BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF048A14

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006368110.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    299   1e-96   Solanum tuberosum [potatoes]
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    305   2e-95   Solanum tuberosum [potatoes]
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    305   3e-95   
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    305   1e-94   Solanum lycopersicum
ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        303   5e-94   Nicotiana tomentosiformis
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        295   1e-90   Nicotiana sylvestris
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    291   2e-89   
emb|CDP07225.1|  unnamed protein product                                290   1e-88   Coffea canephora [robusta coffee]
gb|AGK82806.1|  alcohol oxidase                                         288   1e-88   Solanum lycopersicum
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    288   2e-88   
gb|AGK82821.1|  alcohol oxidase                                         288   3e-88   Solanum pimpinellifolium [currant tomato]
gb|AGK82832.1|  alcohol oxidase                                         287   6e-88   Solanum habrochaites
gb|AGK82825.1|  alcohol oxidase                                         286   1e-87   Solanum pennellii
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        285   9e-87   Eucalyptus grandis [rose gum]
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    283   2e-86   Sesamum indicum [beniseed]
ref|XP_011072475.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    280   3e-86   
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...    287   5e-86   
ref|XP_010274420.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    281   9e-86   
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    282   1e-85   Eucalyptus grandis [rose gum]
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    280   2e-85   Sesamum indicum [beniseed]
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    280   3e-85   
gb|KDP37817.1|  hypothetical protein JCGZ_06719                         275   6e-85   Jatropha curcas
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    279   8e-85   Citrus sinensis [apfelsine]
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             279   9e-85   Citrus clementina [clementine]
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                  276   2e-84   Citrus sinensis [apfelsine]
ref|XP_002519938.1|  electron carrier, putative                         275   7e-84   Ricinus communis
ref|XP_006385149.1|  alcohol oxidase-related family protein             276   7e-84   
gb|KDP37816.1|  hypothetical protein JCGZ_06718                         276   1e-83   Jatropha curcas
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        275   5e-83   Populus euphratica
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        275   6e-83   Vitis vinifera
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                272   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    271   9e-82   Nelumbo nucifera [Indian lotus]
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        270   1e-81   Prunus mume [ume]
gb|KHN11789.1|  Long-chain-alcohol oxidase FAO4A                        266   4e-81   Glycine soja [wild soybean]
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  270   4e-81   Medicago truncatula
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    269   8e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            268   2e-80   Medicago truncatula
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             268   2e-80   
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  268   3e-80   
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    267   6e-80   Cicer arietinum [garbanzo]
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    267   9e-80   
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    266   1e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    266   1e-79   Glycine max [soybeans]
ref|XP_004167305.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    261   1e-79   
ref|XP_004150760.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    261   2e-79   Cucumis sativus [cucumbers]
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    262   7e-79   Cucumis melo [Oriental melon]
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    263   1e-78   Cicer arietinum [garbanzo]
gb|KHN27504.1|  Long-chain-alcohol oxidase FAO4A                        259   1e-78   Glycine soja [wild soybean]
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             263   2e-78   Phaseolus vulgaris [French bean]
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    263   3e-78   Glycine max [soybeans]
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    262   4e-78   Cucumis melo [Oriental melon]
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    260   3e-77   Glycine max [soybeans]
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             259   7e-77   Phaseolus vulgaris [French bean]
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   258   2e-76   
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    256   4e-76   Glycine max [soybeans]
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        256   4e-76   Glycine soja [wild soybean]
emb|CDY66156.1|  BnaA01g34950D                                          248   2e-75   Brassica napus [oilseed rape]
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    252   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    249   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_006283178.1|  hypothetical protein CARUB_v10004208mg             246   1e-73   
emb|CDX99382.1|  BnaC01g11700D                                          243   2e-73   
ref|XP_008382148.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    248   4e-73   
emb|CAA18625.1|  putative protein                                       246   6e-73   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61567.1|  hypothetical protein M569_13229                         246   1e-72   Genlisea aurea
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                246   1e-72   Erythranthe guttata [common monkey flower]
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728             245   2e-72   
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                      245   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg             245   3e-72   Capsella rubella
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        245   4e-72   Brassica rapa
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg             243   1e-71   
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    243   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        243   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    241   1e-70   Camelina sativa [gold-of-pleasure]
gb|EPS64229.1|  hypothetical protein M569_10552                         240   1e-70   Genlisea aurea
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    240   3e-70   Brassica rapa
emb|CBI29206.3|  unnamed protein product                                238   4e-70   Vitis vinifera
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    239   1e-69   Phoenix dactylifera
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    236   7e-69   Arabis alpina [alpine rockcress]
emb|CDY01593.1|  BnaC07g35830D                                          236   1e-68   
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        236   1e-68   Elaeis guineensis
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    236   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_006878629.1|  hypothetical protein AMTR_s00011p00262370          224   3e-64   Amborella trichopoda
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    220   8e-63   Phoenix dactylifera
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        216   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     207   3e-58   Eucalyptus grandis [rose gum]
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     206   5e-58   Eucalyptus grandis [rose gum]
gb|ABR17814.1|  unknown                                                 205   2e-57   Picea sitchensis
ref|XP_006857358.1|  hypothetical protein AMTR_s00067p00112750          204   3e-57   
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1         199   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1         198   3e-55   Sesamum indicum [beniseed]
gb|KFK39637.1|  hypothetical protein AALP_AA3G269600                    198   4e-55   Arabis alpina [alpine rockcress]
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1         198   5e-55   Prunus mume [ume]
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg             197   7e-55   
emb|CDO99261.1|  unnamed protein product                                197   1e-54   Coffea canephora [robusta coffee]
ref|XP_011462285.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...    196   2e-54   Fragaria vesca subsp. vesca
ref|XP_006354464.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    196   2e-54   Solanum tuberosum [potatoes]
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3         196   2e-54   Brassica rapa
emb|CDX85097.1|  BnaC07g08090D                                          196   3e-54   
emb|CDP11641.1|  unnamed protein product                                196   3e-54   Coffea canephora [robusta coffee]
ref|XP_004296386.1|  PREDICTED: long-chain-alcohol oxidase FAO1 i...    196   3e-54   Fragaria vesca subsp. vesca
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1         195   4e-54   Populus euphratica
ref|XP_004157702.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    188   5e-54   
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    195   5e-54   Solanum tuberosum [potatoes]
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1         195   5e-54   Nicotiana sylvestris
ref|XP_011459707.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    192   8e-54   Fragaria vesca subsp. vesca
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    194   9e-54   
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    194   9e-54   Nelumbo nucifera [Indian lotus]
ref|XP_002464495.1|  hypothetical protein SORBIDRAFT_01g019470          194   1e-53   Sorghum bicolor [broomcorn]
gb|AAL31049.1|AC078893_12  putative oxidase                             192   1e-53   Oryza sativa Japonica Group [Japonica rice]
gb|AAL31027.1|AC078948_11  putative alcohol oxidase                     193   1e-53   Oryza sativa Japonica Group [Japonica rice]
gb|AAL31021.1|AC078948_5  putative alcohol oxidase                      192   1e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    194   2e-53   Nicotiana tomentosiformis
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    194   2e-53   Cucumis sativus [cucumbers]
tpg|DAA49655.1|  TPA: hypothetical protein ZEAMMB73_468308              189   2e-53   
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    193   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_006589282.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    192   2e-53   
gb|KHN30591.1|  Long-chain-alcohol oxidase FAO1                         192   2e-53   Glycine soja [wild soybean]
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    193   2e-53   
ref|XP_002464496.1|  hypothetical protein SORBIDRAFT_01g019480          193   3e-53   
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    193   3e-53   Eucalyptus grandis [rose gum]
gb|ACF88407.1|  unknown                                                 189   3e-53   Zea mays [maize]
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1         193   3e-53   Eucalyptus grandis [rose gum]
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                     193   3e-53   Eucalyptus grandis [rose gum]
gb|EMS51759.1|  Long-chain-alcohol oxidase FAO2                         190   3e-53   Triticum urartu
ref|NP_001176205.1|  Os10g0474966                                       192   4e-53   
ref|XP_001763007.1|  predicted protein                                  193   4e-53   
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    192   4e-53   Setaria italica
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                         192   4e-53   Glycine soja [wild soybean]
gb|ACF22878.1|  alcohol oxidase                                         192   4e-53   Glycine max [soybeans]
gb|EAY78905.1|  hypothetical protein OsI_34008                          191   4e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    192   5e-53   Glycine max [soybeans]
emb|CDX92985.1|  BnaA03g37070D                                          192   5e-53   
ref|XP_006589281.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    192   7e-53   Glycine max [soybeans]
gb|EEE51131.1|  hypothetical protein OsJ_31875                          191   7e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002314488.2|  alcohol oxidase-related family protein             192   7e-53   
emb|CDX94858.1|  BnaC03g43300D                                          192   8e-53   
gb|ACR36076.1|  unknown                                                 189   1e-52   Zea mays [maize]
ref|NP_001064839.2|  Os10g0474800                                       190   1e-52   
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1         191   1e-52   Solanum lycopersicum
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1         191   1e-52   Zea mays [maize]
ref|XP_002464494.1|  hypothetical protein SORBIDRAFT_01g019460          189   1e-52   
ref|XP_004493801.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    191   1e-52   Cicer arietinum [garbanzo]
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    191   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA49654.1|  TPA: hypothetical protein ZEAMMB73_468308              189   2e-52   
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    191   2e-52   Brachypodium distachyon [annual false brome]
ref|XP_006379996.1|  hypothetical protein POPTR_0008s18750g             185   2e-52   
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1         190   2e-52   Vitis vinifera
emb|CAN71289.1|  hypothetical protein VITISV_019349                     190   2e-52   Vitis vinifera
ref|XP_010512451.1|  PREDICTED: long-chain-alcohol oxidase FAO3         190   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    190   3e-52   Brassica rapa
gb|AAL31024.1|AC078948_8  putative alcohol oxidase                      190   3e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007144044.1|  hypothetical protein PHAVU_007G124200g             190   3e-52   Phaseolus vulgaris [French bean]
gb|AAP54248.2|  GMC oxidoreductase family protein, expressed            190   3e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007035186.1|  Alcohol oxidase, putative isoform 4                189   4e-52   
ref|XP_010102592.1|  Long-chain-alcohol oxidase FAO1                    190   4e-52   
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    190   4e-52   Elaeis guineensis
ref|XP_007132926.1|  hypothetical protein PHAVU_011G136600g             190   4e-52   Phaseolus vulgaris [French bean]
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    189   5e-52   Phoenix dactylifera
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    189   5e-52   Lotus japonicus
ref|NP_001142399.1|  uncharacterized protein LOC100274574               189   7e-52   Zea mays [maize]
ref|XP_010488398.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    189   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...    189   8e-52   Zea mays [maize]
ref|XP_007035183.1|  Fatty alcohol oxidase 3 isoform 1                  189   1e-51   
ref|XP_003574052.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    189   1e-51   Brachypodium distachyon [annual false brome]
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g             188   1e-51   Phaseolus vulgaris [French bean]
ref|XP_007035188.1|  Fatty alcohol oxidase 3 isoform 6                  188   1e-51   
gb|AES61079.2|  long-chain-alcohol oxidase FAO1-like protein            186   1e-51   Medicago truncatula
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    188   1e-51   Eucalyptus grandis [rose gum]
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1         188   1e-51   Cucumis melo [Oriental melon]
dbj|BAJ86655.1|  predicted protein                                      188   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                    188   1e-51   Morus notabilis
ref|XP_003607676.1|  Annotation was added to scaffolds in Novembe...    187   1e-51   
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein            188   2e-51   Glycine soja [wild soybean]
gb|KJB10007.1|  hypothetical protein B456_001G179800                    187   2e-51   Gossypium raimondii
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    188   2e-51   Glycine max [soybeans]
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    188   2e-51   Populus euphratica
gb|KGN56837.1|  hypothetical protein Csa_3G134850                       187   2e-51   
emb|CDX89850.1|  BnaA10g02320D                                          188   2e-51   
gb|KGN53996.1|  hypothetical protein Csa_4G246910                       175   2e-51   
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein            188   2e-51   Medicago truncatula
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    187   2e-51   Fragaria vesca subsp. vesca
gb|KJB10006.1|  hypothetical protein B456_001G179800                    187   3e-51   Gossypium raimondii
gb|KJB10008.1|  hypothetical protein B456_001G179800                    187   3e-51   Gossypium raimondii
ref|XP_003590828.1|  Annotation was added to scaffolds in Novembe...    186   3e-51   
ref|XP_002889487.1|  hypothetical protein ARALYDRAFT_470376             187   4e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg             187   4e-51   Citrus clementina [clementine]
ref|XP_006296686.1|  hypothetical protein CARUB_v10013046mg             187   4e-51   Capsella rubella
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    187   4e-51   Cucumis sativus [cucumbers]
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855             187   4e-51   
gb|AAD10696.1|  Unknown protein                                         187   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050220.1|  Alcohol oxidase                                    187   4e-51   
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                   187   5e-51   Citrus sinensis [apfelsine]
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein            187   5e-51   Medicago truncatula
emb|CAC87643.1|  alcohol oxidase                                        186   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171895.2|  long-chain-alcohol oxidase FAO1                       187   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532671.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    186   5e-51   Tarenaya hassleriana [spider flower]
gb|KEH23951.1|  long-chain-alcohol oxidase FAO1                         185   5e-51   Medicago truncatula
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg                186   7e-51   Erythranthe guttata [common monkey flower]
gb|KJB38384.1|  hypothetical protein B456_006G252500                    186   7e-51   Gossypium raimondii
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621              186   8e-51   
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                       186   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531              186   8e-51   
ref|XP_006489751.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    184   1e-50   
ref|XP_002454188.1|  hypothetical protein SORBIDRAFT_04g026370          186   1e-50   Sorghum bicolor [broomcorn]
gb|EPS58840.1|  hypothetical protein M569_15969                         185   1e-50   Genlisea aurea
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    186   1e-50   Glycine max [soybeans]
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    186   1e-50   Phoenix dactylifera
ref|XP_010532672.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    186   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_006406028.1|  hypothetical protein EUTSA_v10020141mg             185   1e-50   Eutrema salsugineum [saltwater cress]
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                         185   2e-50   Gossypium arboreum [tree cotton]
gb|KDP26499.1|  hypothetical protein JCGZ_17657                         185   2e-50   Jatropha curcas
ref|XP_002528823.1|  disulfide oxidoreductase, putative                 185   2e-50   Ricinus communis
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1         185   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010526493.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    185   2e-50   Tarenaya hassleriana [spider flower]
gb|KFK42743.1|  hypothetical protein AALP_AA1G034000                    184   3e-50   Arabis alpina [alpine rockcress]
ref|XP_004247518.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    184   3e-50   Solanum lycopersicum
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2         184   3e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006306477.1|  hypothetical protein CARUB_v10012453mg             184   4e-50   Capsella rubella
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    184   4e-50   Prunus mume [ume]
ref|XP_002311685.2|  alcohol oxidase-related family protein             184   5e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006412937.1|  hypothetical protein EUTSA_v10024496mg             182   5e-50   
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg             184   5e-50   Citrus clementina [clementine]
ref|XP_004982883.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    183   5e-50   Setaria italica
sp|B5WWZ9.1|FAO2_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    184   6e-50   Lotus japonicus
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    183   7e-50   
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    183   7e-50   Citrus sinensis [apfelsine]
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    183   7e-50   Setaria italica
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                         183   8e-50   Medicago truncatula
ref|XP_009119340.1|  PREDICTED: long-chain-alcohol oxidase FAO1         183   8e-50   Brassica rapa
gb|KDP40361.1|  hypothetical protein JCGZ_02359                         183   1e-49   Jatropha curcas
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg             182   1e-49   Citrus clementina [clementine]
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    182   1e-49   Elaeis guineensis
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1         182   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg             182   1e-49   Prunus persica
ref|XP_006418179.1|  hypothetical protein EUTSA_v10006882mg             182   2e-49   Eutrema salsugineum [saltwater cress]
gb|KJB72415.1|  hypothetical protein B456_011G177100                    182   2e-49   Gossypium raimondii
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                         182   2e-49   Gossypium arboreum [tree cotton]
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    182   2e-49   Camelina sativa [gold-of-pleasure]
