sinensis]
Length=309

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA+ NF     +  ++      VNQRDADLL  W  ++NA EGS +KSE 
Sbjct  139  EKLYLYQGFDPASTNFPPNKLQPDQMGV----VNQRDADLLFMWHMYKNAAEGSEKKSEM  194

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ TE + HR HLD SI ++G +LFG +KG  +LNS+RA GLPLVDDW CLKS VR FE
Sbjct  195  LKQITETMRHRKHLDASIDMIGVILFGPDKGSRILNSVRARGLPLVDDWQCLKSMVRVFE  254

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMR+ ANICN+G+S+  M E S  AC       W     G+SA
Sbjct  255  THCGSLTQYGMKHMRAFANICNSGVSQALMEETSEAACSGNELRQWHPAIRGYSA  309



>ref|XP_009386040.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=189

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -1

Query  642  FWDKFRNAPEGSARKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATG  463
             W K++ A EGS+ K  AQK+  E ISHR H+DNSI  +GKLLFG ++G EVL ++R  G
Sbjct  57   LWHKYQKAREGSSHKRNAQKELLEVISHRLHVDNSIEFIGKLLFGSKQGSEVLKTVRPAG  116

Query  462  LPLVDDWSCLKSFVRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFP  283
             PLVDDWSCLKS VR FE HCGSLSQYGMKHMRS+ANICNAGIS+E M E SA+AC S P
Sbjct  117  QPLVDDWSCLKSMVRTFEAHCGSLSQYGMKHMRSLANICNAGISKEMMAEVSAEACISIP  176

Query  282  SYSWSSLRGGFSA  244
            +  WSSL+ GFSA
Sbjct  177  AGQWSSLQKGFSA  189



>gb|EMS56335.1| Vacuolar-processing enzyme beta-isozyme [Triticum urartu]
Length=479

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G NPAN N T      L L AP+ A+NQRDADLL  W ++    E S  K+  
Sbjct  309  EKLYLYQGFNPANTNIT----NKLFLQAPKAAINQRDADLLFLWRRYELLHEKSKEKTNV  364

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ +E ++HR HLD+SI  +GKLLFG E GP VL ++R +G PLVDDW CLK  VR FE
Sbjct  365  LREISETVTHRKHLDSSIDFIGKLLFGYENGPSVLQAVRPSGKPLVDDWDCLKRMVRIFE  424

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN GIS   M EAS  AC    S  WSSL  G+SA
Sbjct  425  SHCGSLTQYGMKHMRAFANICNNGISGTTMKEASIGACGVQNSARWSSLIQGYSA  479



>gb|AET08888.1| vacuolar processing enzyme 1 [Triticum monococcum]
 emb|CCC14975.1| VPE2A protein [Triticum urartu]
Length=491

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G NPAN N T +    L L AP+ A+NQRDADLL  W ++    E S  K   
Sbjct  321  EKLYLYQGFNPANTNITNM----LLLQAPKAAINQRDADLLFLWRRYELLHEKSKEKGNV  376

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ +E ++HR HLD+SI  +GKLLFG E GP VL ++R +G PLVDDW CLK  VR FE
Sbjct  377  LREISETVTHRKHLDSSIDFIGKLLFGFENGPSVLQAVRPSGKPLVDDWDCLKRMVRIFE  436

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN GIS   M EAS  AC    S  WSSL  G+SA
Sbjct  437  SHCGSLTQYGMKHMRAFANICNNGISGTTMKEASIGACGVQNSARWSSLIQGYSA  491



>gb|KDO48391.1| hypothetical protein CISIN_1g016176mg [Citrus sinensis]
Length=394

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA+ NF     +  ++      VNQRDADLL  W  ++NA EGS +KSE 
Sbjct  224  EKLYLYQGFDPASTNFPPNKLQPDQMGV----VNQRDADLLFMWHMYKNAAEGSEKKSEM  279

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ TE + HR HLD SI ++G +LFG +KG  +LNS+RA GLPLVDDW CLKS VR FE
Sbjct  280  LKQITETMRHRKHLDASIDMIGVILFGPDKGSRILNSVRARGLPLVDDWQCLKSMVRVFE  339

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMR+ ANICN+G+S+  M E S  AC       W     G+SA
Sbjct  340  THCGSLTQYGMKHMRAFANICNSGVSQALMEETSEAACSGNELRQWHPAIRGYSA  394



>gb|ABH09087.1| vacuolar processing enzyme-like protein [Artemisia annua]
Length=114

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -1

Query  585  KQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFET  406
            KQF EA++HR  +D SI L+GK+LFG++KGPEVLN++R TG PLV DW CLK+ VR FET
Sbjct  1    KQFAEAMAHRMRIDASIKLLGKVLFGLDKGPEVLNAVRPTGEPLVGDWDCLKTLVRTFET  60

Query  405  HCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            HCGSLSQYGM+HMRSIAN CNAGI+EE+M+EAS+QACP+FPS SWSS+  GFSA
Sbjct  61   HCGSLSQYGMEHMRSIANFCNAGITEEQMIEASSQACPTFPSNSWSSIYNGFSA  114



>gb|KDP25622.1| hypothetical protein JCGZ_20778 [Jatropha curcas]
Length=495

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = -1

Query  771  VDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
             + L+LY G +PAN N   V+     ++AP   VNQRDA+LL  W  ++ + E S +K++
Sbjct  323  TEKLYLYQGFDPANVNLPPVNAH---VNAPMEVVNQRDAELLFMWQMYKRSDEQSGKKAQ  379

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
              +Q  E I HR+HLDNSI L+G LLFG +KG  VL S+R  GLPLVDDW+CLKS VR F
Sbjct  380  ILQQIKETIKHRSHLDNSIELIGTLLFGPQKGSTVLQSVREPGLPLVDDWTCLKSMVRVF  439

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ET+CGSL+QYGMKHMR+ AN+CN G+S   M EA   AC    +  W  L  G+SA
Sbjct  440  ETYCGSLTQYGMKHMRAFANVCNGGVSHASMEEACIAACSGHDAGQWQPLNRGYSA  495



>ref|XP_006477253.1| PREDICTED: vacuolar-processing enzyme-like [Citrus sinensis]
Length=529

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA+ NF      +  L      VNQRDADLL  W  ++NA EGS +KSE 
Sbjct  359  EKLYLYQGFDPASANFP----PNKLLPDQMGVVNQRDADLLFMWHMYKNAAEGSEKKSEM  414

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ TE + HR HLD SI ++G +LFG +KG  +LNS+RA GLPLVDDW CLKS VR FE
Sbjct  415  LKQITETMRHRKHLDASIDMIGVILFGPDKGSRILNSVRARGLPLVDDWQCLKSMVRVFE  474

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMR+ ANICN+G+S+  M E S  AC       W     G+SA
Sbjct  475  THCGSLTQYGMKHMRAFANICNSGVSQALMEETSEAACSGNELRQWHLAIRGYSA  529



>gb|AET08892.1| vacuolar processing enzyme 2 [Aegilops speltoides]
 emb|CCC14970.1| VPE2B protein [Aegilops speltoides]
Length=491

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G NPAN N T      L L AP+ A+NQRDADLL  W ++    E S  K+  
Sbjct  321  EKLYLYQGFNPANTNIT----NKLFLQAPKAAINQRDADLLFLWRRYELLHEKSKEKANV  376

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ +E ++HR HLD+SI  +GKLLFG E GP  L ++R +G PLVDDW CLK  VR FE
Sbjct  377  LREISETVAHRKHLDSSIDFIGKLLFGFENGPWELQAVRPSGKPLVDDWDCLKRMVRIFE  436

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN G+S   M EAS  AC    S  WS+L  G+SA
Sbjct  437  SHCGSLTQYGMKHMRAFANICNNGVSGTTMNEASIGACGVQNSARWSTLIQGYSA  491



>ref|XP_010933721.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
 ref|XP_010933722.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
Length=490

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 3/168 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L+L+ G +P+N N +     +L  + P  A+NQRDADLL  W ++    EGS +K+EA
Sbjct  319  DKLYLFQGFDPSNANLS---GNALAPTMPMEAINQRDADLLFLWKRYEQFDEGSKKKTEA  375

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ TE + HR HLDNSI+L+GKL+FG E GP +LN++R +G  LVDDW+CLK+ V+ F+
Sbjct  376  LREITETLVHRLHLDNSINLIGKLIFGSENGPSILNAVRPSGQALVDDWNCLKTMVQVFQ  435

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSS  265
            T+CG L+QYGM+HMR+ ANICN G S++ MVEA   AC S  S  WSS
Sbjct  436  TYCGPLTQYGMRHMRAFANICNRGSSKDAMVEACLNACESHISAKWSS  483



>ref|XP_003569976.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Brachypodium 
distachyon]
Length=490

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G NPAN N T      L   APR A+NQRDADLL  W ++    E S  K + 
Sbjct  320  EKLYLYQGFNPANANIT----NKLFWQAPRAAINQRDADLLFLWRRYEMLHEKSKEKVKV  375

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ +E + HR HLDNS+ L+G+LLFG E GP VL ++R +G PLVDDW CLK  VR FE
Sbjct  376  LREISETVMHRKHLDNSVDLIGQLLFGFENGPSVLQAVRPSGKPLVDDWDCLKRMVRIFE  435

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG L+QYGMKHMR+ ANICN GI    M E S  AC S     WS L  G+SA
Sbjct  436  SHCGPLTQYGMKHMRAFANICNNGIPGSTMKEGSISACGSRNIARWSPLIQGYSA  490



>ref|XP_009398114.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=396

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 113/175 (65%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PAN N T   E  L        +NQRDADLL  W ++    E S  K   
Sbjct  225  EKLYLYQGFDPANANIT---ENGLSQRMQMGTINQRDADLLFLWKRYERLAESSEDKRRT  281

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              + TE + HRTHLD SI L+GKL+FG   GP +L ++R  G  LVDDW CLKS VR+FE
Sbjct  282  VMEITETMMHRTHLDRSIDLIGKLIFGSNSGPAILRAVRPYGQALVDDWDCLKSMVRSFE  341

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN GIS + + EASA AC ++ S  WSS   G+SA
Sbjct  342  SHCGSLTQYGMKHMRAFANICNRGISRDAIKEASASACGNYNSAMWSSSMRGYSA  396



>ref|XP_009621616.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Nicotiana 
tomentosiformis]
 emb|CAB42650.2| putative preprolegumain [Nicotiana tabacum]
Length=455

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LF YMG+N A  ++   +     L  P R VNQRD  L+H W KFR+APEGSARK+EA
Sbjct  298  DPLFRYMGSNSAKNSYNTSNNDESWL--PSRTVNQRDVHLMHLWSKFRSAPEGSARKAEA  355

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             +Q +EA+S R  +DNS+  +G++LFG+EK  ++LN++R  G PLVDDW CLKSFV+ FE
Sbjct  356  HRQLSEALSQREDVDNSVRHIGEVLFGVEKSHKLLNTVRPAGQPLVDDWDCLKSFVKIFE  415

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACP  292
            + CG+L+ YG KH+R  AN+CNAGI  E+M  A+ QACP
Sbjct  416  SQCGTLTPYGRKHVRGFANLCNAGIRREQMAAAAKQACP  454



>ref|XP_002448237.1| hypothetical protein SORBIDRAFT_06g023820 [Sorghum bicolor]
 gb|EES12565.1| hypothetical protein SORBIDRAFT_06g023820 [Sorghum bicolor]
Length=493

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 115/175 (66%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLY G +PAN N        L    P+ AVNQRDADLL  W ++      S  K  A
Sbjct  323  EKLFLYQGFDPANANIA----NMLLWPGPKGAVNQRDADLLFMWKRYEQLNGESVEKLRA  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              +  E + HR HLD+SI  +G+LLFG EKGP +L ++RA+GLPLVDDW CLK  VR FE
Sbjct  379  LIEIKETVQHRKHLDSSIDFIGRLLFGFEKGPSMLEAVRASGLPLVDDWDCLKRMVRIFE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMK+MR+ ANICN+GISE +M E+S  AC S+ S  WS +  G SA
Sbjct  439  SQCGSLTQYGMKYMRAFANICNSGISEMKMRESSISACSSYNSARWSPMAQGHSA  493



>ref|XP_006440379.1| hypothetical protein CICLE_v10019686mg [Citrus clementina]
 gb|ESR53619.1| hypothetical protein CICLE_v10019686mg [Citrus clementina]
Length=529

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA+ NF     +  ++      VNQRDADLL  W  ++NA EGS +KSE 
Sbjct  359  EKLYLYQGFDPASTNFPPNKLQPDQMGV----VNQRDADLLFMWHMYKNAAEGSEKKSEM  414

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ TE + HR HLD SI ++G +LFG +KG  +LNS+ A GLPLVDDW CLKS VR FE
Sbjct  415  LKQITETMRHRKHLDASIDMIGVILFGPDKGSRILNSVGARGLPLVDDWQCLKSMVRVFE  474

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMR+ ANICN+G+S+  M E S  AC       W     G+SA
Sbjct  475  THCGSLTQYGMKHMRAFANICNSGVSQALMEETSEAACSGNELRQWHPAIRGYSA  529



>gb|EMT33588.1| Vacuolar-processing enzyme beta-isozyme [Aegilops tauschii]
Length=432

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G NPAN N T      L L AP+ A+NQRDADLL  W ++      S  K+  
Sbjct  262  EKLYLYQGFNPANTNIT----NKLFLQAPKAAINQRDADLLFLWRRYELLHGKSKEKANV  317

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              + +E ++HR HLDNSI  +GKLLFG E GP  L ++R +G PLVDDW CLK  VR FE
Sbjct  318  LTEISETVAHRKHLDNSIDFIGKLLFGFENGPSELQAVRPSGKPLVDDWDCLKRMVRIFE  377

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN G+S   M EAS   C    S   S+L  G+SA
Sbjct  378  SHCGSLTQYGMKHMRAFANICNNGVSGTTMKEASINTCGGHNSARLSTLIQGYSA  432



>gb|AEB22070.1| vacuolar processing enzyme 2, partial [Solanum tuberosum]
Length=148

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 3/116 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLYMGT+PAN+N+TF+D+ S+++S   +AVNQRDADL+HFW KF  APEGS RK+EA
Sbjct  20   DVLFLYMGTDPANDNYTFMDDNSMRVS---KAVNQRDADLVHFWYKFHKAPEGSVRKTEA  76

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFV  421
            QKQ  EAISHR HLDNSI+LVGKLLFGI+KGP +L S+R  G PLVDDW CLKS+V
Sbjct  77   QKQLNEAISHRMHLDNSIALVGKLLFGIKKGPGMLTSVRPAGQPLVDDWDCLKSYV  132



>ref|XP_004976374.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=492

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 115/175 (66%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLY G +PAN N       +L    P+ AVNQRDADLL  W ++     GS  K  A
Sbjct  322  EKLFLYQGFDPANANAA----NTLLWPGPKGAVNQRDADLLFMWKRYEQLDGGSEEKLRA  377

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD+SI  +G+L+FG E GP++L ++RA+G PLVDDW CLK  VR FE
Sbjct  378  LREIKETVQHRKHLDSSIDFIGRLVFGFENGPKMLEAVRASGQPLVDDWDCLKRMVRIFE  437

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
              CGSL+QYGMK+MR+ ANICN+GISE +M E+S  AC  + S  WS +  G SA
Sbjct  438  AQCGSLTQYGMKYMRAFANICNSGISEAKMRESSISACGGYNSARWSPMAQGHSA  492



>ref|XP_006647602.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=482

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 115/175 (66%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PAN       +  L L  P+ AVNQRDADLL  W ++    E S  K + 
Sbjct  312  EKLYLYQGFDPANAEV----KNKLLLDDPKAAVNQRDADLLFLWRRYELLHEKSEEKLKV  367

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ +EA++HR HLD+S+  VGKLLFG   GP VL  +R +G PLVDDW CLK  VR FE
Sbjct  368  LREISEAVTHRKHLDSSVDFVGKLLFGFGNGPTVLQHVRPSGQPLVDDWDCLKRMVRIFE  427

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN GI +  M +AS  AC S  S  WSSL  G+SA
Sbjct  428  SHCGSLTQYGMKHMRAFANICNNGIPDAAMKDASIVACSSDNSARWSSLVQGYSA  482



>ref|NP_001275272.1| vacoular processing enzyme 2 precursor [Solanum tuberosum]
 gb|ACC68681.1| vacoular processing enzyme 2 [Solanum tuberosum]
Length=461

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 109/148 (74%), Gaps = 13/148 (9%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D+LFLYMGT+PAN+N+TFVD+ SL++S   +AVNQRDADL+HFW KF  APEGS RK+EA
Sbjct  311  DALFLYMGTDPANDNYTFVDDNSLRVS---KAVNQRDADLVHFWYKFHKAPEGSVRKTEA  367

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRA--  415
            QKQ  EAISHR HLDNSI+LVGKLLFGI+KGPEVL S+R  G PLVDDW CLKS+V    
Sbjct  368  QKQLNEAISHRMHLDNSIALVGKLLFGIKKGPEVLTSVRPAGQPLVDDWDCLKSYVSTPT  427

Query  414  --------FETHCGSLSQYGMKHMRSIA  355
                    F      +S YG   +RS+ 
Sbjct  428  PFSSISFEFSQIYSCISLYGGMRLRSLV  455



>gb|EMT06055.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=492

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 114/156 (73%), Gaps = 1/156 (1%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFTFVD-EKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGS  607
            L+ N  SLFLY+GTNPAN+N +FV    S     P   VNQRDADL+HFW K+R + EGS
Sbjct  321  LDLNDQSLFLYIGTNPANDNASFVQGSSSTSRQLPGGRVNQRDADLVHFWHKYRRSAEGS  380

Query  606  ARKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKS  427
            A+K EA+++  E ++ R+ +D+S+ L+G LLFG E+G +VL ++R  G P+V DW CLKS
Sbjct  381  AKKGEARRRLVETMARRSRVDSSVELIGGLLFGSEQGAKVLGAVRPAGQPVVADWDCLKS  440

Query  426  FVRAFETHCGSLSQYGMKHMRSIANICNAGISEERM  319
             VR F+  CG L+QYGMKHMRS+AN+CNAG+ EE M
Sbjct  441  VVRRFQERCGPLTQYGMKHMRSLANLCNAGVREEAM  476



>tpg|DAA36671.1| TPA: hypothetical protein ZEAMMB73_569687 [Zea mays]
Length=309

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 113/175 (65%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L  Y G +PAN N   +    L    P+ AVNQRDADLL  W ++     G+  K  A
Sbjct  139  EKLSFYQGFDPANANIANM----LLWPGPKGAVNQRDADLLFMWKRYEQLNGGTEEKLRA  194

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              +  E + HR HLD+SI  VG+L+FG EKGP +L ++R +G PLVDDW CLK  VR FE
Sbjct  195  LIEIKETVQHRKHLDSSIDFVGRLVFGFEKGPSMLEAVRTSGQPLVDDWDCLKRMVRIFE  254