gb|KJB72416.1|  hypothetical protein B456_011G177100                    182   2e-49   Gossypium raimondii
ref|XP_010475034.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    182   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006412936.1|  hypothetical protein EUTSA_v10024496mg             182   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2         181   3e-49   Nicotiana sylvestris
gb|KJB72414.1|  hypothetical protein B456_011G177100                    181   4e-49   Gossypium raimondii
ref|XP_010548742.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    181   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    181   5e-49   Cicer arietinum [garbanzo]
ref|XP_010532673.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    181   6e-49   Tarenaya hassleriana [spider flower]
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    180   8e-49   
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg             181   8e-49   Capsella rubella
ref|XP_002272123.2|  PREDICTED: long-chain-alcohol oxidase FAO2-like    180   1e-48   Vitis vinifera
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    180   1e-48   Setaria italica
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg                180   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_011080082.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    179   2e-48   Sesamum indicum [beniseed]
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2         179   2e-48   Nicotiana tomentosiformis
emb|CDX92884.1|  BnaC07g41420D                                          179   3e-48   
gb|KFK29401.1|  hypothetical protein AALP_AA7G128800                    179   3e-48   Arabis alpina [alpine rockcress]
ref|XP_011080081.1|  PREDICTED: long-chain-alcohol oxidase FAO2         178   4e-48   Sesamum indicum [beniseed]
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    178   4e-48   Solanum tuberosum [potatoes]
ref|XP_009137800.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        178   4e-48   Brassica rapa
gb|EYU46424.1|  hypothetical protein MIMGU_mgv1a001883mg                178   4e-48   Erythranthe guttata [common monkey flower]
emb|CDX77516.1|  BnaA07g06540D                                          167   9e-48   
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906             177   9e-48   Arabidopsis lyrata subsp. lyrata
dbj|BAK00483.1|  predicted protein                                      176   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP03771.1|  unnamed protein product                                177   1e-47   Coffea canephora [robusta coffee]
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                      177   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAK64154.1|  unknown protein                                         177   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63097.1|  unknown                                                 177   2e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51703.1|  BnaA03g58930D                                          176   2e-47   Brassica napus [oilseed rape]
ref|XP_010447958.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    176   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002454190.1|  hypothetical protein SORBIDRAFT_04g026390          177   2e-47   Sorghum bicolor [broomcorn]
ref|XP_002529832.1|  electron carrier, putative                         176   3e-47   Ricinus communis
dbj|BAK02336.1|  predicted protein                                      176   4e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010433200.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        174   9e-47   Camelina sativa [gold-of-pleasure]
gb|ACF87929.1|  unknown                                                 171   1e-46   Zea mays [maize]
emb|CDY18199.1|  BnaC05g02220D                                          174   2e-46   Brassica napus [oilseed rape]
ref|XP_008382898.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    173   2e-46   
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    174   2e-46   Cicer arietinum [garbanzo]
gb|EEE51130.1|  hypothetical protein OsJ_31873                          173   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001761391.1|  predicted protein                                  173   3e-46   
ref|XP_010438427.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    173   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010523169.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    172   8e-46   
gb|EMT04470.1|  Putative GMC-type oxidoreductase                        172   2e-45   
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    170   4e-45   
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    170   5e-45   
gb|ACN27562.1|  unknown                                                 169   7e-45   
gb|EEC73620.1|  hypothetical protein OsI_08118                          169   9e-45   
ref|NP_001047464.1|  Os02g0621800                                       169   1e-44   
ref|NP_001148058.1|  oxidoreductase                                     168   2e-44   
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684              167   4e-44   
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601              167   4e-44   
gb|EEE57396.1|  hypothetical protein OsJ_07570                          169   5e-44   
gb|EPS66779.1|  hypothetical protein M569_07992                         166   7e-44   
ref|XP_002981110.1|  hypothetical protein SELMODRAFT_114089             166   7e-44   
ref|XP_002982582.1|  hypothetical protein SELMODRAFT_116855             166   9e-44   
ref|XP_002994642.1|  hypothetical protein SELMODRAFT_138935             166   9e-44   
ref|XP_001753124.1|  predicted protein                                  166   9e-44   
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    166   1e-43   
ref|XP_009369441.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    166   1e-43   
ref|XP_009369442.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    165   2e-43   
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    163   1e-42   
gb|AGC65582.1|  fatty alcohol oxidase                                   159   5e-41   
gb|EEC67160.1|  hypothetical protein OsI_34014                          154   1e-39   
emb|CEP11610.1|  hypothetical protein                                   145   4e-36   
dbj|GAN06400.1|  long chain fatty acid oxidase                          142   5e-35   
gb|EPB86823.1|  hypothetical protein HMPREF1544_06348                   141   8e-35   
emb|CEI89775.1|  hypothetical protein RMCBS344292_04123                 140   2e-34   
emb|CEG67601.1|  hypothetical protein RMATCC62417_04004                 140   2e-34   
gb|EIE83566.1|  hypothetical protein RO3G_08271                         139   2e-34   
emb|CDS08066.1|  hypothetical protein LRAMOSA02015                      139   3e-34   
emb|CEG74394.1|  hypothetical protein RMATCC62417_09621                 139   5e-34   
emb|CEJ01770.1|  hypothetical protein RMCBS344292_15791                 138   8e-34   
emb|CBI23676.3|  unnamed protein product                                135   5e-33   
ref|XP_005644346.1|  FAD/NAD(P)-binding domain-containing protein       134   6e-33   
ref|XP_010501308.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    134   3e-32   
gb|KFH71384.1|  hypothetical protein MVEG_01683                         132   9e-32   
ref|WP_040443572.1|  hypothetical protein                               131   1e-31   
gb|EFH90466.1|  glucose-methanol-choline oxidoreductase                 130   4e-31   
ref|XP_004361070.1|  glucose-methanol-choline oxidoreductase            131   6e-31   
ref|XP_005650828.1|  FAD/NAD(P)-binding domain-containing protein       128   8e-31   
emb|CEP11230.1|  hypothetical protein                                   130   1e-30   
dbj|GAN00881.1|  conserved hypothetical protein                         129   2e-30   
gb|KFH44797.1|  Long-chain-alcohol oxidase-like protein                 128   5e-30   
ref|XP_003328562.1|  hypothetical protein PGTG_10521                    127   8e-30   
gb|EXX66452.1|  hypothetical protein RirG_123640                        125   4e-29   
dbj|GAN00882.1|  long chain fatty acid oxidase                          125   5e-29   
gb|EPB87889.1|  hypothetical protein HMPREF1544_05296                   125   6e-29   
ref|XP_009831227.1|  hypothetical protein, variant 5                    124   8e-29   
gb|KEQ82382.1|  long-chain fatty alcohol dehydrogenase                  124   1e-28   
ref|XP_009831226.1|  hypothetical protein, variant 4                    123   1e-28   
emb|CBI37146.3|  unnamed protein product                                122   1e-28   
ref|XP_009831229.1|  hypothetical protein, variant 1                    124   2e-28   
ref|XP_009831225.1|  hypothetical protein H257_07411                    124   2e-28   
gb|KHN10761.1|  Long-chain-alcohol oxidase FAO2                         121   3e-28   
gb|EPB87888.1|  hypothetical protein HMPREF1544_05295                   122   6e-28   
ref|XP_011124651.1|  hypothetical protein AOL_s00097g516                122   7e-28   
gb|ADG38493.1|  AT3G23410-like protein                                  113   2e-27   
ref|WP_019946571.1|  hypothetical protein                               120   2e-27   
gb|ADG38491.1|  AT3G23410-like protein                                  113   3e-27   
gb|ADG38490.1|  AT3G23410-like protein                                  113   3e-27   
gb|EKG12277.1|  Glucose-methanol-choline oxidoreductase                 119   5e-27   
ref|XP_002841296.1|  hypothetical protein                               119   5e-27   
gb|KFH47883.1|  Long-chain-alcohol oxidase-like protein                 119   6e-27   
gb|ADG38496.1|  AT3G23410-like protein                                  112   7e-27   
ref|WP_029214956.1|  hypothetical protein                               119   7e-27   
gb|ESA06032.1|  hypothetical protein GLOINDRAFT_82554                   118   7e-27   
gb|ADG38495.1|  AT3G23410-like protein                                  112   7e-27   
gb|KDO33323.1|  hypothetical protein SPRG_02132                         119   7e-27   
ref|XP_008615139.1|  hypothetical protein SDRG_10901                    119   1e-26   
ref|XP_008871235.1|  hypothetical protein H310_07607                    118   1e-26   
ref|XP_006692351.1|  hypothetical protein CTHT_0018560                  118   2e-26   
ref|WP_044510213.1|  hypothetical protein                               117   3e-26   
ref|XP_003018036.1|  hypothetical protein TRV_07960                     117   4e-26   
ref|XP_002182547.1|  predicted protein                                  117   4e-26   
gb|EGD92018.2|  hypothetical protein TERG_08235                         112   5e-26   
ref|XP_003171263.1|  fatty alcohol oxidase                              116   7e-26   
ref|WP_044018575.1|  hypothetical protein                               115   7e-26   
gb|KEQ64225.1|  long-chain fatty alcohol dehydrogenase                  116   8e-26   
gb|AII52338.1|  hypothetical protein N008_10155                         115   9e-26   
ref|XP_002842592.1|  long chain fatty acid oxidase                      115   1e-25   
ref|WP_040788581.1|  oxidoreductase                                     115   1e-25   
ref|WP_040833364.1|  oxidoreductase                                     115   1e-25   
gb|EEQ89581.1|  long chain fatty alcohol oxidase                        115   2e-25   
ref|XP_002622231.1|  long chain fatty alcohol oxidase                   115   2e-25   
ref|XP_003011696.1|  hypothetical protein ARB_02250                     114   3e-25   
gb|KFX48806.1|  Long-chain-alcohol oxidase FAO2                         114   3e-25   
ref|XP_002147053.1|  long chain fatty alcohol oxidase, putative         114   4e-25   
ref|WP_018162755.1|  hypothetical protein                               113   4e-25   
ref|WP_033369528.1|  hypothetical protein                               113   5e-25   
ref|WP_042261336.1|  oxidoreductase                                     113   5e-25   
ref|XP_007684042.1|  GMC oxidoreductase                                 113   7e-25   
gb|EME47783.1|  hypothetical protein DOTSEDRAFT_69651                   113   7e-25   
emb|CCH79163.1|  Oxidoreductase GMC-type                                112   1e-24   
ref|XP_003231449.1|  long chain fatty alcohol oxidase                   112   1e-24   
ref|WP_035567966.1|  hypothetical protein                               112   1e-24   
ref|WP_040786198.1|  oxidoreductase                                     112   1e-24   
gb|EZF29717.1|  hypothetical protein H101_06625                         112   2e-24   
gb|EZF27387.1|  hypothetical protein H100_00625                         112   2e-24   
gb|EZF78359.1|  hypothetical protein H105_00612                         112   2e-24   
ref|WP_022566024.1|  MULTISPECIES: putative oxidoreductase              111   2e-24   
ref|WP_039798089.1|  oxidoreductase                                     111   2e-24   
ref|XP_003654573.1|  hypothetical protein THITE_2117674                 112   2e-24   
ref|WP_040766272.1|  oxidoreductase                                     111   2e-24   
ref|WP_030525445.1|  oxidoreductase                                     111   3e-24   
gb|EWC47090.1|  hypothetical protein DRE_03459                          111   3e-24   
gb|EUN25552.1|  hypothetical protein COCVIDRAFT_39053                   111   3e-24   
gb|EGD99881.1|  long chain fatty alcohol oxidase                        111   3e-24   
ref|XP_007706606.1|  hypothetical protein COCCADRAFT_81154              111   4e-24   
ref|XP_009831231.1|  hypothetical protein H257_07412                    111   4e-24   
ref|XP_010529119.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    110   4e-24   
ref|WP_043738716.1|  oxidoreductase                                     110   4e-24   
ref|WP_039822949.1|  oxidoreductase                                     110   5e-24   
ref|XP_007697741.1|  hypothetical protein COCSADRAFT_295770             110   6e-24   
ref|WP_040872144.1|  oxidoreductase                                     110   6e-24   
ref|WP_029932851.1|  oxidoreductase                                     110   7e-24   
gb|EEC67159.1|  hypothetical protein OsI_34012                          110   7e-24   
gb|EEH19591.1|  hypothetical protein PABG_07795                         110   8e-24   
ref|XP_629786.1|  glucose-methanol-choline oxidoreductase               110   8e-24   
ref|WP_043692605.1|  oxidoreductase                                     109   9e-24   
ref|XP_002788971.1|  long chain fatty acid oxidase                      110   9e-24   
ref|XP_007680563.1|  hypothetical protein BAUCODRAFT_274597             110   1e-23   
emb|CDX98615.1|  BnaA03g44000D                                          109   1e-23   
ref|XP_658227.1|  hypothetical protein AN0623.2                         110   1e-23   
ref|WP_039808649.1|  oxidoreductase                                     109   1e-23   
ref|WP_026850921.1|  hypothetical protein                               109   1e-23   
gb|EMD94921.1|  hypothetical protein COCHEDRAFT_1201414                 109   1e-23   
ref|XP_001904377.1|  hypothetical protein                               109   1e-23   
ref|WP_034349962.1|  GMC oxidoreductase                                 109   1e-23   
ref|WP_014442627.1|  putative oxidoreductase                            108   2e-23   
gb|KFY48297.1|  hypothetical protein V495_01464                         109   2e-23   
gb|KFY64266.1|  hypothetical protein V496_03367                         109   2e-23   
gb|ELR10689.1|  hypothetical protein GMDG_04950                         108   2e-23   
ref|WP_010889387.1|  GMC oxidoreductase                                 108   2e-23   
ref|WP_025352553.1|  oxidoreductase                                     108   2e-23   
ref|XP_011024801.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    108   2e-23   
ref|WP_029902619.1|  oxidoreductase                                     108   2e-23   
ref|XP_002543430.1|  conserved hypothetical protein                     107   2e-23   
ref|XP_001227812.1|  hypothetical protein CHGG_09885                    108   3e-23   
emb|CEP11229.1|  hypothetical protein                                   108   3e-23   
gb|KFY10153.1|  hypothetical protein V492_05166                         108   3e-23   
gb|EMF15130.1|  long-chain fatty alcohol dehydrogenase                  108   3e-23   
ref|XP_010762144.1|  hypothetical protein PADG_06552                    108   4e-23   
ref|WP_040382972.1|  GMC oxidoreductase                                 108   4e-23   
ref|XP_003665019.1|  hypothetical protein MYCTH_103590                  108   4e-23   
ref|XP_003855144.1|  hypothetical protein MYCGRDRAFT_37086              108   4e-23   
gb|KHG08529.1|  Long-chain-alcohol oxidase FAO2                         107   5e-23   
ref|WP_040794704.1|  oxidoreductase                                     107   5e-23   
gb|EZG10707.1|  long chain fatty alcohol oxidase                        107   8e-23   
ref|WP_039363498.1|  oxidoreductase                                     107   8e-23   
ref|WP_036542894.1|  oxidoreductase                                     107   9e-23   
dbj|GAM35263.1|  hypothetical protein TCE0_017r03459                    107   9e-23   
ref|WP_043664884.1|  oxidoreductase                                     107   1e-22   
gb|KFZ00641.1|  hypothetical protein V501_10589                         107   1e-22   
ref|WP_044005244.1|  hypothetical protein                               106   1e-22   
gb|KFZ24759.1|  hypothetical protein V502_00763                         105   1e-22   
gb|AHJ99440.1|  hypothetical protein Hsw_3845                           106   1e-22   
gb|KFY36052.1|  hypothetical protein V494_05366                         106   1e-22   
ref|WP_036545967.1|  oxidoreductase                                     106   1e-22   
dbj|BAD55823.1|  putative oxidoreductase                                106   1e-22   
ref|WP_041559871.1|  oxidoreductase                                     106   2e-22   
ref|WP_034389156.1|  GMC oxidoreductase                                 106   2e-22   
ref|XP_009831228.1|  hypothetical protein, variant 3                    106   2e-22   
ref|WP_027004897.1|  hypothetical protein                               106   2e-22   
ref|XP_009831230.1|  hypothetical protein, variant 2                    106   2e-22   
ref|XP_001268562.1|  long chain fatty alcohol oxidase, putative         106   2e-22   
ref|WP_034353012.1|  GMC oxidoreductase                                 105   3e-22   
gb|KFY79221.1|  hypothetical protein V499_01756                         106   3e-22   
ref|WP_020101185.1|  hypothetical protein                               105   3e-22   
gb|EYB69467.1|  GMC oxidoreductase                                      105   3e-22   
gb|KIN05921.1|  hypothetical protein OIDMADRAFT_189585                  105   3e-22   
ref|WP_024806286.1|  oxidoreductase                                     105   4e-22   
ref|WP_027460446.1|  GMC oxidoreductase                                 105   4e-22   
ref|XP_007837981.1|  hypothetical protein PFICI_11209                   105   4e-22   
ref|WP_014985326.1|  oxidoreductase                                     105   5e-22   
ref|WP_017869768.1|  MULTISPECIES: hypothetical protein                 104   5e-22   
ref|WP_029120493.1|  GMC oxidoreductase                                 104   6e-22   
gb|KEQ78490.1|  putative long chain fatty alcohol oxidase               105   6e-22   
gb|KFY98584.1|  hypothetical protein V500_01604                         105   7e-22   
gb|KIW04861.1|  hypothetical protein PV09_04043                         104   8e-22   
gb|AGQ19576.1|  MedDCM-OCT-S38-C2-cds46                                 103   8e-22   
ref|WP_014351288.1|  oxidoreductase                                     104   8e-22   
ref|WP_032385620.1|  hypothetical protein                               104   8e-22   
gb|EMS23820.1|  long chain fatty alcohol oxidase                        104   8e-22   
emb|CDR40807.1|  RHTO0S05e07470g1_1                                     104   8e-22   
ref|XP_001243546.1|  hypothetical protein CIMG_02987                    104   8e-22   
gb|EHL01767.1|  putative Long-chain-alcohol oxidase FAO2                104   9e-22   
gb|EPS25096.1|  hypothetical protein PDE_00027                          104   1e-21   
gb|EFW14100.1|  long chain fatty alcohol oxidase                        104   1e-21   
ref|XP_003071927.1|  GMC oxidoreductase family protein                  104   1e-21   
ref|XP_003294587.1|  hypothetical protein DICPUDRAFT_159608             104   1e-21   
ref|XP_008084965.1|  FAD/NAD(P)-binding protein                         104   1e-21   
ref|WP_013285320.1|  oxidoreductase                                     103   1e-21   
ref|XP_003051757.1|  hypothetical protein NECHADRAFT_37686              103   1e-21   
gb|ERS99077.1|  hypothetical protein HMPREF1624_04272                   104   1e-21   
ref|WP_033090122.1|  oxidoreductase                                     103   1e-21   
gb|KIH94120.1|  long-chain fatty alcohol dehydrogenase                  103   1e-21   
ref|WP_040749116.1|  oxidoreductase                                     103   1e-21   
ref|XP_002479333.1|  long chain fatty alcohol oxidase, putative         104   1e-21   
dbj|GAM49565.1|  oxidoreductase                                         103   2e-21   
ref|WP_021030799.1|  hypothetical protein                               103   2e-21   
gb|EGU13115.1|  Long chain fatty alcohol oxidase                        103   2e-21   
gb|KGO40669.1|  Alcohol dehydrogenase, long-chain fatty                 103   2e-21   
ref|WP_028654089.1|  oxidoreductase                                     103   2e-21   
gb|KFY28599.1|  hypothetical protein V491_00390                         100   2e-21   
gb|EHA26798.1|  long chain fatty alcohol oxidase                        103   2e-21   
ref|XP_001389382.1|  long chain fatty alcohol oxidase                   103   2e-21   
gb|KFY31288.1|  hypothetical protein V493_01243                         102   3e-21   
ref|WP_033245952.1|  MULTISPECIES: oxidoreductase                       102   3e-21   
ref|XP_001591990.1|  hypothetical protein SS1G_07437                    102   3e-21   
gb|EWM21472.1|  glucose-methanol-choline oxidoreductase                 103   3e-21   
gb|KEY78297.1|  long chain fatty alcohol oxidase                        102   3e-21   
ref|XP_753079.1|  long chain fatty alcohol oxidase                      102   3e-21   
gb|KFY27803.1|  hypothetical protein V493_03299                         102   3e-21   
gb|EYE98796.1|  putative long chain fatty alcohol oxidase               102   3e-21   
gb|EHK24705.1|  hypothetical protein TRIVIDRAFT_54537                   102   4e-21   
ref|WP_030270415.1|  oxidoreductase                                     102   4e-21   
ref|WP_012826512.1|  glucose-methanol-choline oxidoreductase            102   4e-21   
dbj|GAM23381.1|  hypothetical protein SAMD00019534_065560               102   4e-21   
gb|EMT02982.1|  Putative GMC-type oxidoreductase                        101   5e-21   
ref|XP_002618046.1|  hypothetical protein CLUG_01505                    102   5e-21   
ref|WP_011741213.1|  oxidoreductase                                     102   5e-21   
emb|CBJ27378.1|  oxidoreductase                                         102   5e-21   



>ref|XP_006368110.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like, partial [Solanum 
tuberosum]
Length=389

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGAVIQTP LHPG+FSALMPW SG +FKMRMS+Y+RTA+IF LARDKGSGEA SP S
Sbjct  195  GSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFALARDKGSGEALSPYS  254

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            ++Y LD+TDEENL+ GLEK LRILAAAGAEEIG     G +LKV +AS  EFERFVKEES
Sbjct  255  ISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASLKEFERFVKEES  314

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S  + KH     SAHQMGSCRMGVDPK SVVN KGETWEVEGLF+GD SV PTA+GVNPM
Sbjct  315  SIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPM  374

Query  148  VTIXSVSYCISQSXL  104
            VTI ++SYC +QS L
Sbjct  375  VTIQAISYCTAQSVL  389



>ref|XP_006359948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=707

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 165/201 (82%), Gaps = 0/201 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGAVIQTP LHPG+FSALMPW SG +FKMRMS+Y+RTA+IF LARDKGSGEA SP S
Sbjct  504  GSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFALARDKGSGEALSPYS  563

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            ++Y LD+TDEENL+ GLEK LRILAAAGAEEIG     G +LKV +AS  EFERFVKEES
Sbjct  564  ISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASLKEFERFVKEES  623

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S  + KH     SAHQMGSCRMGVDPK SVVN KGETWEVEGLF+GD SV PTA+GVNPM
Sbjct  624  SIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPM  683

Query  148  VTIXSVSYCISQSXLEFLKTH  86
            VTI ++SYC +QS L+ LK  
Sbjct  684  VTIQAISYCTAQSVLQLLKNQ  704



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 165/201 (82%), Gaps = 0/201 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGAVIQTP LHPG+FSALMPW SG +FKMRMS+Y+RTA+IF LARDKGSGEA SP S
Sbjct  499  GSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFALARDKGSGEALSPYS  558

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            ++Y LD+TDEENL+ GLEK LRILAAAGAEEIG     G +LKV +AS  EFERFVKEES
Sbjct  559  ISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASLKEFERFVKEES  618

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S  + KH     SAHQMGSCRMGVDPK SVVN KGETWEVEGLF+GD SV PTA+GVNPM
Sbjct  619  SIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPM  678

Query  148  VTIXSVSYCISQSXLEFLKTH  86
            VTI ++SYC +QS L+ LK  
Sbjct  679  VTIQAISYCTAQSVLQLLKNQ  699



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 165/201 (82%), Gaps = 0/201 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGAVIQTP LHPG+FSALMPW SG +FKMRMS+Y+RTA+IF LARDKGSGEAFSP S
Sbjct  573  GSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFALARDKGSGEAFSPYS  632

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            V+Y LD+TDEENL+ GLEK LRILAAAGAEEIG     G +LKV +AS  EFERFV+EES
Sbjct  633  VSYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASTKEFERFVREES  692

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S  + KH     SAHQMGSCRMG DPK SVVN KGETWEVEGLF+GD SV PTA+GVNPM
Sbjct  693  SIEIGKHSVPICSAHQMGSCRMGTDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPM  752

Query  148  VTIXSVSYCISQSXLEFLKTH  86
            VTI ++SYC +QS L+ LK  
Sbjct  753  VTIQAISYCTAQSVLQLLKNQ  773



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   303 bits (776),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 163/201 (81%), Gaps = 0/201 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGA+IQTP LHPG+FSALMPW SG + KMRM +Y+RTA+I  LARDKGSGEAFSP S
Sbjct  570  GSGYGAIIQTPGLHPGMFSALMPWVSGLDIKMRMCKYSRTAYILALARDKGSGEAFSPYS  629

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            VTY +D+ DEENL+ GLEK+LRILAAAGAEEIG  HG G +LKVKDAS  EFERFVKEES
Sbjct  630  VTYKMDQIDEENLKLGLEKMLRILAAAGAEEIGTQHGKGRSLKVKDASLKEFERFVKEES  689

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S  +  H     SAHQMGSCRMGVDP  SVVN KGE WEVEGLF+GD SV PTA+GVNPM
Sbjct  690  SIEIGNHSVPICSAHQMGSCRMGVDPTTSVVNSKGELWEVEGLFLGDSSVFPTAIGVNPM  749

Query  148  VTIXSVSYCISQSXLEFLKTH  86
            VTI ++SYC +QS ++ LK  
Sbjct  750  VTIQAISYCTAQSVVQLLKNQ  770



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGA+IQTP LHPG+FSALMPW SG + KMRM +Y+RTA++  LARD GSGEAFSP S
Sbjct  569  GSGYGAIIQTPGLHPGMFSALMPWVSGLDIKMRMCKYSRTAYLLALARDMGSGEAFSPYS  628