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMK+MR+ ANICN+GISE +M E+S  AC S+ S  WS +  G SA
Sbjct  255  SQCGSLTQYGMKYMRAFANICNSGISEMKMRESSISACSSYNSARWSPMARGHSA  309



>gb|EMS56147.1| Vacuolar-processing enzyme [Triticum urartu]
Length=459

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 113/175 (65%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLY G +PA    ++  ++   L + + A+NQRDAD+L  W K+     GS  K  A
Sbjct  288  DMLFLYQGFDPAKSYSSYFRQR---LPSLKGAINQRDADILFMWKKYEQLNGGSEEKQRA  344

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              +  E + HR HLD+SI  +GKL+FG EKGP VL++ R +G PLVDDW CLK+ VR FE
Sbjct  345  LTEIKETVLHRKHLDSSIDFIGKLVFGFEKGPSVLDAARGSGQPLVDDWDCLKTMVRIFE  404

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKHMR+ ANICN G+SE  M EAS  AC  +    WS L  G SA
Sbjct  405  SQCGSLTQYGMKHMRAFANICNNGVSEAEMKEASISACDDYDMGKWSPLVRGHSA  459



>gb|KHG24041.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=496

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 113/176 (64%), Gaps = 4/176 (2%)
 Frame = -1

Query  771  VDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            ++ L+LY G +PA  N        L  + P  AVNQRDAD+L  W  ++N+ +GS +K+E
Sbjct  325  LEKLYLYQGFDPATVNLP---PNELSPNTPMEAVNQRDADILFLWHMYKNSEDGS-KKTE  380

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
              +Q TE   HR HLD SI L+G LL+G  KG  +L S+R TGLPLVDDW CLKS VR F
Sbjct  381  ILRQITETKRHRIHLDGSIDLIGTLLYGPAKGSAILKSVRETGLPLVDDWQCLKSVVRLF  440

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ETHCGSL+QYGMKHMR+ ANICN+G+S+  M EA   AC       W     G+ A
Sbjct  441  ETHCGSLTQYGMKHMRAFANICNSGVSQALMQEACTAACNGHGPIQWHPSNQGYGA  496



>gb|AET08895.1| vacuolar processing enzyme 2 [Aegilops tauschii]
 emb|CCC14981.1| VPE2D protein [Aegilops tauschii]
Length=489

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G NPAN N T      L L AP+ A+NQRDADLL  W ++      S  K+  
Sbjct  319  EKLYLYQGFNPANTNIT----NKLFLQAPKAAINQRDADLLFLWRRYELLHGKSKEKANV  374

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              +  E ++HR HLDNSI  +GKLLFG E GP  L ++R +G PLVDDW CLK  VR FE
Sbjct  375  LTEIGETVAHRKHLDNSIDFIGKLLFGFENGPSELQAVRPSGKPLVDDWDCLKRMVRIFE  434

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN G+S   M EAS   C    S   S+L  G+SA
Sbjct  435  SHCGSLTQYGMKHMRAFANICNNGVSGTTMKEASINTCGGHNSARLSTLIQGYSA  489



>gb|KJB25635.1| hypothetical protein B456_004G201300 [Gossypium raimondii]
Length=496

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  N        L  + P  AVNQRDAD+L  W  ++N+ +G  +K+E 
Sbjct  326  EKLYLYQGFDPATVNLP---PNELGPNTPTEAVNQRDADILFLWHMYKNSEDG-LKKTEI  381

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ TE   HR HLD SI L+G LL+G  KG  +L S+R TGLPLVDDW CLKS VR FE
Sbjct  382  LKQITETKRHRIHLDGSIDLIGTLLYGPAKGSAILKSVRETGLPLVDDWQCLKSVVRLFE  441

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMR+ ANICN+G+S+  M EA   AC       W     G+SA
Sbjct  442  THCGSLTQYGMKHMRAFANICNSGVSQALMEEACTAACNGHGPIQWYPSNQGYSA  496



>ref|XP_004960991.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=473

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 119/163 (73%), Gaps = 7/163 (4%)
 Frame = -1

Query  774  NVDSLFLYMGTNPANENFTFVDEKSLKLSAPRRA---VNQRDADLLHFWDKFRNAPEGSA  604
            N  SL+ ++GT+PAN+N TF  + SL+    RR+   VNQRDADL++FW K++ + EG+ 
Sbjct  311  NGQSLYQFIGTDPANDNATFGRDNSLR----RRSSGTVNQRDADLVYFWQKYKKSAEGTP  366

Query  603  RKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSF  424
             K+EA+K+  + +S R+ +D+S+ L+G LLFG ++GP+VL ++R  G PL DDW CLK+ 
Sbjct  367  EKAEARKRLLQVMSRRSRVDSSMELIGSLLFGSDEGPKVLGAVRPAGQPLADDWDCLKAM  426

Query  423  VRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC  295
            V A+E  CG L QYGMKHMRS ANICNAG+ E+ M + ++QAC
Sbjct  427  VHAYEAQCGPLKQYGMKHMRSFANICNAGVGEDAMAKVASQAC  469



>ref|XP_006652582.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=500

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLY G NPAN N T      L    P+ AVNQRDADLL  W ++     GS  K + 
Sbjct  329  EKLFLYQGFNPANGNIT----NELIWPVPKAAVNQRDADLLFMWKRYEQLNGGSEDKLKV  384

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  + I+HR HLD+SI  +GKL+FG E GP +L + R++G  LVDDW CLK  VR FE
Sbjct  385  LREIEDTIAHRKHLDSSIDFIGKLVFGFENGPLILEAARSSGQSLVDDWDCLKKMVRIFE  444

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSL-RGGFSA  244
            + CGSL+QYGMKHMR+ AN+CN G+SE +M+E S  AC S+ S  WS +  GG SA
Sbjct  445  SQCGSLTQYGMKHMRAFANMCNNGVSEAKMMETSINACGSYNSARWSPMTEGGHSA  500



>ref|XP_003580236.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Brachypodium 
distachyon]
Length=494

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLY G NPAN N        L    P  AVNQRDAD+L  W ++     GS  K  A
Sbjct  324  EKLFLYQGFNPANANVA----NRLIWPGPSAAVNQRDADILFMWKRYEQLNVGSEEKLRA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              +  E ++HR HLD+SI  +GKL+FG   GP VL + R+ G PLVD+W CLK  VR FE
Sbjct  380  LMEIKETMAHRKHLDSSIDFIGKLVFGFANGPSVLEAARSPGQPLVDNWDCLKRMVRIFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKHMR+ ANICN G+SE++M+EAS  AC S+    WSS+  G SA
Sbjct  440  SQCGSLTQYGMKHMRAFANICNNGVSEDKMMEASTSACGSYDLARWSSVAQGHSA  494



>ref|XP_004953273.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Setaria 
italica]
Length=494

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G NP N + T+     L     +  VNQRDAD+L  W ++    E S  K E 
Sbjct  324  EKLYLYQGFNPENADITY----KLLWQGQKSVVNQRDADILFLWKRYELLNEKSKEKLEV  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ T  ++HR HLD+S+  +GKLLFG+E GP  L ++R+ G PLVDDW CLK  VR FE
Sbjct  380  LREITGTVTHRKHLDSSVDFIGKLLFGVENGPSTLGAVRSPGQPLVDDWDCLKRMVRIFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN G     M EAS  AC S+ S  WS L  G+SA
Sbjct  440  SHCGSLTQYGMKHMRAFANICNRGTPATAMKEASISACGSYNSARWSPLVQGYSA  494



>ref|XP_002452849.1| hypothetical protein SORBIDRAFT_04g033520 [Sorghum bicolor]
 gb|EES05825.1| hypothetical protein SORBIDRAFT_04g033520 [Sorghum bicolor]
Length=495

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 111/175 (63%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PAN N T      L        VNQRDAD+L  W ++    E S  K E 
Sbjct  325  EKLYLYQGFDPANANVT----NKLLRPGLEAVVNQRDADILFLWKRYELLHEKSEEKQEV  380

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ T  + HR HLD+SI  +GKLLFGIEKGP  L ++R +G PLVDDW CLK  VR FE
Sbjct  381  LREITGTVRHRKHLDSSIDFIGKLLFGIEKGPFTLQAVRPSGQPLVDDWDCLKQMVRIFE  440

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN+G     M +AS  AC S+ S  WS L  G+SA
Sbjct  441  SHCGSLTQYGMKHMRAFANICNSGTPGASMKQASMGACGSYNSARWSPLVQGYSA  495



>dbj|BAD25788.1| putative asparaginyl endopeptidase REP-2 [Oryza sativa Japonica 
Group]
 dbj|BAG91757.1| unnamed protein product [Oryza sativa Japonica Group]
Length=394

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L+LY G +PAN       +  L    P+ AVNQRDADLL  W ++    + S  K +A
Sbjct  224  DKLYLYQGFDPANAEV----KNKLSWEGPKAAVNQRDADLLFLWRRYELLHDKSEEKLKA  279

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ ++ + HR  LD+S+ LVGKLLFG   GP VL ++R +G PLVDDW CLK  VR FE
Sbjct  280  LREISDTVMHRKLLDSSVDLVGKLLFGFGNGPSVLQAVRPSGQPLVDDWDCLKRMVRIFE  339

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG L+QYGMKHMR+ ANICN GIS   M EAS   C S  S  WSSL  G+SA
Sbjct  340  SHCGPLTQYGMKHMRAFANICNNGISGASMKEASIATCSSHNSGRWSSLVQGYSA  394



>ref|XP_002441635.1| hypothetical protein SORBIDRAFT_09g030710 [Sorghum bicolor]
 gb|EES20065.1| hypothetical protein SORBIDRAFT_09g030710 [Sorghum bicolor]
Length=472

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 124/164 (76%), Gaps = 5/164 (3%)
 Frame = -1