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            VTY +D+ DEENL+ GLEK+LRILAAAGAE IG  HG G +L VKD S  EFERFVKEES
Sbjct  629  VTYKMDRIDEENLKLGLEKMLRILAAAGAEAIGTQHGKGRSLNVKDESLKEFERFVKEES  688

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S  +  H     SAHQMGSCRMG DP  SVVN KGETWEVEGLF+GD SV PTA+GVNPM
Sbjct  689  SIKIGNHSVPICSAHQMGSCRMGEDPTTSVVNSKGETWEVEGLFLGDSSVFPTAIGVNPM  748

Query  148  VTIXSVSYCISQSXLEFLKTH  86
            VTI ++SYC +QS L+ LK  
Sbjct  749  VTIQAISYCTAQSVLQLLKNQ  769



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYG VIQTPALHPG+FS +MPW SG + KMRM +Y+RTAHIF LARDKGSGEA S  S+
Sbjct  543  SGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGEAISSNSI  602

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G TLKVK++S  EFE FVKEESS
Sbjct  603  SYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGKTLKVKESSVDEFESFVKEESS  662

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +  +       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVNPMV
Sbjct  663  RGFKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMV  722

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ ++SYC +Q+ L+ LK
Sbjct  723  TVQAISYCTAQNVLQVLK  740



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGAVIQTPALHPG+FSALMPW SG++FK RM +++RTAH+F LARDKGSG+   P S
Sbjct  593  GSGYGAVIQTPALHPGMFSALMPWTSGRDFKDRMCKFSRTAHVFALARDKGSGKLLYPNS  652

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            +TY++DK DEEN++RGLEK+LRILA+AGAEEIG +H  G ++ VK  S  EF++FVKEES
Sbjct  653  ITYNMDKIDEENIKRGLEKVLRILASAGAEEIGTHHVKGRSINVKKVSYTEFDKFVKEES  712

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+SL+       SAHQMGSCRMGVDPK SV NP GETWE+EGL++ D SV PTALGVNPM
Sbjct  713  SRSLKDLATPICSAHQMGSCRMGVDPKISVANPIGETWEIEGLYLADSSVFPTALGVNPM  772

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ +++YC +QS LE L+
Sbjct  773  VTVQAIAYCTAQSVLESLR  791



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  682  GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            GYG VIQTPALHPG+FS +MPW SG + KMRM +Y+RTAHIF LARDKGSGE  SP S++
Sbjct  545  GYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYSIS  604

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G   KVK++S  EFE FVKEESS+
Sbjct  605  YKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSR  664

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVNPM+T
Sbjct  665  GLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLT  724

Query  142  IXSVSYCISQSXLEFLK  92
            + ++SYC +Q+ L+ LK
Sbjct  725  VQAISYCTAQNVLQLLK  741



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  682  GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            GYG VIQTPALHPG+FS +MPW SG + KMRM +Y+RTAHIF LARDKGSGE  SP S++
Sbjct  573  GYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYSIS  632

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G   KVK++S  EFE FVKEESS+
Sbjct  633  YKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSR  692

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVNPM+T
Sbjct  693  GLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLT  752

Query  142  IXSVSYCISQSXLEFLK  92
            + ++SYC +Q+ L+ LK
Sbjct  753  VQAISYCTAQNVLQLLK  769



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   288 bits (736),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  682  GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            GYG VIQTP+LHPG+FS +MPW SG + KMRM +Y+RTAHIF LARDKGSGE  SP S++
Sbjct  545  GYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYSIS  604

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G   KVK++S  EFE FVKEESS+
Sbjct  605  YKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSR  664

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVNPM+T
Sbjct  665  GLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLT  724

Query  142  IXSVSYCISQSXLEFLK  92
            + ++SYC +Q+ L+ LK
Sbjct  725  VQAISYCTAQNVLQLLK  741



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   287 bits (734),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 160/200 (80%), Gaps = 0/200 (0%)
 Frame = -2

Query  682  GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            GYG VIQTP+LHPG+FS +MPW SG + KMRM +Y+RTAHIF LARDKGSGE  SP S++
Sbjct  545  GYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYSIS  604

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G   KVK++S  EFE FVKEESS+
Sbjct  605  YKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSR  664

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVNPM+T
Sbjct  665  GLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLT  724

Query  142  IXSVSYCISQSXLEFLKTHD  83
            + ++SYC +Q+ L+ LK  +
Sbjct  725  VQAISYCTAQNVLQLLKAKN  744



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  682  GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            GYG VIQTP+LHPG+FS +MPW SG + KMRM +Y+RTAHIF LARDKGSGE  SP S++
Sbjct  545  GYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYSIS  604

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y LD+ DE+N++ G+EKLLRILAAAGAEEIG +H  G   KVK++S  EFE FVKEESS+
Sbjct  605  YKLDQIDEQNIKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKEESSR  664

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVNPM+T
Sbjct  665  GLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPMLT  724

Query  142  IXSVSYCISQSXLEFLK  92
            + ++SYC +Q+ L+ LK
Sbjct  725  VQAISYCTAQNVLQLLK  741



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   285 bits (729),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            N +GYGAVIQTPALHPG+FSALMPW SG + K RM++++RTAH+F LARDKGSG   S T
Sbjct  609  NKSGYGAVIQTPALHPGMFSALMPWTSGLDMKERMTKFSRTAHLFTLARDKGSGTITSST  668

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
            S++Y +D  DE+NLQ+GLEK+LRILAAAGAEEIG +HG G TLKVK  S  EFE+FVKEE
Sbjct  669  SISYKMDDADEQNLQKGLEKVLRILAAAGAEEIGSHHGEGKTLKVKQVSYHEFEQFVKEE  728

Query  331  SSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
            S++S++       SAHQMGSCRMG DP++S VNP GETWEVEGL+V D SV PTALGVNP
Sbjct  729  SARSIKGLSTPICSAHQMGSCRMGPDPRSSAVNPMGETWEVEGLYVADTSVFPTALGVNP  788

Query  151  MVTIXSVSYCISQSXLEFLK  92
            MVT+ +++YC +QS LE L+
Sbjct  789  MVTVQAIAYCTAQSVLEALR  808



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGA+IQTP+LHPG+FS LMPW SG + K RM +++RTAH+F LARDKGSG   S T +
Sbjct  553  SGYGAIIQTPSLHPGIFSLLMPWISGIDMKNRMVKFSRTAHVFALARDKGSGVITSETDI  612

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y L+  D+ENL +GLEK +RILAAAGAEEIG +H TG  LKVK AS  EFERFVKEES 
Sbjct  613  SYKLEDFDQENLSKGLEKCMRILAAAGAEEIGTHHSTGRVLKVKQASEKEFERFVKEESL  672

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L+K     ASAHQMGSCRMGVDPK SVVNPKGETWEVEGLFV D SV PTALGVNPMV
Sbjct  673  RPLQKLSAPIASAHQMGSCRMGVDPKGSVVNPKGETWEVEGLFVADSSVFPTALGVNPMV  732

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ + +YCI+QS L+ L+
Sbjct  733  TVQATAYCIAQSVLQILE  750



>ref|XP_011072475.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Sesamum 
indicum]
Length=671

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYG VIQTP LHPG+FS LMPW SG + K RM +++RT HIF LARDKGSG+  S T+V
Sbjct  469  SGYGTVIQTPILHPGMFSLLMPWISGTDMKNRMVKFSRTTHIFALARDKGSGKITSETNV  528

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y L+ +D+ENL +GLEK++RI+AAAGAEEIG  H TG  LKVK AS  EFERFVKEES 
Sbjct  529  SYKLEYSDQENLSKGLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQASEEEFERFVKEESL  588

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L+K      SAHQMGSCRMGVDPK+S VNPKGETWEVEGLFV D SV PTALGVNPMV
Sbjct  589  RPLQKLSSPIGSAHQMGSCRMGVDPKSSAVNPKGETWEVEGLFVADSSVFPTALGVNPMV  648

Query  145  TIXSVSYCISQSXLEFL  95
            TI +++YC +QS LE L
Sbjct  649  TIQAIAYCTAQSVLEVL  665



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score =   287 bits (735),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 163/201 (81%), Gaps = 0/201 (0%)
 Frame = -2

Query  694   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
             ++ +GYGAV+QTPALHPG+FSALMPW SG + K RM R++RTAHIF LARDKGSG+ +SP
Sbjct  934   MDKSGYGAVLQTPALHPGMFSALMPWLSGADMKRRMLRFSRTAHIFALARDKGSGDVYSP  993

Query  514   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              S+ Y ++ TDEENL++GL+K+LRILAAAGAEEIG +H  G ++ VK AS  EFERFVKE
Sbjct  994   DSIGYKMEATDEENLKKGLDKILRILAAAGAEEIGTHHCKGKSINVKQASSHEFERFVKE  1053

Query  334   ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
             ESS+ LR       SAHQMGSCRMG+DPK SVVN  GETWEVEGLFV D SV PTALGVN
Sbjct  1054  ESSRPLRDLNTQICSAHQMGSCRMGIDPKQSVVNQMGETWEVEGLFVADSSVFPTALGVN  1113

Query  154   PMVTIXSVSYCISQSXLEFLK  92
             PMVTI +++YC +QS L+ LK
Sbjct  1114  PMVTIQAIAYCTAQSVLDVLK  1134



>ref|XP_010274420.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Nelumbo 
nucifera]
Length=728

 Score =   281 bits (718),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGA++QTP+LHPGLFS LMPW SG +FK RMSR++RTAH+F LARDKGSG+  S +S
Sbjct  519  GSGYGAILQTPSLHPGLFSVLMPWVSGADFKERMSRFSRTAHVFALARDKGSGQVNSESS  578

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            ++Y LD  DEENL +G+EK+LRILAAAGAEEIG +H  G  L VK AS+ EFE+FVKEES
Sbjct  579  LSYRLDAIDEENLSKGVEKMLRILAAAGAEEIGTHHCEGRKLNVKRASKDEFEKFVKEES  638

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
             + L       ASAHQMGSCRMGVD   SVV P+GETWEVEGLFV D SV PTALGVNPM
Sbjct  639  GRKLGGLSTPVASAHQMGSCRMGVDRDKSVVCPRGETWEVEGLFVADTSVFPTALGVNPM  698

Query  148  VTIXSVSYCISQSXLEFLKTHD  83
            VT+ ++SYC + S +EFL+ +D
Sbjct  699  VTVQAISYCTAHSVIEFLERND  720



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            + +GYGAVIQTPALHPG+FS LMPW SG + K RM++++RTAH+F LARDKGSG   S T
Sbjct  599  DKSGYGAVIQTPALHPGMFSVLMPWTSGLDMKERMTKFSRTAHLFALARDKGSGTIASST  658

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
            S++Y +D TDE NLQ+GLEK+LRILAAAGAEEIG +H  G TLKVK  S  EFERFVKEE
Sbjct  659  SISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIGTHHNEGKTLKVKQVSYHEFERFVKEE  718

Query  331  SSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
            S++ ++       SAHQMGSCRMG +P++SVVNP GETWEVEGL+V D SV PTALGVNP
Sbjct  719  SARPIKGQSTPICSAHQMGSCRMGPNPRSSVVNPMGETWEVEGLYVADTSVFPTALGVNP  778

Query  151  MVTIXSVSYCISQSXLEFLK  92
            MVT+ +++YC +QS LE L+
Sbjct  779  MVTVQAIAYCTAQSVLEALR  798



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYG VIQTP LHPG+FS LMPW SG + K RM +++RT HIF LARDKGSG+  S T+V
Sbjct  559  SGYGTVIQTPILHPGMFSLLMPWISGTDMKNRMVKFSRTTHIFALARDKGSGKITSETNV  618

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y L+ +D+ENL +GLEK++RI+AAAGAEEIG  H TG  LKVK AS  EFERFVKEES 
Sbjct  619  SYKLEYSDQENLSKGLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQASEEEFERFVKEESL  678

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L+K      SAHQMGSCRMGVDPK+S VNPKGETWEVEGLFV D SV PTALGVNPMV
Sbjct  679  RPLQKLSSPIGSAHQMGSCRMGVDPKSSAVNPKGETWEVEGLFVADSSVFPTALGVNPMV  738

Query  145  TIXSVSYCISQSXLEFL  95
            TI +++YC +QS LE L
Sbjct  739  TIQAIAYCTAQSVLEVL  755



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score =   280 bits (717),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGA++QTP+LHPGLFS LMPW SG +FK RMSR++RTAH+F LARDKGSG+  S +S
Sbjct  566  GSGYGAILQTPSLHPGLFSVLMPWVSGADFKERMSRFSRTAHVFALARDKGSGQVNSESS  625

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            ++Y LD  DEENL +G+EK+LRILAAAGAEEIG +H  G  L VK AS+ EFE+FVKEES
Sbjct  626  LSYRLDAIDEENLSKGVEKMLRILAAAGAEEIGTHHCEGRKLNVKRASKDEFEKFVKEES  685

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
             + L       ASAHQMGSCRMGVD   SVV P+GETWEVEGLFV D SV PTALGVNPM
Sbjct  686  GRKLGGLSTPVASAHQMGSCRMGVDRDKSVVCPRGETWEVEGLFVADTSVFPTALGVNPM  745

Query  148  VTIXSVSYCISQSXLEFLKTHD  83
            VT+ ++SYC + S +EFL+ +D
Sbjct  746  VTVQAISYCTAHSVIEFLERND  767



>gb|KDP37817.1| hypothetical protein JCGZ_06719 [Jatropha curcas]
Length=608

 Score =   275 bits (704),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = -2

Query  679  YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTY  500
            YGAVIQTP+LHPG+F++LMPW SG + K +M R++RTAHIF LARDKGSG+  SP S++Y
Sbjct  408  YGAVIQTPSLHPGMFASLMPWGSGVDMKRKMGRFSRTAHIFALARDKGSGKVNSPNSISY  467