Query  765  SLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQ  586
            SL+ +MGT+PAN++ + +    L+ S+   AVNQRDADL++FW ++R A EG+  K+EA+
Sbjct  313  SLYTFMGTDPANDDGSLL---RLRRSSGGAAVNQRDADLVYFWQRYRKAAEGTPEKAEAR  369

Query  585  KQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFET  406
            ++  + +S R+ +D+++ L+G LLFG ++GP+VL ++R  G PL DDW CLKS VRA+E 
Sbjct  370  RRLLQVMSRRSRVDSTMELIGGLLFGSKEGPKVLGAVRPAGQPLADDWDCLKS-VRAYER  428

Query  405  HCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSF-PSY  277
            HCG L+QYGMKHMRS+ANICNAG+ E+ M + ++QAC +  PS+
Sbjct  429  HCGPLAQYGMKHMRSLANICNAGVGEDAMAKVASQACAAVAPSH  472



>ref|NP_001105183.1| vacuolar processing enzyme1 precursor [Zea mays]
 gb|AAL58571.1| vacuolar processing enzyme 1 [Zea mays]
Length=494

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PAN N T      L  S     VNQRDAD+L  W ++    E S  K E 
Sbjct  324  EKLYLYQGFDPANANVT----NKLLWSGQEAVVNQRDADILFLWKRYELLHEKSEEKQEV  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ T  + HR HLDNSI+ +GKLLFG EKGP  L ++R  G PLVDDW CLK  VR FE
Sbjct  380  LREITGTVRHRKHLDNSINFIGKLLFGAEKGPSTLEAVRPPGQPLVDDWDCLKQMVRIFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGM+HMR+ ANICN+G     M  AS  AC  + S  WS L  G+SA
Sbjct  440  SHCGSLTQYGMRHMRAFANICNSGTPGASMKRASMGACGGYNSARWSPLAQGYSA  494



>gb|KDO80009.1| hypothetical protein CISIN_1g011066mg [Citrus sinensis]
Length=445

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 2/117 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            ++LF Y+GTNPAN+N+TFVDE SL+ ++  +AVNQRDADLLHFWDK+R APEG+ RK+EA
Sbjct  322  NNLFTYLGTNPANDNYTFVDENSLRPAS--KAVNQRDADLLHFWDKYRKAPEGTPRKAEA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVR  418
            QKQF EA+SHR H+D+SI L+GKLLFGIEKGPE+LN++R  G PLVDDW CLKS V+
Sbjct  380  QKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVK  436



>gb|AFW72544.1| vacuolar processing enzyme 1 [Zea mays]
Length=500

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PAN N T      L  S     VNQRDAD+L  W ++    E S  K E 
Sbjct  330  EKLYLYQGFDPANANVT----NKLLWSGQEAVVNQRDADILFLWKRYELLHEKSEEKQEV  385

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ T  + HR HLDNSI+ +GKLLFG EKGP  L ++R  G PLVDDW CLK  VR FE
Sbjct  386  LREITGTVRHRKHLDNSINFIGKLLFGAEKGPSTLEAVRPPGQPLVDDWDCLKQMVRIFE  445

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGM+HMR+ ANICN+G     M  AS  AC  + S  WS L  G+SA
Sbjct  446  SHCGSLTQYGMRHMRAFANICNSGTPGASMKRASMGACGGYNSARWSPLAQGYSA  500



>dbj|BAJ89125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LF Y G NPAN N        L L     A+NQRDAD+L  W ++     GS  K   
Sbjct  139  EKLFHYQGFNPANSNVA----NRLLLPDLEGAINQRDADILFMWKRYEKLNGGSEEKLGV  194

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E ++HR HLD+SI  +GKL+FG E GP VL + R++G PLVDDW CLK  VR FE
Sbjct  195  LREIKETVAHRKHLDSSIDFIGKLVFGFENGPSVLEAARSSGQPLVDDWDCLKRMVRVFE  254

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKHMR+ ANICN G+SE +M EAS  AC  +    WS L  G SA
Sbjct  255  SQCGSLTQYGMKHMRAFANICNNGVSEAQMREASISACGGYNLAKWSPLDLGHSA  309



>ref|NP_001047562.1| Os02g0644000 [Oryza sativa Japonica Group]
 dbj|BAF09476.1| Os02g0644000, partial [Oryza sativa Japonica Group]
Length=446

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L+LY G +PAN       +  L    P+ AVNQRDADLL  W ++    + S  K +A
Sbjct  276  DKLYLYQGFDPANAEV----KNKLSWEGPKAAVNQRDADLLFLWRRYELLHDKSEEKLKA  331

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ ++ + HR  LD+S+ LVGKLLFG   GP VL ++R +G PLVDDW CLK  VR FE
Sbjct  332  LREISDTVMHRKLLDSSVDLVGKLLFGFGNGPSVLQAVRPSGQPLVDDWDCLKRMVRIFE  391

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG L+QYGMKHMR+ ANICN GIS   M EAS   C S  S  WSSL  G+SA
Sbjct  392  SHCGPLTQYGMKHMRAFANICNNGISGASMKEASIATCSSHNSGRWSSLVQGYSA  446



>ref|NP_001152500.1| LOC100286140 [Zea mays]
 gb|ACG47915.1| vacuolar processing enzyme, beta-isozyme precursor [Zea mays]
 tpg|DAA36670.1| TPA: vacuolar processing enzyme, beta-isozyme [Zea mays]
Length=457

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 113/175 (65%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L  Y G +PAN N   +    L    P+ AVNQRDADLL  W ++     G+  K  A
Sbjct  287  EKLSFYQGFDPANANIANM----LLWPGPKGAVNQRDADLLFMWKRYEQLNGGTEEKLRA  342

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              +  E + HR HLD+SI  VG+L+FG EKGP +L ++R +G PLVDDW CLK  VR FE
Sbjct  343  LIEIKETVQHRKHLDSSIDFVGRLVFGFEKGPSMLEAVRTSGQPLVDDWDCLKRMVRIFE  402

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMK+MR+ ANICN+GISE +M E+S  AC S+ S  WS +  G SA
Sbjct  403  SQCGSLTQYGMKYMRAFANICNSGISEMKMRESSISACSSYNSARWSPMARGHSA  457



>ref|XP_010259032.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=495

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 115/175 (66%), Gaps = 6/175 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PANEN          L      VNQRDADLL  W +++ + +GS +K EA
Sbjct  327  EKLYLYQGFDPANENLN-----QNTLHPHMEVVNQRDADLLFLWQRYKKSEDGS-KKKEA  380

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K+  E + HRTH+D S+ L+G +LFG E+   +L+++R +GLPLVDDW CLK+ VR FE
Sbjct  381  FKRIAETVMHRTHIDGSVELIGNILFGTERSASILSAVRPSGLPLVDDWGCLKAMVRLFE  440

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSL+QYGM+HMR+ ANICN+GISE+ M  A   AC    S  WS    G+SA
Sbjct  441  YHCGSLTQYGMRHMRAFANICNSGISEDAMEAACRAACSGPLSAVWSPFTRGYSA  495



>ref|XP_008668185.1| PREDICTED: LOC100286140 isoform X1 [Zea mays]
 tpg|DAA36669.1| TPA: vacuolar processing enzyme, beta-isozyme [Zea mays]
Length=493

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 113/175 (65%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L  Y G +PAN N   +    L    P+ AVNQRDADLL  W ++     G+  K  A
Sbjct  323  EKLSFYQGFDPANANIANM----LLWPGPKGAVNQRDADLLFMWKRYEQLNGGTEEKLRA  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              +  E + HR HLD+SI  VG+L+FG EKGP +L ++R +G PLVDDW CLK  VR FE
Sbjct  379  LIEIKETVQHRKHLDSSIDFVGRLVFGFEKGPSMLEAVRTSGQPLVDDWDCLKRMVRIFE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMK+MR+ ANICN+GISE +M E+S  AC S+ S  WS +  G SA
Sbjct  439  SQCGSLTQYGMKYMRAFANICNSGISEMKMRESSISACSSYNSARWSPMARGHSA  493



>dbj|BAC41386.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 dbj|BAC41387.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 dbj|BAD25787.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 gb|EAY86869.1| hypothetical protein OsI_08253 [Oryza sativa Indica Group]
 gb|EAZ23976.1| hypothetical protein OsJ_07703 [Oryza sativa Japonica Group]
Length=496

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L+LY G +PAN       +  L    P+ AVNQRDADLL  W ++    + S  K +A
Sbjct  326  DKLYLYQGFDPANAEV----KNKLSWEGPKAAVNQRDADLLFLWRRYELLHDKSEEKLKA  381

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ ++ + HR  LD+S+ LVGKLLFG   GP VL ++R +G PLVDDW CLK  VR FE
Sbjct  382  LREISDTVMHRKLLDSSVDLVGKLLFGFGNGPSVLQAVRPSGQPLVDDWDCLKRMVRIFE  441

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG L+QYGMKHMR+ ANICN GIS   M EAS   C S  S  WSSL  G+SA
Sbjct  442  SHCGPLTQYGMKHMRAFANICNNGISGASMKEASIATCSSHNSGRWSSLVQGYSA  496



>ref|XP_008369533.1| PREDICTED: legumain [Malus domestica]
Length=501

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY+G +PA+ N       + +L  P   VNQRDA++ + W  ++ +  GS +  E 
Sbjct  330  EKLYLYLGFDPASVNLP---PNNGQLEKPMEVVNQRDAEIFYMWQMYKRSEHGSGKSREI  386