Query  499  DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQS  320
             ++  DEENLQ+GLEK LRILAAAGAEEIG +H  G +L VK AS  EF++FVK ESS+S
Sbjct  468  QMEAADEENLQKGLEKGLRILAAAGAEEIGTHHSKGRSLNVKKASYKEFDKFVKRESSRS  527

Query  319  LRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI  140
            LR       SAHQMGSCRMG+DP+ SVVN  GETWEVEGLF+ D SV P ALGVNPMVT+
Sbjct  528  LRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIADTSVFPAALGVNPMVTV  587

Query  139  XSVSYCISQSXLEFLK  92
             +++YC +QS L+ LK
Sbjct  588  QAIAYCTAQSVLQLLK  603



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score =   279 bits (714),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPG+FS+LMPW SG + K+RM +++RTAHIF LARD+GSG   SP S+
Sbjct  586  SGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFALARDQGSGTVNSPYSI  645

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y ++  DEENL++G+EK+LR+LAAAGAEEIG +H  G T+ VK AS  EFERFVKEESS
Sbjct  646  SYQMEAMDEENLKKGIEKILRMLAAAGAEEIGTHHCKGKTINVKKASSEEFERFVKEESS  705

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + LR      +SAHQMGSCRMG+DPK SVVN  GETW+VEGL++ D SV PTALGVNPMV
Sbjct  706  RPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWDVEGLYLADTSVFPTALGVNPMV  765

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS L+ L+
Sbjct  766  TVQAIAYCTAQSVLDVLR  783



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score =   279 bits (713),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPG+FS+LMPW SG + K+RM +++RTAHIF LARD+GSG   SP S+
Sbjct  578  SGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSI  637

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y ++  DEENL++G+EK+LRILAAAGAEEIG +H  G T+ VK AS  EFERFVKEESS
Sbjct  638  SYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKTINVKKASSEEFERFVKEESS  697

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + LR      +SAHQMGSCRMG+DPK SVVN  GETW VEGL++ D SV PTALGVNPMV
Sbjct  698  RPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMV  757

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS L+ L+
Sbjct  758  TVQAIAYCTAQSVLDVLR  775



>gb|KDO72345.1| hypothetical protein CISIN_1g0039902mg, partial [Citrus sinensis]
Length=707

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPG+FS+LMPW SG + K+RM +++RTAHIF LARD+GSG   SP S+
Sbjct  505  SGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAHIFVLARDQGSGTVNSPYSI  564

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y ++  DEENL++G+EK+LRILAAAGAEEIG +H  G  + VK AS  EFERFVKEESS
Sbjct  565  SYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKIINVKKASSEEFERFVKEESS  624

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + LR      +SAHQMGSCRMG+DPK SVVN  GETW VEGL++ D SV PTALGVNPMV
Sbjct  625  RPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEGLYLADTSVFPTALGVNPMV  684

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS L+ L+
Sbjct  685  TVQAIAYCTAQSVLDVLR  702



>ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gb|EEF42542.1| electron carrier, putative [Ricinus communis]
Length=710

 Score =   275 bits (704),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 156/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTP+LHPG+FS+LMPW SG + KM+M RY+RTAHIF L RDKGSG   SP+S+
Sbjct  509  SGYGAVIQTPSLHPGMFSSLMPWVSGADIKMQMCRYSRTAHIFALGRDKGSGTVNSPSSI  568

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            TY +   DE+NLQ G+EK+LRILAAAGAEEIG +H  G  L VK AS  EFE+FVKEE +
Sbjct  569  TYQMKAADEKNLQNGIEKILRILAAAGAEEIGTHHCIGRRLNVKTASYHEFEKFVKEERA  628

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + +R       SAHQMGSCRMGV+PK SVVN  GETWE+EGL++ D SV PTALGVNPMV
Sbjct  629  RPMRDLSNQICSAHQMGSCRMGVNPKHSVVNQTGETWEIEGLYLADASVFPTALGVNPMV  688

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS LE L+
Sbjct  689  TVQAIAYCTAQSVLEVLR  706



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score =   276 bits (706),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 158/206 (77%), Gaps = 3/206 (1%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            VN +GYGAVIQTP+LHPG+FS L+PW SG + K RM R++RTAH+F LARD+GSG   SP
Sbjct  542  VNKSGYGAVIQTPSLHPGMFSGLIPWISGADMKRRMCRFSRTAHVFALARDRGSGTVNSP  601

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
            +S+ Y +D  DE+NLQ GLEK LRILAAAGAEEIG +H TG +L VK  S  EFERFVKE
Sbjct  602  SSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEIGTHHSTGKSLNVKKVSYREFERFVKE  661

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
            ES++ LR       SAHQMGSCRMGV+PK S VN  GE WEVEGLFV D SV PTALGVN
Sbjct  662  ESARPLRDLTGQICSAHQMGSCRMGVNPKESAVNQMGEAWEVEGLFVADTSVFPTALGVN  721

Query  154  PMVTIXSVSYCISQSXLEFL---KTH  86
            PMVT+ +++YC +QS ++ L   +TH
Sbjct  722  PMVTVQAIAYCTAQSVVQLLSRKRTH  747



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = -2

Query  679  YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTY  500
            YGAVIQTP+LHPG+F++LMPW S  + KM+  R++RTAHIF LARDKGSG+  SP S++Y
Sbjct  560  YGAVIQTPSLHPGMFASLMPWVSCVDMKMKRGRFSRTAHIFALARDKGSGKVNSPNSISY  619

Query  499  DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQS  320
             ++  DEENLQ+GLEK+LRILAAAGAEEIG +H  G +L VK AS  EF++FVK ESS+S
Sbjct  620  QMEAPDEENLQKGLEKVLRILAAAGAEEIGTHHSKGRSLNVKKASYKEFDKFVKRESSRS  679

Query  319  LRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI  140
            LR       SAHQMGSCRMG+DP+ SVVN  GETWEVEGLF+ D SV PTALGVNPMVT+
Sbjct  680  LRDLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIADTSVFPTALGVNPMVTV  739

Query  139  XSVSYCISQSXLEFLK  92
             +++YC +QS L+ LK
Sbjct  740  QAIAYCTAQSVLQLLK  755



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   275 bits (703),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 157/206 (76%), Gaps = 3/206 (1%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            VN +GYGAVIQTP+LHPG+FS L+PW SG + K RM R++RTAH+F LARD+GSG   SP
Sbjct  600  VNKSGYGAVIQTPSLHPGMFSGLIPWISGADMKRRMFRFSRTAHVFALARDRGSGTVNSP  659

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
            +S+ Y +D  DE+NLQ GLEK LRILAAAGAEEIG +H TG  L VK  S  EFERFVKE
Sbjct  660  SSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEIGTHHSTGKILNVKKVSYREFERFVKE  719

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
            ES++ LR       SAHQMGSCRMGV+PK S VN  GE WEVEGLFV D SV PTALGVN
Sbjct  720  ESARPLRDLTGQICSAHQMGSCRMGVNPKESAVNQMGEAWEVEGLFVADTSVFPTALGVN  779

Query  154  PMVTIXSVSYCISQSXLEFL---KTH  86
            PMVT+ +++YC +QS ++ L   +TH
Sbjct  780  PMVTVQAIAYCTAQSVVQLLSRKRTH  805



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   275 bits (702),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGAVIQTP+LHPG+FS LMPW SG + K RM RY+RTAHIF LARDKGSG   SP++
Sbjct  586  GSGYGAVIQTPSLHPGMFSVLMPWISGPDMKDRMIRYSRTAHIFALARDKGSGTISSPST  645

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            ++Y +D+TDEENL+RG+EKLLRILAAAGAEEIG ++  G ++ VK  S   FE+FVKEES
Sbjct  646  ISYQMDETDEENLKRGMEKLLRILAAAGAEEIGTHNCNGRSINVKKVSSHAFEKFVKEES  705

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S++LR       SAHQMGSCRMGVDP++S VN  GETWEVEGL+V D SV PTALGVNPM
Sbjct  706  SRALRDLSTPVCSAHQMGSCRMGVDPRSSAVNQMGETWEVEGLYVADTSVFPTALGVNPM  765

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ +++Y  ++S +E L+
Sbjct  766  VTVQAIAYSTAKSVVEVLR  784



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTP+LHPGLFSA+MPW SG++FK RM +Y+RTAH+F LARDKG G   SP+ +
Sbjct  561  SGYGAVIQTPSLHPGLFSAVMPWVSGKDFKDRMVKYSRTAHVFALARDKGRGTIASPSDI  620

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y LD  D ENL+ G+E++LRILAAAGAEEIG +H  G  LKVK ASR EFE FV+ ES 
Sbjct  621  SYKLDDLDRENLREGIERVLRILAAAGAEEIGTHHRDGGVLKVKGASREEFEGFVERESM  680

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + LR      ASAHQMGSCRMGVD   S V+P+GETWEVEGLFV D SV PTALGVNPMV
Sbjct  681  RPLRNLSTPIASAHQMGSCRMGVDSGGSGVDPRGETWEVEGLFVADSSVFPTALGVNPMV  740

Query  145  TIXSVSYCISQSXLEFL  95
            T+ +++YC +QS LE L
Sbjct  741  TVQAIAYCTAQSVLEIL  757



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score =   271 bits (694),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G+GYGAVIQTP LHPG+FS + PW S  + + RMS+++RTA+IF LARDKGSG+  SP+S
Sbjct  598  GSGYGAVIQTPMLHPGMFSVITPWISSVDMRERMSKFSRTAYIFALARDKGSGQVNSPSS  657

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            ++Y +D  DEE+L++GLEK+LRILAAAGAEEIG +H  G  + VK  S  EFERFVK+ES
Sbjct  658  ISYRMDAMDEEHLKQGLEKILRILAAAGAEEIGTSHCLGRKVNVKKVSSNEFERFVKKES  717

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
             ++LR       SAHQMGSCRMGVDPK+SVVN +GETWEVEGLF+ D SV PTALGVNPM
Sbjct  718  RRALRDLRTPIPSAHQMGSCRMGVDPKSSVVNHRGETWEVEGLFLADSSVFPTALGVNPM  777

Query  148  VTIXSVSYCISQSXLEFLK  92
            VTI S++YC +QS LE L+
Sbjct  778  VTIQSIAYCTAQSVLEVLR  796



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 158/201 (79%), Gaps = 1/201 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP-  515
            N +GYGAVIQTPALHPG+FS +MPW SG++ K RMSR++RTAH+F LARDKGSG   +P 
Sbjct  544  NKSGYGAVIQTPALHPGMFSVVMPWVSGKDIKHRMSRFSRTAHVFALARDKGSGTVNAPP  603

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
             S++Y+++  DE NL+ GLEK LRILAAAGAE+IG +H  G  L VK A+  EFERFVKE
Sbjct  604  DSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKGKGLHVKKANLDEFERFVKE  663

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
            ESS+ LR+      SAHQMGSCRMGVD K SVVN  GETWEVEGLFV D SV PTALGVN
Sbjct  664  ESSRPLREISSAICSAHQMGSCRMGVDSKQSVVNQMGETWEVEGLFVADTSVFPTALGVN  723

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PMVT+ +++YC SQS L+ L+
Sbjct  724  PMVTVQAIAYCTSQSILQVLR  744



>gb|KHN11789.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=622

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIF LARD+GSG   +P  +
Sbjct  420  SGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRI  479

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y     DEENL++G+EK+LRILAAAGAEEIG +H  G TL VK  S  EFE+FVKEESS
Sbjct  480  SYKPADVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEKFVKEESS  539

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL        SAHQMGSCRMG +PK SVVNP GETWEVEGL+V D SV PTALGVNPMV
Sbjct  540  RSLTDLTTPLCSAHQMGSCRMGSNPKQSVVNPTGETWEVEGLYVADASVFPTALGVNPMV  599

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS +E LK
Sbjct  600  TVQAIAYCTAQSVVEVLK  617



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   270 bits (690),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 154/200 (77%), Gaps = 0/200 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            N TGYGAVIQTP+LHPGLFS LMPW+SG + K RM +++RTAH+F LARD+GSG   SPT
Sbjct  608  NATGYGAVIQTPSLHPGLFSVLMPWSSGMDIKDRMRKFSRTAHVFALARDQGSGTVDSPT  667

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
             ++Y +   D+ENL +G+EK+LRILAAAGAEEIG ++  G +L VK+ S  EFE+FVKEE
Sbjct  668  RISYQMKNVDKENLHKGIEKVLRILAAAGAEEIGTHNNKGRSLNVKEVSYHEFEKFVKEE  727

Query  331  SSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
            SS  L        SAHQMGSCRMG +PK SVVN  GETWEVEGL++ D SV PTALGVNP
Sbjct  728  SSMPLTDLSTPVCSAHQMGSCRMGTNPKESVVNQTGETWEVEGLYLADTSVFPTALGVNP  787

Query  151  MVTIXSVSYCISQSXLEFLK  92
            MVT+ +++YC +Q  LE LK
Sbjct  788  MVTVQAIAYCTAQHVLEVLK  807



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   269 bits (688),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGE-AFSP  515
            N +GYGAVIQTP+LHPGLFSALMPW SG   K RM++++RTAHIF L+RD GSG  + SP
Sbjct  612  NDSGYGAVIQTPSLHPGLFSALMPWTSGSNIKHRMTKFSRTAHIFALSRDVGSGIISTSP  671

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              ++Y +D  DE NL++G+EK+LRILAAAGAEEIG +H +G ++ VK A+  EFE+FVK 
Sbjct  672  FDISYMMDPIDEANLKKGVEKMLRILAAAGAEEIGTHHNSGESINVKKATYHEFEKFVKR  731

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
            ESS+ ++      ASAHQMGSC+MGVDP+ SVVN  GE+W+VEGL++ D SV PTALGVN
Sbjct  732  ESSKEIQGLSTPVASAHQMGSCKMGVDPRTSVVNQMGESWDVEGLYIADSSVFPTALGVN  791

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PMVT+ ++SYC +QS LE+LK
Sbjct  792  PMVTVQAISYCTAQSVLEYLK  812



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 156/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPG FS +MPW SG + K RM +++RTAHIF LARD+GSG   SP+ +
Sbjct  629  SGYGAVIQTPALHPGTFSIVMPWVSGSDIKDRMRKFSRTAHIFALARDQGSGNVHSPSRI  688

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y+++  DEENLQ+G++K+LRILAAAGAEEIG +H  G TL VK+AS  EFE+FVK+ESS
Sbjct  689  SYEMEDVDEENLQKGIDKVLRILAAAGAEEIGTHHNKGNTLNVKNASYHEFEQFVKKESS  748

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL        SAHQMGSCRMG +PK SVV   GETWEVE LFV D SV PTALG+NPM+
Sbjct  749  RSLTDLSTPLCSAHQMGSCRMGSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPMI  808

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ S++YC +QS L+ LK
Sbjct  809  TVQSIAYCTAQSVLQVLK  826



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 158/201 (79%), Gaps = 1/201 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP-  515
            N +GYGAVIQTPALHPG+FS +MPW SG++ K RMSR++RTAH+F LARDKGSG   +P 
Sbjct  600  NKSGYGAVIQTPALHPGMFSVVMPWVSGKDIKHRMSRFSRTAHVFALARDKGSGTVNAPP  659

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
             S++Y+++  DE NL+ GLEK LRILAAAGAE+IG +H  G  L VK ++  EFERFVKE
Sbjct  660  YSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKGKGLHVKKSNLDEFERFVKE  719

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
            ESS+ LR+      SAHQMGSCRMGVD K SV+N  GETWEVEGLFV D SV PTALGVN
Sbjct  720  ESSRPLRELSSAICSAHQMGSCRMGVDSKQSVLNQMGETWEVEGLFVADTSVFPTALGVN  779

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PMVT+ +++YC SQS L+ L+
Sbjct  780  PMVTVQAIAYCTSQSILQVLR  800



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 156/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPG FS +MPW SG + K RM +++RTAHIF LARD+GSG   SP+ +
Sbjct  651  SGYGAVIQTPALHPGTFSIVMPWVSGSDIKDRMRKFSRTAHIFALARDQGSGNVHSPSRI  710

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y+++  DEENLQ+G++K+LRILAAAGAEEIG +H  G TL VK+AS  EFE+FVK+ESS
Sbjct  711  SYEMEDVDEENLQKGIDKVLRILAAAGAEEIGTHHNKGNTLNVKNASYHEFEQFVKKESS  770

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL        SAHQMGSCRMG +PK SVV   GETWEVE LFV D SV PTALG+NPM+
Sbjct  771  RSLTDLSTPLCSAHQMGSCRMGSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPMI  830

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ S++YC +QS L+ LK
Sbjct  831  TVQSIAYCTAQSVLQVLK  848



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   267 bits (682),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPG FS +MPW SG++ K RM +++RTAHIF LARDKGSG+  SP  +
Sbjct  614  SGYGAVIQTPALHPGTFSIVMPWISGKDIKDRMRKFSRTAHIFALARDKGSGKVDSPNRI  673

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
             Y ++  DEENLQ+G+EK+LRILAAAGAEEIG +H  G TL VK AS+ E E+FVKEESS
Sbjct  674  NYQMEDVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQASKLELEKFVKEESS  733

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L K      SAHQMGSCRMG +PK S V   GETWEVE L+V D SV PTALG+NPM+
Sbjct  734  RPLTKLSTPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMI  793

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S++YC +QS L  LK
Sbjct  794  TIQSIAYCTAQSVLHALK  811



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score =   267 bits (682),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPG FS +MPW SG++ K RM +++RTAHIF LARDKGSG+  SP  +
Sbjct  632  SGYGAVIQTPALHPGTFSIVMPWISGKDIKDRMRKFSRTAHIFALARDKGSGKVDSPNRI  691

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
             Y ++  DEENLQ+G+EK+LRILAAAGAEEIG +H  G TL VK AS+ E E+FVKEESS
Sbjct  692  NYQMEDVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQASKLELEKFVKEESS  751

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L K      SAHQMGSCRMG +PK S V   GETWEVE L+V D SV PTALG+NPM+
Sbjct  752  RPLTKLSTPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMI  811

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S++YC +QS L  LK
Sbjct  812  TIQSIAYCTAQSVLHALK  829



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGE-AFSP  515
            N +GYG VIQTP+LHPGLFSA+MPW SG   K RM++++RT+H+F LARD GSG  + SP
Sbjct  603  NDSGYGTVIQTPSLHPGLFSAMMPWTSGLNIKHRMTKFSRTSHMFALARDMGSGVISTSP  662

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              + Y +   DE NLQ+G+EK+LRILAAAGAEEIG +H +G ++ VK AS  EFE+FVK+
Sbjct  663  FDIKYKMHPIDEANLQKGIEKMLRILAAAGAEEIGTHHYSGSSINVKKASFHEFEKFVKK  722

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
            ESS++++      ASAHQMGSCRMG++P+ SVVN +GE+WEVEGL++ D SV PTALGVN
Sbjct  723  ESSKAIQGLSMPIASAHQMGSCRMGINPRTSVVNQRGESWEVEGLYLADSSVFPTALGVN  782

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PMVT+ ++SYC +QS LEFL+
Sbjct  783  PMVTVQAISYCTTQSVLEFLR  803



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIF LARD+GSG   +P  +
Sbjct  605  SGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRI  664

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y     DEENL++G+EK+LRILAAAGAEEIG +H  G TL VK  S  EFE+FVKEESS
Sbjct  665  SYKPADVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEKFVKEESS  724

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL        SAHQMGSCRMG +PK SVVNP GETWEVEGL+V D SV PTALGVNPMV
Sbjct  725  RSLTDLTTPLCSAHQMGSCRMGSNPKQSVVNPTGETWEVEGLYVADASVFPTALGVNPMV  784

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS +E LK
Sbjct  785  TVQAIAYCTAQSVVEVLK  802



>ref|XP_004167305.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A-like, 
partial [Cucumis sativus]
Length=608

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  682  GYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            GYG AVIQTPALHPGLFS LMPW SG   K RM +++RTAH+F LARDKGSG   SP+S+
Sbjct  407  GYGGAVIQTPALHPGLFSILMPWISGTNIKQRMCKFSRTAHVFVLARDKGSGIVKSPSSL  466

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y +D  DE NLQ+GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+E+FVKEESS
Sbjct  467  SYKMDDVDEHNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESS  526

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L+       SAHQMGSCRMG+  K SVVN +GETWEVEGLF+ D SV PTALGVNPMV
Sbjct  527  RPLKDLLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMV  586

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS LE LK
Sbjct  587  TVQAIAYCTAQSVLETLK  604



>ref|XP_004150760.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cucumis sativus]
Length=617

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  682  GYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            GYG AVIQTPALHPGLFS LMPW SG   K RM +++RTAH+F LARDKGSG   SP+S+
Sbjct  416  GYGGAVIQTPALHPGLFSILMPWISGTNIKQRMCKFSRTAHVFVLARDKGSGIVKSPSSL  475

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y +D  DE NLQ+GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+E+FVKEESS
Sbjct  476  SYKMDDVDEHNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESS  535

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L+       SAHQMGSCRMG+  K SVVN +GETWEVEGLF+ D SV PTALGVNPMV
Sbjct  536  RPLKDLLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMV  595

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS LE LK
Sbjct  596  TVQAIAYCTAQSVLETLK  613



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  682  GYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            GYG AVIQTPALHPGLFS LMPW SG   K RM +++RTAH+F LARDKGSG   SP+S+
Sbjct  530  GYGGAVIQTPALHPGLFSILMPWVSGTNIKQRMCKFSRTAHVFVLARDKGSGTVKSPSSL  589

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y +D  DE+NLQ+GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+E+FVKEESS
Sbjct  590  SYKMDNVDEQNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSYREYEKFVKEESS  649

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L+       SAHQMGSCRMG   K SVVN +GETWEVEGLF+ D SV PTALGVNPMV
Sbjct  650  RPLKDLLTPICSAHQMGSCRMGSGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMV  709

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS LE LK
Sbjct  710  TVQAIAYCTAQSVLETLK  727



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 152/200 (76%), Gaps = 0/200 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            N +GYGAVIQTP+LHPGLFS LMPWNSG + K RM +++RTAH+F LARD+GSG   SP+
Sbjct  622  NKSGYGAVIQTPSLHPGLFSILMPWNSGMDIKDRMRKFSRTAHVFALARDQGSGTVDSPS  681

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
             ++Y +   D+ENL++G+EK+LRILAAAGAEEIG ++  G  L VK  S  EFE+FVKEE
Sbjct  682  CISYHMKDADKENLKKGIEKVLRILAAAGAEEIGTHNNKGNRLNVKKVSYHEFEKFVKEE  741

Query  331  SSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
            SS  L        SAHQMGSCRMG +PK SVVN  GETWEVE L++ D SV PTALGVNP
Sbjct  742  SSMELTDLSTPICSAHQMGSCRMGNNPKDSVVNQMGETWEVEDLYIADASVFPTALGVNP  801

Query  151  MVTIXSVSYCISQSXLEFLK  92
            MVTI +++YC +Q  LE L+
Sbjct  802  MVTIQAIAYCTAQHVLEVLR  821



>gb|KHN27504.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=638

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 151/200 (76%), Gaps = 0/200 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            + +GYG VIQTPALHPG+FS LMPW SG + K RM +++RTAH+F LARD+GSG   SP+
Sbjct  435  DKSGYGTVIQTPALHPGMFSILMPWTSGADIKDRMRKFSRTAHVFALARDQGSGTVNSPS  494

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
             ++Y L   D+ENL+ GLEK+LRILAAAGAEEIG ++  G  + VK  S  EFE+FVKEE
Sbjct  495  CISYQLKDIDKENLKVGLEKVLRILAAAGAEEIGTHNNKGRRINVKQVSYHEFEKFVKEE  554

Query  331  SSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
            SS SL        SAHQMGSC+MG +P+ SVVN  GETWEVEGL++ D SV PTALGVNP
Sbjct  555  SSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYLADSSVFPTALGVNP  614

Query  151  MVTIXSVSYCISQSXLEFLK  92
            MVT+ ++SYC +Q  LE L+
Sbjct  615  MVTVQAISYCTAQYVLEVLR  634



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIF LARDKGSG   SP  +
Sbjct  606  SGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDKGSGTVESPKHI  665

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y L   DEENLQ+G+EK+LRILAAAGAEEIG +H  G TL VK  S  EFE+FVKEESS
Sbjct  666  SYRLAGVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEKFVKEESS  725

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L        SAHQMGSCRMG +PK SVVN  GETWE+EGL++ D SV PTALGVNPMV
Sbjct  726  RPLADLSTPLCSAHQMGSCRMGSNPKQSVVNQTGETWEMEGLYLADTSVFPTALGVNPMV  785

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ + +YCI+QS +E L+
Sbjct  786  TVQATAYCIAQSVVEVLR  803



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPG+FS LMPW SG++ K RM +++RTAH+F LARD+GSG   SP+ +
Sbjct  627  SGYGAVIQTPALHPGMFSILMPWTSGKDIKDRMRKFSRTAHVFALARDQGSGTVNSPSHI  686

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y L   D+ENL+ GLEK+LRILAAAGAEEIG ++  G ++ VK  S  EFE+FVKEESS
Sbjct  687  SYQLKDVDKENLKIGLEKVLRILAAAGAEEIGTHNNKGRSINVKQVSYHEFEKFVKEESS  746

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             SL        SAHQMGSC+MG +P+ SVVN  GETWEVEGL++ D SV PTALGVNPMV
Sbjct  747  MSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYLADTSVFPTALGVNPMV  806

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ ++SYC +Q  LE L+
Sbjct  807  TVQAISYCTAQYVLEVLR  824



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  682  GYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            GYG AVIQTPALHPGLFS LMPW SG   K RM +++RTAH+F LARDKGSG   SP+S+
Sbjct  620  GYGGAVIQTPALHPGLFSILMPWVSGTNIKQRMCKFSRTAHVFVLARDKGSGTVKSPSSL  679

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y +D  DE+NLQ+GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+E+FVKEESS
Sbjct  680  SYKMDNVDEQNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSYREYEKFVKEESS  739

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L+       SAHQMGSCRMG   K SVVN +GETWEVEGLF+ D SV PTALGVNPMV
Sbjct  740  RPLKDLLTPICSAHQMGSCRMGSGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMV  799

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS LE LK
Sbjct  800  TVQAIAYCTAQSVLETLK  817



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYG VIQTPALHPG+FS LMPW SG + K RM +++RTAH+F LARD+GSG   SP+ +
Sbjct  624  SGYGTVIQTPALHPGMFSILMPWTSGADIKDRMRKFSRTAHVFALARDQGSGTVNSPSCI  683

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y L   D+ENL+ GLEK+LRILAAAGAEEIG ++  G  + VK  S  EFE+FVKEESS
Sbjct  684  SYQLKDIDKENLKVGLEKVLRILAAAGAEEIGTHNNKGRRINVKQVSYHEFEKFVKEESS  743

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             SL        SAHQMGSC+MG +P+ SVVN  GETWEVEGL++ D SV PTALGVNPMV
Sbjct  744  MSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYLADSSVFPTALGVNPMV  803

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ ++SYC +Q  LE L+
Sbjct  804  TVQAISYCTAQYVLEVLR  821



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   259 bits (661),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            TGYGAVIQTP+LHPG+FS LMPW SG++ K RM +++RTAH+F LARD+GSG   SP+ +
Sbjct  613  TGYGAVIQTPSLHPGMFSILMPWTSGKDMKDRMHKFSRTAHVFALARDQGSGTVNSPSLI  672

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y+L   D+ENL+ G+EK+LRILAAAGAEEIG ++  G ++ VK  S  EFE+FVKEESS
Sbjct  673  SYELKDVDKENLETGIEKVLRILAAAGAEEIGTHNNKGRSINVKQVSYHEFEKFVKEESS  732