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              +  E + HRTHLD SI  +G  L+G  KGP  LNS+RA G PLVDDW CLKS VR FE
Sbjct  387  LNEIKETMRHRTHLDASIQFIGTFLYGPGKGPSKLNSVRAVGQPLVDDWGCLKSMVRVFE  446

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC  295
            THCGSL+QYGMKHMR+ ANICN+G+SE +M EA + AC
Sbjct  447  THCGSLTQYGMKHMRAFANICNSGVSEAKMAEACSAAC  484



>gb|KCW81643.1| hypothetical protein EUGRSUZ_C03004 [Eucalyptus grandis]
Length=433

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLYMGTNPAN+N +FVD+ SL+   P++AVNQRDADLLHFW KFR APEGS+RK EA
Sbjct  316  EDLFLYMGTNPANDNSSFVDDNSLR--PPQKAVNQRDADLLHFWHKFRKAPEGSSRKLEA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFV  421
            QKQF EA+SHR H+D+S+ L+GKLLFGI+KGPEVLN++R  G PLVDDW+CL+S V
Sbjct  374  QKQFFEAMSHRMHIDHSVKLIGKLLFGIKKGPEVLNAVRPAGQPLVDDWACLRSLV  429



>ref|XP_006371860.1| hypothetical protein POPTR_0018s04650g [Populus trichocarpa]
 gb|ERP49657.1| hypothetical protein POPTR_0018s04650g [Populus trichocarpa]
Length=478

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 4/120 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPR-RAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            D++FLYMGTNPAN+NFTF+DE  L+   PR +AVNQRDADL+HFWDK+R APEGS+RK E
Sbjct  317  DNIFLYMGTNPANDNFTFMDENLLR---PRSKAVNQRDADLVHFWDKYRKAPEGSSRKVE  373

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
            AQKQF EA+SHR H+D+SI L+GKLLFGIEK  EVLN+IR  G PLVDDW CLK+ V+ +
Sbjct  374  AQKQFVEAMSHRMHIDHSIKLIGKLLFGIEKASEVLNAIRPAGQPLVDDWDCLKTLVKFY  433



>ref|NP_001053428.1| Os04g0537900 [Oryza sativa Japonica Group]
 sp|Q84LM2.1|VPE1_ORYSJ RecName: Full=Vacuolar-processing enzyme beta-isozyme 1; Short=Beta-VPE 
1; Short=OsVPE1; AltName: Full=Asparaginyl endopeptidase 
VPE1; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAC76418.1| vacuolar processing enzyme [Oryza sativa Japonica Group]
 dbj|BAF15342.1| Os04g0537900 [Oryza sativa Japonica Group]
 gb|EEE61412.1| hypothetical protein OsJ_15605 [Oryza sativa Japonica Group]
Length=497

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLY G NPAN N T      L    P+  VNQRDADLL  W ++      S  K  A
Sbjct  326  EKLFLYQGFNPANGNIT----NELIWPVPKATVNQRDADLLFMWKRYEQLNGVSEDKLRA  381

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  + I+HR HLD+SI  +GKL+FG E GP  L + R++G PLVD+W CLK  VR FE
Sbjct  382  LREIEDTIAHRKHLDSSIDFIGKLVFGFENGPLALEAARSSGQPLVDNWDCLKKMVRIFE  441

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSL-RGGFSA  244
            + CGSL+QYGMK+MR+ ANICN G+SE +M+EAS  AC  + S  WS +  GG SA
Sbjct  442  SQCGSLTQYGMKYMRAFANICNNGVSEAKMMEASINACGRYNSARWSPMTEGGHSA  497



>sp|B8ASK4.1|VPE1_ORYSI RecName: Full=Vacuolar-processing enzyme beta-isozyme 1; Short=Beta-VPE 
1; Short=OsVPE1; AltName: Full=Asparaginyl endopeptidase 
VPE1; Flags: Precursor [Oryza sativa Indica Group]
 gb|EEC77714.1| hypothetical protein OsI_16797 [Oryza sativa Indica Group]
Length=497

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLY G NPAN N T      L    P+  VNQRDADLL  W ++      S  K  A
Sbjct  326  EKLFLYQGFNPANGNIT----NELIWPVPKATVNQRDADLLFMWKRYEQLNGVSEDKLRA  381

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  + I+HR HLD+SI  +GKL+FG E GP  L + R++G PLVD+W CLK  VR FE
Sbjct  382  LREIEDTIAHRKHLDSSIDFIGKLVFGFENGPLALEAARSSGQPLVDNWDCLKKMVRIFE  441

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSL-RGGFSA  244
            + CGSL+QYGMK+MR+ ANICN G+SE +M+EAS  AC  + S  WS +  GG SA
Sbjct  442  SQCGSLTQYGMKYMRAFANICNNGVSEAKMMEASINACGRYNSARWSPMTEGGHSA  497



>emb|CAQ00096.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26636.1| vacuolar processing enzyme 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G NPAN N T      L   A + A+NQRDADLL  W ++    E S  K   
Sbjct  322  EKLYLYQGFNPANTNIT----NKLFWQARKAAINQRDADLLFLWRRYELLHEKSKEKVNV  377

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ +E ++HR HLD+SI  +GKLLFG E GP +L ++R +G+PLVDDW CLK  VR FE
Sbjct  378  LREISETVTHRKHLDSSIDFIGKLLFGFENGPSMLETVRPSGIPLVDDWDCLKRMVRIFE  437

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC-PSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN GIS   M EAS   C     S   S+L  G+SA
Sbjct  438  SHCGSLTQYGMKHMRAFANICNNGISGTSMKEASISTCGGGHNSARLSTLIQGYSA  493



>ref|XP_003608767.1| Vacuolar-processing enzyme [Medicago truncatula]
Length=301

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  N    ++K   L +    VNQRDA++L  W+ ++     + +K E 
Sbjct  130  EKLYLYQGFDPATVNLPPHNDK---LESKMEVVNQRDAEILFMWEMYKRLDHQTEKKREI  186

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD S+ L+G LLFG  KG  VL ++RATGLPLVDDW CLKS VR FE
Sbjct  187  LEKIAETVKHRNHLDGSVELIGVLLFGPTKGSSVLQAVRATGLPLVDDWECLKSRVRLFE  246

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSF  286
            THCGSL+QYGMKHMR+ ANICN+GISE+ M +A   AC  +
Sbjct  247  THCGSLTQYGMKHMRAFANICNSGISEDSMEKACMVACGGY  287



>gb|EMT14075.1| Vacuolar-processing enzyme beta-isozyme [Aegilops tauschii]
Length=415

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 112/175 (64%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLY G +PA  +   +  + L + + + A+ QRDAD+L  W K+     GS  K  A
Sbjct  244  DMLFLYQGFDPAKSS---IRNRPLPMPSLKGAIKQRDADILFMWKKYEKLNGGSEEKQRA  300

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD+SI  +GKL+FG +KGP VL + R +G PLVDDW CLK+ V+ FE
Sbjct  301  LREVKETVLHRKHLDSSIDFIGKLVFGFDKGPLVLEAARGSGQPLVDDWDCLKTMVQVFE  360

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKH R+ AN+CN G+SE  M EAS  AC  +    WS L  G+SA
Sbjct  361  SQCGSLTQYGMKHTRAFANMCNNGVSEAEMKEASISACDGYDMGRWSPLVRGYSA  415



>emb|CBX26637.1| vacuolar processing enzyme 2a [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 112/175 (64%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFL+ G +PA  +   +  + L + + + A+NQRDAD+L  W K+     GS  K  A
Sbjct  240  DMLFLFQGFDPAKSS---IRNRPLPMPSLKGAINQRDADILFMWRKYEKLNAGSEEKQRA  296

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD+SI  +GKL+FG +KGP +L + R +G PLVDDW CL++ VR FE
Sbjct  297  LREVKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLQAARGSGQPLVDDWDCLRTMVRVFE  356

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKHMR+ ANICN G+SE  M EAS  AC  +    W+ L  G S 
Sbjct  357  SQCGSLTQYGMKHMRAFANICNNGVSEAEMKEASISACDGYDMGKWNPLVLGHST  411



>gb|AAD04882.1| C13 endopeptidase NP1 precursor [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 112/175 (64%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFL+ G +PA  +   +  + L + + + A+NQRDAD+L  W K+     GS  K  A
Sbjct  240  DMLFLFQGFDPAKSS---IRNRPLPMPSLKGAINQRDADILFMWRKYEKLNAGSEEKQRA  296

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD+SI  +GKL+FG +KGP +L + R +G PLVDDW CL++ VR FE
Sbjct  297  LREVKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLQAARGSGQPLVDDWDCLRTMVRVFE  356

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKHMR+ ANICN G+SE  M EAS  AC  +    W+ L  G S 
Sbjct  357  SQCGSLTQYGMKHMRAFANICNNGVSEAEMKEASISACDGYDMGKWNPLVLGHST  411



>emb|CBX26639.1| vacuolar processing enzyme 2c [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LF Y G NPAN N        L L     A+NQRDAD+L  W ++     GS  K   
Sbjct  328  EKLFHYQGFNPANSNVA----NRLLLPDLEGAINQRDADILFMWKRYEKLNGGSEEKLGV  383

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E ++HR HLD+SI  +GKL+FG E GP VL + R++G PLVDDW CLK  VR FE
Sbjct  384  LREIKETVAHRKHLDSSIDFIGKLVFGFENGPSVLEAARSSGQPLVDDWDCLKRMVRVFE  443

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKHMR+ ANICN G+SE +M EAS  AC  +    WS L  G SA
Sbjct  444  SQCGSLTQYGMKHMRAFANICNNGVSEAQMREASISACGGYNLAKWSPLDLGHSA  498



>gb|KJB51882.1| hypothetical protein B456_008G236100 [Gossypium raimondii]
Length=491

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA+ NF       L       A+NQRDAD+L  W  ++N+ +GS +K E 
Sbjct  320  EKLYLYQGFDPASVNFP---PNELSHDTQMEAINQRDADILFLWHMYKNSEDGS-KKKEI  375

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ +E + HR HLD SI L+G +L+G  KG  +LN+IR  GLPLVDDW CLKS VR FE
Sbjct  376  LKQISETMRHRIHLDGSIDLIGTVLYGPAKGSVILNTIREPGLPLVDDWQCLKSMVRLFE  435

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC-PSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMR+ ANICN+ +S+  M EA   AC  S     W     G+SA
Sbjct  436  THCGSLTQYGMKHMRAFANICNSDVSQSAMEEACVAACSSSHDPTQWHPSNNGYSA  491



>ref|XP_002509577.1| Vacuolar-processing enzyme precursor [Ricinus communis]
 sp|P49042.1|VPE_RICCO RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Ricinus communis]
 dbj|BAA04225.1| precursor of vacuolar processing enzyme [Ricinus communis]
 gb|EEF50964.1| Vacuolar-processing enzyme precursor [Ricinus communis]
Length=497

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 112/175 (64%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L+L+ G +PA+ NF      +  L+AP   VNQRDA+L   W  ++ +  GS +K E 
Sbjct  326  DKLYLFQGFDPASVNFP---PNNAHLNAPMEVVNQRDAELHFMWQLYKRSENGSEKKKEI  382

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             +Q  +AI HR+HLD+S+ L+G LLFG +K   +L S+R  G PLVDDW CLKS VR FE
Sbjct  383  LQQIKDAIKHRSHLDSSMQLIGDLLFGPKKASAILKSVREPGSPLVDDWGCLKSMVRVFE  442

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            T CGSL+QYGMKHMR+ ANICNAG+S   M EA   AC    +  W     G+SA
Sbjct  443  TCCGSLTQYGMKHMRTFANICNAGVSHTSMEEACNAACSGHDAGQWHPTNQGYSA  497



>emb|CAQ00098.1| legumain [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 108/173 (62%), Gaps = 4/173 (2%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            LFLY G +PA  + T      L L   + A+NQRDAD+L  W K+     GS  K  A +
Sbjct  319  LFLYQGFDPAKSSIT----NRLPLPILKGAINQRDADVLFMWKKYEQLNGGSEEKHRALR  374

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
               E + HR HLD+SI  +GKL+FG +KGP +L + R +G PLVDDW CLK  VR FE+ 
Sbjct  375  DIKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLQAARGSGQPLVDDWDCLKRMVRVFESQ  434

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            CGSL+QYGMKHMR+ ANICN G+SE  M EAS  AC  +    W+ L  G SA
Sbjct  435  CGSLTQYGMKHMRAFANICNNGVSEAEMKEASISACGGYDMGRWNPLVLGHSA  487



>gb|EMT00724.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=477

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 107/175 (61%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + LFLY G  PAN N        L L     A+NQRDAD+L  W ++     GS  K   
Sbjct  307  EKLFLYQGFGPANSNVA----NRLLLPELEGAINQRDADILFMWKRYEKLNGGSEEKQRV  362

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD+SI  +GKL+FG E GP ++ + R++G PLVDDW CLK  VR FE
Sbjct  363  LREIKETVVHRKHLDSSIDFIGKLVFGFENGPSMIEAARSSGQPLVDDWDCLKRTVRVFE  422

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKHMR+ ANICN GIS   M EAS  AC  + S  WS L  G SA
Sbjct  423  SQCGSLTQYGMKHMRAFANICNNGISGAEMREASISACGGYDSAKWSPLAVGHSA  477



>gb|EYU24761.1| hypothetical protein MIMGU_mgv1a005235mg [Erythranthe guttata]
Length=492

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 111/175 (63%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA EN        +K+      VNQRDAD+L  W++++   +G+  K+E 
Sbjct  321  EKLYLYQGFDPATENLP---PNGIKVKERMDVVNQRDADVLFLWERYKKMEDGTKAKAEF  377

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K  TE + HR HLD S+ ++G  LFG +KGP +L ++R  GLPL DDW CLKS VR FE
Sbjct  378  LKVITETMLHREHLDGSVDIIGLALFGPDKGPSILKTVRRRGLPLADDWDCLKSTVRLFE  437

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSL+QYGMKHMR+ ANICN+G+   R+ EA   AC       WS L  G+SA
Sbjct  438  AHCGSLTQYGMKHMRAFANICNSGVPLSRIEEACMAACGGRDIAKWSPLNRGYSA  492



>ref|XP_009382344.1| PREDICTED: legumain-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 116/177 (66%), Gaps = 5/177 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L LY G  PA  N T   E +L+L  P   +NQRDADLL  W  +  + E S++K E 
Sbjct  335  DVLSLYQGFEPAIANVT---ENALRLRMPMGVINQRDADLLFMWKMYEQSDERSSKKKEI  391

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ T+ + HR HLD+SI  +G  +FG E GP +L ++R +G  LVDDW CLKS VRAFE
Sbjct  392  LEEITKTLMHRVHLDSSIDYIGNQIFGSEIGPSILRAVRPSGQALVDDWECLKSMVRAFE  451

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYS--WSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN GIS++ M  A +++C S+   +  WS    GFSA
Sbjct  452  SHCGSLTQYGMKHMRAFANICNEGISKDVMEAACSRSCKSYDGAAAMWSPSHRGFSA  508



>ref|XP_008796848.1| PREDICTED: vacuolar-processing enzyme [Phoenix dactylifera]
Length=491

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 116/175 (66%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L+L+ G +P+N N +      L  + P  A+NQRDADLL  W ++      S +K++ 
Sbjct  319  DKLYLFQGFDPSNANLS---GNGLPPTMPTGAINQRDADLLFLWKRYEQLDARSEKKTQV  375

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K+ TE + HR HLDNSI+L+GKL+FG E GP +LN++R +G  LVDDW+CLK+ V+ F+
Sbjct  376  LKEITETMMHRLHLDNSINLIGKLIFGSENGPSILNAVRPSGQALVDDWNCLKTMVQVFQ  435

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            ++CG L+Q+GM+HMR+ AN+CN GIS + MVEA    C S  S  WS     +SA
Sbjct  436  SYCGPLTQHGMRHMRAFANLCNRGISNDAMVEACVNTCGSHISAKWSPSSREYSA  490



>ref|XP_002886459.1| F23N19.7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62718.1| F23N19.7 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+ Y G +PA  N      K L +++    VNQRDADLL  W  +R + +GS +K + 
Sbjct  363  EKLYFYQGFDPATVNLPL---KKLPVNSQVGVVNQRDADLLFLWHMYRASEDGSRKKDDT  419

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K+ TE   HR HLD S+ L+G +LFG      VLNS+R  GLPLVDDW CLKS VRAFE
Sbjct  420  LKELTETTRHRKHLDASVELIGTILFG--PAMNVLNSVREPGLPLVDDWECLKSMVRAFE  477

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSF  286
            THCGSL+QYGMKHMR+ AN+CN G+S+E M EASA AC  +
Sbjct  478  THCGSLTQYGMKHMRAFANVCNNGVSKELMEEASAAACGGY  518



>ref|XP_007039931.1| Beta vacuolar processing enzyme [Theobroma cacao]
 gb|EOY24432.1| Beta vacuolar processing enzyme [Theobroma cacao]
Length=543

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 113/170 (66%), Gaps = 7/170 (4%)
 Frame = -1

Query  753  YMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQKQFT  574
            Y G +P++ENF   +   ++      AVNQRDAD+L  W  ++N+ +GS +K+E  +Q T
Sbjct  381  YQGFDPSSENFPPNELTHME------AVNQRDADILFLWHMYKNSEDGS-KKTEILRQIT  433

Query  573  EAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETHCGS  394
            E I HR HLD SI L+G LL+G  KG  +LNS+R  GLPLVDDW CLKS VR FETHCG 
Sbjct  434  ETIRHRIHLDGSIDLIGTLLYGPAKGSGILNSVREPGLPLVDDWQCLKSMVRLFETHCGL  493

Query  393  LSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            L+QYGMKHMR+ AN+CN+G+S+  M +A   AC    +  W     G+SA
Sbjct  494  LTQYGMKHMRAFANLCNSGVSQSLMEQACVAACSGHDTRQWHPSNQGYSA  543



>gb|EMT17626.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=621

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLY G +PA    +++  +  +L + + A+NQRDAD+L  W+K+     GS  K  A
Sbjct  451  DMLFLYQGFDPAK---SYIPNRQ-RLPSLKGAINQRDADILFMWNKYEKLNGGSEEKQRA  506

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD+SI  +GKL+FG +KGP +L ++R +G PLVDDW CLK+ VR FE
Sbjct  507  LREVKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLGAVRGSGQPLVDDWYCLKTMVRVFE  566

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+ YGMKHMR+ ANICN G+S+ +M EAS  AC  +    WS L  G SA
Sbjct  567  SQCGSLTWYGMKHMRAFANICNNGVSKTKMKEASISACDGYDLGKWSPLVQGHSA  621



>ref|XP_006838620.1| hypothetical protein AMTR_s00002p00231730, partial [Amborella 
trichopoda]
 gb|ERN01189.1| hypothetical protein AMTR_s00002p00231730, partial [Amborella 
trichopoda]
Length=218

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 107/159 (67%), Gaps = 4/159 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRR-AVNQRDADLLHFWDKFRNAPEGSARKSE  592
            + L+LY G +PAN N +   + SL L   R   VNQRDADLL  W +++ + EGS  K  
Sbjct  44   ERLYLYQGFDPANANLS---DNSLPLQPNRMDVVNQRDADLLFLWQRYKRSTEGSEEKVA  100