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             SL        SAHQMGSC+MG +P  SVVN  GETWEVEGL++ D SV PTALGVNPMV
Sbjct  733  MSLTDLTTPLCSAHQMGSCKMGTNPSDSVVNQMGETWEVEGLYLADTSVFPTALGVNPMV  792

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +Q   E L+
Sbjct  793  TVQAIAYCTAQYVAEVLR  810



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 149/198 (75%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYG VIQTPALHPG+FS LMPW SG++ K RM R++RTAH+F LARD+GSG   S + +
Sbjct  632  SGYGTVIQTPALHPGMFSILMPWVSGKDMKDRMRRFSRTAHVFALARDQGSGTVNSDSEI  691

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
             Y ++  DEE L+ G+EK+LRILAAAGAEEIG +HG G ++ VK AS  E ERFVKEES 
Sbjct  692  RYSVEARDEEKLRAGVEKVLRILAAAGAEEIGTHHGKGKSINVKSASYHELERFVKEESG  751

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + +R       SAHQMGSCRMGV    S VNP GETWEVEGLFV D SV PTALGVNPMV
Sbjct  752  REMRGLRWPICSAHQMGSCRMGVAAATSAVNPMGETWEVEGLFVADTSVFPTALGVNPMV  811

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC + S L+ LK
Sbjct  812  TVQAIAYCTALSVLQLLK  829



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIF LARD+GSG   +P  +
Sbjct  607  SGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRI  666

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y     DEENL++G+EK+LRILAAAGAEEIG +H  G TL VK     EFE+FVKEESS
Sbjct  667  SYKPAGVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVRYHEFEKFVKEESS  726

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL        SAHQMGSCRMG +PK S VN  GETWEVEGL+V D SV PTALGVNPMV
Sbjct  727  RSLTDLTTPLCSAHQMGSCRMGSNPKQSAVNQTGETWEVEGLYVADTSVFPTALGVNPMV  786

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS +E L+
Sbjct  787  TVQAIAYCTAQSVVEVLR  804



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIF LARD+GSG   +P  +
Sbjct  607  SGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRI  666

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y     DEENL++G+EK+LRILAAAGAEEIG +H  G TL VK     EFE+FVKEESS
Sbjct  667  SYKPAGVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVRYHEFEKFVKEESS  726

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL        SAHQMGSCRMG +PK S VN  GETWEVEGL+V D SV PTALGVNPMV
Sbjct  727  RSLTDLTTPLCSAHQMGSCRMGSNPKQSAVNQTGETWEVEGLYVADTSVFPTALGVNPMV  786

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC +QS +E L+
Sbjct  787  TVQAIAYCTAQSVVEVLR  804



>emb|CDY66156.1| BnaA01g34950D [Brassica napus]
Length=508

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -2

Query  679  YG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            YG  VIQTP+LHPGLFS ++PW S +EFK RM +++RTAH+F L RDKG+G   S +S+ 
Sbjct  309  YGETVIQTPSLHPGLFSGVIPWTSSKEFKSRMLKFSRTAHVFTLLRDKGTGTINSKSSIE  368

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y+L+  DEE+L++GLE++L IL AAGAEEIG ++  G +L VK AS  E ERFV+EESS+
Sbjct  369  YNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVKTASAVEIERFVREESSK  428

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            SL+       SAHQMGSCRMG  P+ S V P GETWEVEGLFV D SV PTALGVNPMVT
Sbjct  429  SLKDLSGQICSAHQMGSCRMGTSPEVSAVKPTGETWEVEGLFVADTSVFPTALGVNPMVT  488

Query  142  IXSVSYCISQSXLEFLK  92
            I S++YCI  + ++ LK
Sbjct  489  IQSIAYCIGLNVVDALK  505



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 146/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYGAVIQTPALHPGLFS   PW SG ++K RM+R++RT HIF LARD+GSG   +   +
Sbjct  579  SGYGAVIQTPALHPGLFSVATPWLSGADYKDRMARFSRTTHIFALARDRGSGTVDASGCI  638

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
             Y +   DE+NLQRGLEK+LRI+AAAGAEEIG  H  G  L V+ AS  +FERFVK  S 
Sbjct  639  RYRMGAADEKNLQRGLEKILRIMAAAGAEEIGTQHCHGDRLNVRSASSHQFERFVKATSG  698

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + L        SAHQMGSCRMG+ P+ S VN +GETWEVEGLFV D SVLPTALGVNPMV
Sbjct  699  KGLMDLLTPVYSAHQMGSCRMGIHPRTSAVNSRGETWEVEGLFVADASVLPTALGVNPMV  758

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC + S LE L+
Sbjct  759  TVQAIAYCTAHSVLEELR  776



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -2

Query  679  YGA-VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            YG  +IQTPALHPG+FS ++PW SG+++K RM +++RTAH+F L RDKGSGE  S  S+T
Sbjct  584  YGTTIIQTPALHPGMFSGIIPWTSGKDYKNRMLKFSRTAHVFALTRDKGSGEIRSLNSIT  643

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y L+ TDEENL++G+E++LRIL AAGAEEIG ++  G +L VK AS  E+ERFV+EESS+
Sbjct  644  YTLNGTDEENLKKGIERILRILTAAGAEEIGTHNLEGKSLNVKAASSEEYERFVREESSK  703

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMGV  + S V P GETWEVEGLFV D SV PTALGVNPMVT
Sbjct  704  PLKGLSGQICSAHQMGSCRMGVAAEKSAVRPTGETWEVEGLFVADTSVFPTALGVNPMVT  763

Query  142  IXSVSYCISQSXLEFLK  92
            + +++YC+    ++ LK
Sbjct  764  VQAIAYCVGSYVIDVLK  780



>ref|XP_006283178.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16076.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=598

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            + YG  VIQTPALHPG+FS + PW S ++FK RM +++RTAHIF L RDKG+G   S + 
Sbjct  397  SSYGETVIQTPALHPGMFSGVTPWASSKDFKTRMLKFSRTAHIFALLRDKGTGTINSKSY  456

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+L++GLE++L+I+AAAGAEEIG ++  G +L V+ AS  EFERFV+EES
Sbjct  457  IDYNLNDEDEESLKKGLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRASAVEFERFVREES  516

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  517  SKPLKNLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM  576

Query  148  VTIXSVSYCISQSXLEFLKTHD  83
            VT+ S++YCI  + ++ LK ++
Sbjct  577  VTVQSIAYCIGLNVVDVLKRNN  598



>emb|CDX99382.1| BnaC01g11700D [Brassica napus]
Length=508

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = -2

Query  679  YG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            YG  VIQTP+LHPGLFS ++PW S +EFK RM +++RTAH+F L RDKG+G   S +S+ 
Sbjct  309  YGETVIQTPSLHPGLFSGVIPWTSSKEFKTRMLKFSRTAHVFTLLRDKGTGTINSKSSIE  368

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y+L+  DEE+L++GLE++L IL AAGAEEIG ++  G +L V+ AS  E ERFV+EESS+
Sbjct  369  YNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVRTASAVEIERFVREESSK  428

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMG  P+ S V P GETWEVEGLFV D SV PTALGVNPMV+
Sbjct  429  GLKDLSGQICSAHQMGSCRMGTRPEVSAVKPTGETWEVEGLFVADTSVFPTALGVNPMVS  488

Query  142  IXSVSYCISQSXLEFLK  92
            + S++YCI  + ++ LK
Sbjct  489  VQSIAYCIGLNVVDALK  505



>ref|XP_008382148.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A 
[Malus domestica]
Length=768

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 153/201 (76%), Gaps = 1/201 (0%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP-  515
            +G+GYGAVIQTP LHPG+ S ++PW SG++ K RMS ++RTAH+F L RDKGSG   +P 
Sbjct  561  DGSGYGAVIQTPTLHPGMLSIVIPWVSGKDTKRRMSMFSRTAHVFALVRDKGSGTVNAPP  620

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
             SV+Y+++  DE NL  GLEK LRILAAAGAEEIG +H  G +L VK AS  EFERFVKE
Sbjct  621  NSVSYEMEAIDEHNLNTGLEKSLRILAAAGAEEIGTHHFKGKSLAVKKASLDEFERFVKE  680

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
            ESS+SLR        A+QMGSCRMGVD K SVVN  GETWEVE LF+ D SV PTALGVN
Sbjct  681  ESSRSLRDLSSAICLAYQMGSCRMGVDAKGSVVNQMGETWEVERLFLADTSVFPTALGVN  740

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PMVT+ +++YC +QS LE L+
Sbjct  741  PMVTVQAIAYCTAQSVLEVLR  761



>emb|CAA18625.1| putative protein [Arabidopsis thaliana]
 emb|CAB78940.1| putative protein [Arabidopsis thaliana]
Length=678

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            + YG  VIQTPALHPG+FS ++PW S ++FK RM +++RTAHIF L RDKG+G   S T 
Sbjct  477  SSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTIDSKTY  536

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+L+ GLE++L+ILAAAGAEEIG +H  G +L V+ AS  E ERFV+EES
Sbjct  537  IDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREES  596

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVE LFV D SV PTALGVNPM
Sbjct  597  SKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPM  656

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + ++ LK
Sbjct  657  VTVQSIAYCIGLNVVDVLK  675



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 141/194 (73%), Gaps = 0/194 (0%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+IQTPALHPG+FSALMPW SG   K +M ++ RTA++F L RD G+GE  SPT ++Y +
Sbjct  541  AIIQTPALHPGMFSALMPWISGDAHKKKMLKFPRTANLFTLVRDLGTGEVNSPTDISYRV  600

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
            D  DEENL+RG+E +LRILAAAGAEEIG  H  G  L VK A+  E E+FVKEES +  R
Sbjct  601  DDRDEENLRRGMEMVLRILAAAGAEEIGTQHKQGRVLNVKRATEEELEKFVKEESERGFR  660

Query  313  KHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIXS  134
                   SAHQMGSCRMG  P  S V P GE+WEVEGL+V D SV PTALGVNPMVTI +
Sbjct  661  NLSSPMCSAHQMGSCRMGASPAESAVAPDGESWEVEGLYVADSSVFPTALGVNPMVTIQA  720

Query  133  VSYCISQSXLEFLK  92
            ++YC +QS L  L+
Sbjct  721  IAYCTAQSILTRLR  734



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -2

Query  685  TGY-GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            +GY  A+IQTPALHPG+FSALMPW SG++ K RM +Y+RTAH+F L RD+GSG   SP  
Sbjct  536  SGYSAAIIQTPALHPGMFSALMPWLSGRDIKDRMVKYSRTAHLFALVRDRGSGFVASPDH  595

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            V Y +D  D ENL++G+E++LR+LAAAGAEEIG +H  G  LKVK+A   E ERFV EES
Sbjct  596  VGYKMDGADRENLRKGIERVLRVLAAAGAEEIGTHHRNGRVLKVKEAGEEELERFVVEES  655

Query  328  SQSLRKHPXLK-ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
            S+ L ++     +SAHQMGSCRMGV P+ S V P GE+WEV  LFV D SV PTALGVNP
Sbjct  656  SRVLEENLSWPISSAHQMGSCRMGVGPRGSAVGPTGESWEVGALFVADASVFPTALGVNP  715

Query  151  MVTIXSVSYCISQSXLEFL  95
            MVT+ +++YC++Q  ++ L
Sbjct  716  MVTVQAIAYCVAQCVVQSL  734



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            + YG  VIQTPALHPG+FS ++PW S ++FK RM +++RTAHIF L RDKG+G   S + 
Sbjct  524  SSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTINSKSY  583

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+L+ GL+++L+ILAAAGAEEIG +H  G +L V+ AS  E ERFV+EES
Sbjct  584  IDYNLNDEDEESLKSGLDRVLKILAAAGAEEIGTHHSEGRSLNVRTASTLEIERFVREES  643

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  644  SKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM  703

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + ++ LK
Sbjct  704  VTVQSIAYCIGLNVVDVLK  722



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            + YG  VIQTPALHPG+FS ++PW S ++FK RM +++RTAHIF L RDKG+G   S T 
Sbjct  525  SSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTIDSKTY  584

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+L+ GLE++L+ILAAAGAEEIG +H  G +L V+ AS  E ERFV+EES
Sbjct  585  IDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREES  644

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVE LFV D SV PTALGVNPM
Sbjct  645  SKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPM  704

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + ++ LK
Sbjct  705  VTVQSIAYCIGLNVVDVLK  723



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            + YG  VIQTPALHPG+FS + PW S ++FK RM +++RTAHIF L RDKG+G   S + 
Sbjct  560  SSYGETVIQTPALHPGMFSGVTPWASSKDFKTRMLKFSRTAHIFALLRDKGTGTINSKSY  619

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+L++GLE++L+I+AAAGAEEIG ++  G +L V+ AS  EFERFV+EES
Sbjct  620  IDYNLNDEDEESLKKGLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRASAVEFERFVREES  679

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  680  SKPLKNLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM  739

Query  148  VTIXSVSYCISQSXLEFLKTHD  83
            VT+ S++YCI  + ++ LK ++
Sbjct  740  VTVQSIAYCIGLNVVDVLKRNN  761



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = -2

Query  679  YG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            YG  VIQTP+LHPGLFS ++PW S +EFK RM +++RTAH+F L RDKG+G   S +S+ 
Sbjct  572  YGETVIQTPSLHPGLFSGVIPWTSSKEFKSRMLKFSRTAHVFTLLRDKGTGTINSKSSIE  631

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y+L+  DEE+L++GLE++L IL AAGAEEIG ++  G +L VK  S  E ERFV+EESS+
Sbjct  632  YNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVKTTSAVEIERFVREESSK  691

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            SL+       SAHQMGSCRMG  P+ S V P GETWEVEGLFV D SV PTALGVNPMVT
Sbjct  692  SLKDLSGQICSAHQMGSCRMGTSPEVSAVKPTGETWEVEGLFVADTSVFPTALGVNPMVT  751