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
             + + TE ++HR HLD S+ L+G+LLFG +KG  VL + R +G  LVDDWSCLKS VRAF
Sbjct  101  FRNEMTEKMAHREHLDKSVDLIGRLLFGWDKGSNVLGAKRPSGKALVDDWSCLKSMVRAF  160

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC  295
            E  CG L+QYGMKHMR+ ANICN GIS E M +A  + C
Sbjct  161  EEKCGPLTQYGMKHMRAFANICNEGISLEVMSKACEEVC  199



>emb|CAQ00097.1| legumain [Hordeum vulgare subsp. vulgare]
Length=486

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 109/168 (65%), Gaps = 3/168 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLY G +PA  +   +  + L + + + A+NQRDAD+L  W K+     GS  K  A
Sbjct  317  DMLFLYQGFDPAKSS---IRNRPLPMPSLKGAINQRDADILFMWRKYEKLNAGSEEKQRA  373

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD+SI  +GKL+FG +KGP VL + R +G PLVDDW CL++ VR FE
Sbjct  374  LREVKETVLHRKHLDSSIDFIGKLVFGFDKGPSVLQAARGSGQPLVDDWDCLRTMVRVFE  433

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSS  265
            + CGSL+QYG +HMR+ ANICN G+SE  M EAS  AC  +   SW S
Sbjct  434  SQCGSLTQYGTRHMRAFANICNNGVSEAEMKEASISACDGYDMGSWGS  481



>gb|EYU34366.1| hypothetical protein MIMGU_mgv1a018579mg [Erythranthe guttata]
Length=491

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 111/175 (63%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA EN        +++      VNQRDAD+L  W++++   +G+  K+E 
Sbjct  320  EKLYLYQGFDPATENLP---PNGIEVKERMDVVNQRDADVLFLWERYKKMEDGTKAKAEF  376

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K  TE + HR HLD S+ ++G  LFG +KGP +L ++R  GLPL DDW CLKS VR FE
Sbjct  377  LKVITETMLHREHLDGSVDIIGLALFGPDKGPSILKTVRRRGLPLADDWDCLKSTVRLFE  436

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
             HCGSL+QYGMKHMR+ ANICN+G+   R+ EA   AC       WS L  G+SA
Sbjct  437  AHCGSLTQYGMKHMRAFANICNSGVPLSRIEEACMAACGGRDIAKWSPLNRGYSA  491



>gb|ABS57371.1| VPE1 [Triticum aestivum]
Length=494

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 111/175 (63%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D LFLY G +PA  +   +  + L + + + A+ QRDAD+L  W K+     GS  K  A
Sbjct  323  DMLFLYQGFDPAKSS---IRNRPLPMPSLKGAIKQRDADILFMWKKYGKLNGGSEEKQRA  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD+SI  +GKL+FG +KGP VL + R +G PLVDDW CLK+ VR FE
Sbjct  380  LREVKETVLHRKHLDSSIDFIGKLVFGFDKGPLVLEAARGSGQPLVDDWDCLKTMVRVFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            + CGSL+QYGMKH R+ AN+CN G SE  M EAS  AC  +    WS L  G+SA
Sbjct  440  SQCGSLTQYGMKHTRAFANMCNNGASEAEMKEASISACDGYDMGKWSPLVRGYSA  494



>emb|CBX26640.1| vacuolar processing enzyme 2d [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 107/173 (62%), Gaps = 4/173 (2%)
 Frame = -1

Query  762  LFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEAQK  583
            LFLY G +PA  + T      L L   + A+NQRDAD+L  W K+     GS  K  A +
Sbjct  325  LFLYQGFDPAKSSIT----NRLPLPILKGAINQRDADVLFMWKKYEQLNGGSEEKHRALR  380

Query  582  QFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFETH  403
               E + HR HLD+SI  +GKL+FG +KGP +L + R +G PLVDDW CLK  VR FE+ 
Sbjct  381  DIKETVLHRKHLDSSIDFIGKLVFGFDKGPSMLQAARGSGQPLVDDWDCLKRMVRVFESQ  440

Query  402  CGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            CGSL+QYGMKHMR+ ANICN G+ E  M EAS  AC  +    W+ L  G SA
Sbjct  441  CGSLTQYGMKHMRAFANICNNGVPEAEMKEASINACDGYDMGRWNPLVLGHSA  493



>ref|XP_010093667.1| Vacuolar-processing enzyme [Morus notabilis]
 gb|EXB54447.1| Vacuolar-processing enzyme [Morus notabilis]
Length=501

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 110/175 (63%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  NF   D    KL      VNQRDA+L   W  ++   E   +K E 
Sbjct  330  EKLYLYQGFDPATLNFPPNDPN--KLDMRMEVVNQRDAELFFMWQMYKRT-ESRNKKREI  386

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
              Q  EA  HRTHLD SI L+G LL+G +KG  VLNS+R+ G PLVDDW+CLKS V++FE
Sbjct  387  LNQIKEATRHRTHLDKSIELIGSLLYGPQKGSLVLNSVRSPGQPLVDDWACLKSMVKSFE  446

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCGSL+QYGMKHMR+ ANICN+G+S   M EA+   C       W    GGFSA
Sbjct  447  SHCGSLTQYGMKHMRAFANICNSGVSVASMEEAALAVCSGHDVGQWHPSNGGFSA  501



>ref|XP_006391830.1| hypothetical protein EUTSA_v10023430mg [Eutrema salsugineum]
 gb|ESQ29116.1| hypothetical protein EUTSA_v10023430mg [Eutrema salsugineum]
Length=484

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 109/163 (67%), Gaps = 6/163 (4%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  N        L + +P   VNQRDADLL  W  +R + +GS RK E 
Sbjct  315  EKLYLYQGFDPATVNLP---PNELPVKSPVGVVNQRDADLLFLWHMYRTSEDGS-RKDEI  370

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K+ T+ + HR HLD S+ L+G +LFG      VLNS+R  GLPLVDDW CLKS VR FE
Sbjct  371  LKEITDQMRHRKHLDASVELIGMILFGPTT--NVLNSVREPGLPLVDDWECLKSMVRVFE  428

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPS  280
            THCGSL+QYGMKHMR+ AN+CN G+S+E M +ASA AC  + S
Sbjct  429  THCGSLTQYGMKHMRAFANVCNNGVSKELMEKASAAACGGYES  471



>ref|XP_004245119.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=451

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 110/160 (69%), Gaps = 4/160 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D+L +YMG+N      T         ++  R VNQRD  LL+   KF+NAPEGS RKSEA
Sbjct  296  DALSIYMGSNFP----THTSSTKNNYASNSRHVNQRDVQLLYLISKFQNAPEGSRRKSEA  351

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ +E I  R H+DNS+  +G++LFG+E GP+VLN +R  G PLVDDW CLKSFV+ FE
Sbjct  352  YRKLSEVILKREHVDNSVKHIGQILFGVENGPKVLNIVRPAGQPLVDDWDCLKSFVKIFE  411

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPS  289
            +HCGSL++YG K++R  AN+CNAGI  ++M  A+ Q C S
Sbjct  412  SHCGSLTRYGKKYVRGFANMCNAGIQRDQMDAAAKQTCSS  451



>ref|XP_010430341.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Camelina 
sativa]
Length=487

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 5/161 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  N        L + +    VNQRDADLL  W  +R + +GS +K + 
Sbjct  316  EKLYLYQGFDPATVNLP---PNELLVKSQVGVVNQRDADLLFLWHMYRTSEDGSRKKDDT  372

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K+ TE   HR HLD+S+ L+G +LFG      +LNSIR  GLPLVDDW CLKS VR FE
Sbjct  373  LKELTETTRHRKHLDSSVELIGTVLFG--PAMNILNSIREPGLPLVDDWECLKSTVRVFE  430

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSF  286
            THCGSL+QYGMKHMR+ AN+CN G+S+E M EASA AC  +
Sbjct  431  THCGSLTQYGMKHMRAFANVCNNGVSKELMEEASAAACGGY  471



>gb|AAL40390.1| C13 cysteine proteinase precursor [Oryza sativa Indica Group]
Length=465

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 109/175 (62%), Gaps = 4/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            D L+LY G +PAN       +  L    P+ A NQRDADLL  W ++    + S  K +A
Sbjct  295  DKLYLYQGFDPANAEV----KNKLSWEGPKAAANQRDADLLFLWRRYELLHDKSEEKLKA  350

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++ ++ + HR  LD+S+ LVGKLL G   GP VL ++  +G PLVDDW CLK  VR FE
Sbjct  351  LREISDTVMHRKLLDSSVDLVGKLLLGFGNGPSVLQAVSPSGQPLVDDWDCLKRMVRIFE  410

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            +HCG L+QYGMKHMR+ ANICN GIS   M EAS   C S  S  WSSL  G+SA
Sbjct  411  SHCGPLTQYGMKHMRAFANICNNGISGASMKEASIATCSSHNSGRWSSLVQGYSA  465



>ref|XP_001759301.1| predicted protein [Physcomitrella patens]
 gb|EDQ75985.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 122/187 (65%), Gaps = 7/187 (4%)
 Frame = -1

Query  783  LEQNVDSLFLYMGTNPANENFT---FVDEK-SLKLSA-PRRAVNQRDADLLHFWDKFRNA  619
            L+   + L  Y+G +PANEN T   F+ E  +++L     R +NQRDADL+H+W ++  +
Sbjct  310  LKMKPEELDQYLGYDPANENVTGPIFLREYLAIRLGGVEERHINQRDADLVHYWHRYHKS  369

Query  618  PEGSARKSEAQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWS  439
              GS  K+EA+      +SHR ++D S+ LVG+LLFG+E GP  L+++R  GLPL DDW+
Sbjct  370  KVGSTAKAEAELDLMRILSHRMYIDKSVDLVGRLLFGVEAGPTTLSAVRPDGLPLTDDWA  429

Query  438  CLKSFVRAFETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACP--SFPSYSWSS  265
            CLKS V AFE  CG LS+YGMKHMR+ ANICNAG+   +M   +A+AC   +F S +   
Sbjct  430  CLKSMVSAFELSCGELSEYGMKHMRAFANICNAGVEPSKMSGVAAEACAVSAFGSGTLQI  489

Query  264  LRGGFSA  244
               GFSA
Sbjct  490  PTTGFSA  496



>ref|XP_010473493.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Camelina 
sativa]
Length=487

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 5/161 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  N        L + +    VNQRDAD+L  W  +R + +GS +K + 
Sbjct  316  EKLYLYQGFDPATVNLP---PNELLVKSQVGVVNQRDADILFLWHMYRTSEDGSRKKDDT  372

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K+ TE   HR HLD S+ L+G +LFG      VLNSIR  GLPLVDDW CLKS VR FE
Sbjct  373  LKELTETTRHRKHLDASVELIGTVLFG--PAMNVLNSIREPGLPLVDDWECLKSTVRVFE  430

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSF  286
            THCGSL+QYGMKHMR+ AN+CN GIS+E M EASA AC  +
Sbjct  431  THCGSLTQYGMKHMRAFANVCNNGISKELMEEASAAACGGY  471



>ref|XP_008437131.1| PREDICTED: legumain [Cucumis melo]
Length=495

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA+ N    + + L++ +   A+NQRDAD+   W  +R   +G+  K++ 
Sbjct  322  ERLYLYQGFDPASVNLPPYNGR-LEMKS-MEAINQRDADIFFLWQMYRKFEDGTNEKAQI  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E ++HR+HLD SI ++G LLFG EKG  VL+ +RA+GLPLVDDW CLKS VR  E
Sbjct  380  LEEIRETVTHRSHLDGSIRMIGFLLFGPEKGSNVLDDVRASGLPLVDDWECLKSMVRVLE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYS-WSSLRGGFSA  244
            ++CGSL+QYGMKHMR++ANICN G+SE  M EAS  AC     Y  W     G+SA
Sbjct  440  SYCGSLTQYGMKHMRALANICNRGVSEASMREASMAACNGGGGYGLWHPSNRGYSA  495



>ref|XP_007155624.1| hypothetical protein PHAVU_003G217500g [Phaseolus vulgaris]
 gb|ESW27618.1| hypothetical protein PHAVU_003G217500g [Phaseolus vulgaris]
Length=493

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 112/175 (64%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  NF      + +L +    VNQRDA+LL  W  ++ +     +K++ 
Sbjct  322  EKLYLYHGFDPATVNFP---PHNGRLKSKMEVVNQRDAELLFMWQMYQRSNHLPEKKTDI  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ  E + HR HLD S+ L+G LL+G EK   VL S+R TGLPLVDDW+CLKS VR +E
Sbjct  379  LKQIEEIVKHRKHLDGSVELIGVLLYGPEKASSVLRSVRTTGLPLVDDWTCLKSMVRVYE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMR+ ANICN+G+SE  M +A   AC  + +        G+SA
Sbjct  439  THCGSLTQYGMKHMRAFANICNSGVSETSMEKACVAACGGYHAGLLHPSNTGYSA  493



>ref|XP_004298668.1| PREDICTED: legumain [Fragaria vesca subsp. vesca]
Length=493

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY+G +PA+ NF      + +L      VNQRDA++   W  ++ +  GS +K E 
Sbjct  322  EKLYLYLGFDPASVNFP---PNNGQLEQHMEVVNQRDAEIFFMWQLYKRSEHGSEKKREI  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ  + ++HR H+D SI  +G  L+G + G  VLNS+R  GLPLVDDW CLKS VR FE
Sbjct  379  LKQIRDTMNHRNHIDGSIKFIGTFLYGPKNGATVLNSVRPLGLPLVDDWECLKSMVRVFE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC  295
            THCGSL+QYGMKHMR+ ANICN+G+S+ +M EAS  AC
Sbjct  439  THCGSLTQYGMKHMRAFANICNSGVSQAQMEEASWAAC  476



>sp|O24326.1|VPE2_PHAVU RecName: Full=Vacuolar-processing enzyme; AltName: Full=Pv-VPE; 
Flags: Precursor [Phaseolus vulgaris]
 emb|CAB17079.1| legumain-like proteinase precursor [Phaseolus vulgaris]
Length=493

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 112/175 (64%), Gaps = 3/175 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  NF      + +L +    VNQRDA+LL  W  ++ +     +K++ 
Sbjct  322  EKLYLYHGFDPATVNFP---PHNGRLKSKMEVVNQRDAELLFMWQVYQRSNHLPEKKTDI  378

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             KQ  E + HR HLD S+ L+G LL+G EK   VL S+R TGLPLVDDW+CLKS VR +E
Sbjct  379  LKQIEEIVKHRKHLDGSVELIGVLLYGPEKASSVLRSVRTTGLPLVDDWTCLKSMVRVYE  438

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSFPSYSWSSLRGGFSA  244
            THCGSL+QYGMKHMR+ ANICN+G+SE  M +A   AC  + +        G+SA
Sbjct  439  THCGSLTQYGMKHMRAFANICNSGVSETSMEKACVAACGGYHAGLLHPSNTGYSA  493



>ref|XP_007209951.1| hypothetical protein PRUPE_ppa004795mg [Prunus persica]
 gb|EMJ11150.1| hypothetical protein PRUPE_ppa004795mg [Prunus persica]
Length=491

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 105/159 (66%), Gaps = 3/159 (2%)
 Frame = -1

Query  771  VDSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSE  592
            V+ L+LY G +PA+ NF      + +L  P   VNQRDA+L   W  ++ +  GS +K+ 
Sbjct  319  VEKLYLYQGFDPASLNFP---PNNGQLEKPMEVVNQRDAELFFMWQMYKRSEHGSEKKTH  375

Query  591  AQKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAF  412
              +Q  E + HRTHLD SI  +G  L+G  KG   LNS+RA GLPLVDDW CLKS VR F
Sbjct  376  ILEQIKETMGHRTHLDASIEFIGTFLYGPGKGFSTLNSVRALGLPLVDDWECLKSMVRVF  435

Query  411  ETHCGSLSQYGMKHMRSIANICNAGISEERMVEASAQAC  295
            ET CG L+QYGMKHMR+ ANICN+G+++  M EA + AC
Sbjct  436  ETQCGLLTQYGMKHMRAFANICNSGVTQSEMEEACSAAC  474



>ref|XP_003608766.1| Vacuolar-processing enzyme [Medicago truncatula]
Length=487

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  N    ++K   L +    VNQRDA++L  W+ ++     + +K E 
Sbjct  316  EKLYLYQGFDPATVNLPPHNDK---LESKMEVVNQRDAEILFMWEMYKRLDHQTEKKREI  372

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD S+ L+G LLFG  KG  VL ++RATGLPLVDDW CLKS VR FE
Sbjct  373  LEKIAETVKHRNHLDGSVELIGVLLFGPTKGSSVLQAVRATGLPLVDDWECLKSRVRLFE  432

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSF  286
            THCGSL+QYGMKHMR+ ANICN+GISE+ M +A   AC  +
Sbjct  433  THCGSLTQYGMKHMRAFANICNSGISEDSMEKACMVACGGY  473



>gb|AES90963.2| vacuolar processing enzyme [Medicago truncatula]
Length=494

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  N    ++K   L +    VNQRDA++L  W+ ++     + +K E 
Sbjct  323  EKLYLYQGFDPATVNLPPHNDK---LESKMEVVNQRDAEILFMWEMYKRLDHQTEKKREI  379

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             ++  E + HR HLD S+ L+G LLFG  KG  VL ++RATGLPLVDDW CLKS VR FE
Sbjct  380  LEKIAETVKHRNHLDGSVELIGVLLFGPTKGSSVLQAVRATGLPLVDDWECLKSRVRLFE  439

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSF  286
            THCGSL+QYGMKHMR+ ANICN+GISE+ M +A   AC  +
Sbjct  440  THCGSLTQYGMKHMRAFANICNSGISEDSMEKACMVACGGY  480



>ref|XP_010418271.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Camelina 
sativa]
Length=487

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 105/161 (65%), Gaps = 5/161 (3%)
 Frame = -1

Query  768  DSLFLYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKFRNAPEGSARKSEA  589
            + L+LY G +PA  N        L + +    VNQRDAD+L  W  +R + EGS +K + 
Sbjct  316  EKLYLYQGFDPATVNLP---PNELLVKSQVGVVNQRDADILFLWHMYRTSEEGSRKKDDT  372

Query  588  QKQFTEAISHRTHLDNSISLVGKLLFGIEKGPEVLNSIRATGLPLVDDWSCLKSFVRAFE  409
             K+ TE   HR HLD S+ L+G +LFG      VLNSIR  GLPLVDDW CLKS VR FE
Sbjct  373  LKELTETTRHRKHLDASVELIGTVLFG--PAMNVLNSIREPGLPLVDDWECLKSTVRVFE  430

Query  408  THCGSLSQYGMKHMRSIANICNAGISEERMVEASAQACPSF  286
            THCGSL+QYGMKHMR+ AN+CN G+ +E M EASA AC  +
Sbjct  431  THCGSLTQYGMKHMRAFANVCNNGVPKELMEEASAAACGGY  471



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195