Query  142  IXSVSYCISQSXLEFLK  92
            + S++YCI  + ++ LK
Sbjct  752  VQSIAYCIGLNVVDALK  768



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            T YG  VIQTPALHPG+FS ++PW SG+EFK RM +++RTAH+F L RDKG+G   S + 
Sbjct  527  TSYGETVIQTPALHPGMFSGIIPWTSGEEFKSRMLKFSRTAHVFTLLRDKGTGTVNSKSC  586

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+L++GLE++L IL AAGAEEIG ++  G +L V+ AS  E ERFV+EES
Sbjct  587  IDYNLNDEDEESLKKGLERVLNILIAAGAEEIGTHNSEGKSLNVRTASEAEIERFVREES  646

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEV GL+V D SV PTALGVNPM
Sbjct  647  SKGLKDLAGQICSAHQMGSCRMGIRPEESAVRPTGETWEVGGLYVADTSVFPTALGVNPM  706

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + ++ L+
Sbjct  707  VTVQSIAYCIGLNVVDVLR  725



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            + YG  VIQTPALHPG+FS + PW S  +FK RM +++RTAHIF L RDKG+G   S + 
Sbjct  571  SSYGETVIQTPALHPGMFSGVTPWTSSNDFKTRMLKFSRTAHIFALLRDKGTGTVNSTSC  630

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+LQ+GLE++L+ILAA+GAEEIG ++  G +L ++ AS  E ERFV+EES
Sbjct  631  IDYNLNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREES  690

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  691  SKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM  750

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + ++ LK
Sbjct  751  VTVQSIAYCIGLNVVDVLK  769



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            + YG  VIQTPALHPG+FS + PW S  +FK RM +++RTAHIF L RDKG+G   S + 
Sbjct  568  SSYGETVIQTPALHPGMFSGVTPWTSSNDFKTRMLKFSRTAHIFALLRDKGTGTVNSTSC  627

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+LQ+GLE++L+ILAA+GAEEIG ++  G +L ++ AS  E ERFV+EES
Sbjct  628  IDYNLNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREES  687

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  688  SKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM  747

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + ++ LK
Sbjct  748  VTVQSIAYCIGLNVVDVLK  766



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = -2

Query  679  YG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            YG  VIQTPALHPG+FS + PW S  +FK RM +++RTAHIF L RDKG+G   S + + 
Sbjct  573  YGETVIQTPALHPGMFSGITPWTSSNDFKTRMLKFSRTAHIFALLRDKGTGTVNSTSCID  632

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y+L+  DEE+L++GLE++L+ILAA+GAEEIG ++  G +L ++ AS  E ERFV+EESS+
Sbjct  633  YNLNDEDEESLKKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREESSK  692

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPMVT
Sbjct  693  PLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVT  752

Query  142  IXSVSYCISQSXLEFLK  92
            + S++YCI  + ++ LK
Sbjct  753  VQSIAYCIGLNVVDVLK  769



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 146/201 (73%), Gaps = 6/201 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +IQTP+LHPG+FSAL PW SG++ K RM +++RTAHIF LARD GSG   S ++++Y LD
Sbjct  522  IIQTPSLHPGMFSALTPWISGRDIKNRMLKFSRTAHIFSLARDAGSGTVTSESNISYRLD  581

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXE----FERFVKEESSQ  323
              D ENL  GLE++LR+LAAAGAEEIG +H  G +LKVK   R +     ERF+KEES +
Sbjct  582  DADRENLGSGLEEVLRVLAAAGAEEIGTHHRDGRSLKVKKKDRDDQAALLERFIKEESRK  641

Query  322  SLRKHPXLK--ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
             L K        SAHQMGSCRMG DP  S V+P GETWEV GLFV D SV PTALGVNPM
Sbjct  642  PLEKESLSSPICSAHQMGSCRMGTDPLRSAVDPNGETWEVGGLFVADTSVFPTALGVNPM  701

Query  148  VTIXSVSYCISQSXLEFLKTH  86
            +T+ ++SYCIS+S L  LK +
Sbjct  702  LTVQAISYCISKSVLNHLKCN  722



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 147/199 (74%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            T YG  VIQTP+LHPG+FS ++PW S  +FK RM +++RTAH+F L RDKG+G   S + 
Sbjct  570  TTYGETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTAHVFTLLRDKGTGTINSKSY  629

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+L++GLE +L IL AAGAEEIG ++  G +L V+ AS  E ERFV+EES
Sbjct  630  IDYNLNDEDEESLKKGLESVLNILIAAGAEEIGTHNSKGKSLNVRTASAVEIERFVREES  689

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+SL+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  690  SKSLKDLSGQICSAHQMGSCRMGIRPEESAVRPMGETWEVEGLFVADTSVFPTALGVNPM  749

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + +  LK
Sbjct  750  VTVQSIAYCIGLNVVGALK  768



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = -2

Query  628  LMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKL  449
            LMPW SG + K RM RY+RTAHIF LARDKGSG   SP++++Y +D+TDEENL+RG+EKL
Sbjct  467  LMPWISGPDMKDRMIRYSRTAHIFALARDKGSGTISSPSTISYQMDETDEENLKRGMEKL  526

Query  448  LRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRKHPXLKASAHQMGSC  269
            LRILAAAGAEEIG ++  G ++ VK  S   FE+FVKEESS++LR       SAHQMGSC
Sbjct  527  LRILAAAGAEEIGTHNCNGRSINVKKVSSHAFEKFVKEESSRALRDLSTPVCSAHQMGSC  586

Query  268  RMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIXSVSYCISQSXLEFL  95
            RMGVDP++S VN  GETWEVEGL+V D SV PTALGVNPMVT+ +++Y  ++S +E L
Sbjct  587  RMGVDPRSSAVNQMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYSTAKSVVEML  644



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 146/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            TGYG VIQTPALHPG+FS + PW SG +FK RM+R+ARTAH+F L RD+GSG      ++
Sbjct  577  TGYGVVIQTPALHPGMFSVVTPWTSGADFKDRMTRFARTAHVFALVRDRGSGTVDGEGNI  636

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y ++K DEE+L+ G+EK+LRI+AAAGAEE+G  H  G   +VK AS  E++ FVKE S 
Sbjct  637  SYRMEKGDEESLKNGVEKMLRIMAAAGAEEVGTQHCKGERFEVKRASAREWDSFVKEASR  696

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + +        SAHQMGSCRMGV+   S V+  GETWEVEGLFV D SV PTALGVNPMV
Sbjct  697  RGVGSLTTPVCSAHQMGSCRMGVEASTSAVDEGGETWEVEGLFVADTSVFPTALGVNPMV  756

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC ++S ++ L+
Sbjct  757  TVQAIAYCTARSIVQVLR  774



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            + YG  VIQTP+LHPG+FS ++PW S ++FK RM +++RTAH+F L RD+G+G   S + 
Sbjct  551  SSYGETVIQTPSLHPGMFSGIIPWTSSKDFKTRMLKFSRTAHVFALLRDRGTGTISSKSC  610

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L   DEE+L++GLE++L IL AAGAEEIG ++  G +L +  A+  +  RFV+EES
Sbjct  611  IDYNLQDEDEESLKKGLERVLEILIAAGAEEIGTHNSEGKSLNITTANALQIARFVREES  670

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  671  SKGLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM  730

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + LE LK
Sbjct  731  VTVQSIAYCIGLNVLEVLK  749



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            T YG  VIQTP+LHPG+FS ++PW S  +FK RM +++RTAH+F L RDKG+G   S + 
Sbjct  570  TTYGETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTAHVFTLLRDKGTGTINSKSY  629

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            + Y+L+  DEE+L++GL  +L IL AAGAEEIG ++  G +L V+ AS  E +RFV+EES
Sbjct  630  IDYNLNDEDEESLKKGLGSVLNILIAAGAEEIGTHNSEGKSLNVRTASAVEIKRFVREES  689

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            S+SL+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  690  SKSLKDLSGQICSAHQMGSCRMGIRPEESAVKPTGETWEVEGLFVADTSVFPTALGVNPM  749

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ S++YCI  + +  LK
Sbjct  750  VTVQSIAYCIGLNVVGALK  768



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 146/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            TGYG VIQTPALHPG+FS + PW SG +FK RM+R+ARTAH+F LARD+GSG      ++
Sbjct  581  TGYGTVIQTPALHPGMFSVVTPWTSGADFKDRMTRFARTAHVFALARDRGSGTVDGEGNI  640

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y +++ DEE+L++G+EK+L I+A AGAEE+G  H  G   +VK AS  E+ERFV + S 
Sbjct  641  SYRMERGDEESLKKGVEKMLWIMAGAGAEEVGTQHCKGERFEVKRASAREWERFVIKASR  700

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + +        SAHQMGSCRMGV+   S V+ +GETWEVEGLFV D SV PTALGVNPMV
Sbjct  701  RVVGWLTTPVCSAHQMGSCRMGVEDTTSAVDERGETWEVEGLFVADASVFPTALGVNPMV  760

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ +++YC + S ++ L+
Sbjct  761  TVQAIAYCTAHSIVQVLR  778



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  679  YGA-VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            YG  +IQTPALHPG+FS ++PW SG+++K RM +++RTAH+F L RDKGSGE  S  S+T
Sbjct  584  YGTTIIQTPALHPGMFSGIIPWTSGKDYKNRMLKFSRTAHVFALTRDKGSGEIRSLNSIT  643

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y L+ TDEENL++G+E++LRIL AAGAEEIG ++  G +L VK AS  E+ERFV+EESS+
Sbjct  644  YTLNGTDEENLKKGIERILRILTAAGAEEIGTHNLEGKSLNVKAASSEEYERFVREESSK  703

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             L+       SAHQMGSCRMGV  + S V P GETWEVEGLFV D SV PTALGVNPMVT
Sbjct  704  PLKGLSGQICSAHQMGSCRMGVAAEKSAVRPTGETWEVEGLFVADTSVFPTALGVNPMVT  763



>ref|XP_006878629.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYG +IQ PALHPG+FS +MPW S  + K RM+R++RT H+F L RDKGSG   SP  +
Sbjct  607  SGYGGLIQNPALHPGMFSVVMPWMSSLDMKERMTRFSRTVHLFALVRDKGSGVVSSPPYL  666

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            +Y +  +D+E +   +EK+LRILAAAGAEEIG +   G  + VK AS  EFERFV+E S 
Sbjct  667  SYKMSHSDKETMSNCMEKMLRILAAAGAEEIGTHGSNGERINVKVASSHEFERFVREVSR  726

Query  325  QSLRK----HPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  158
            + L++    +     SAHQMG+CRMG  P  SVV+ KGE WEVEGL++ D SV PTALGV
Sbjct  727  KPLQRFSNGYWRPICSAHQMGTCRMGAHPNDSVVDQKGECWEVEGLYIADSSVFPTALGV  786

Query  157  NPMVTIXSVSYCISQSXLE  101
            NPM+T+ +++YC + + L+
Sbjct  787  NPMLTVQAIAYCTAHAALD  805



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 2/196 (1%)
 Frame = -2

Query  679  YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTY  500
            Y  +++TPALHPG+F+   PW S  +F+ RM+R++RTAH+F L RDKGSG    P S+TY
Sbjct  568  YDILLETPALHPGMFAVATPWISAADFRERMTRFSRTAHVFALVRDKGSGTTDYPHSLTY  627

Query  499  DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQS  320
             +D  DEE L++G+E ++RILAAAGAEE+G  H  G  ++V +    E+   VKE   + 
Sbjct  628  GMDAEDEEKLKKGVEAMVRILAAAGAEEVGTLHCKGERVRVGEEGGVEW--LVKEVRRRG  685

Query  319  LRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI  140
            LR      ++AHQMGSCRMG D +A  V+P GE WEVEGLFV D SV PTALGVNPMVT 
Sbjct  686  LRDGGTPVSTAHQMGSCRMGTDARAGAVSPTGEVWEVEGLFVADTSVFPTALGVNPMVTA  745

Query  139  XSVSYCISQSXLEFLK  92
             +++YC +QS LEFL+
Sbjct  746  QAIAYCTAQSILEFLE  761



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 135/199 (68%), Gaps = 1/199 (1%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            + Y  ++QTPALHPG+F+ + PW S  +F+ RM+R++RTAHIF L RDKGSG A  P SV
Sbjct  540  SSYCTLLQTPALHPGMFATVTPWLSAADFRERMTRFSRTAHIFALVRDKGSGTADYPESV  599

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTG-LTLKVKDASRXEFERFVKEES  329
             Y +D+ DEE L+R LE  +RILAAAGAEE+G +HG G              E  V E  
Sbjct  600  VYRMDEEDEEKLKRSLEAAVRILAAAGAEEVGTHHGKGERVKVGGRGGGEGVEELVTEVV  659

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
             + LR      ++AHQMGSCRM  D K   V+P+GETWEVEGL+V D SV PTALGVNPM
Sbjct  660  RRGLRDGKTPISTAHQMGSCRMAADAKEGAVSPRGETWEVEGLYVADTSVFPTALGVNPM  719

Query  148  VTIXSVSYCISQSXLEFLK  92
            VT+ +++YC +QS L+ L+
Sbjct  720  VTVQAIAYCTAQSILQVLQ  738



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -2

Query  550  ARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKD  371
            A DKGSG   S TS++Y +D TDE NLQ+GLEK+LRILAAAGAEEIG +H  G TLKVK 
Sbjct  590  AMDKGSGTIASSTSISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIGTHHNEGKTLKVKQ  649

Query  370  ASRXEFERFVKEESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  191
             S  EFERFVKEES++ ++       SAHQMGSCRMG +P++SVVNP GETWEVEGL+V 
Sbjct  650  VSYHEFERFVKEESARPIKGQSTPICSAHQMGSCRMGPNPRSSVVNPMGETWEVEGLYVA  709

Query  190  DGSVLPTALGVNPMVTIXSVSYCISQSXLEFLK  92
            D SV PTALGVNPMVT+ +++YC +QS LE L+
Sbjct  710  DTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  742



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = -2

Query  550  ARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKD  371
            A DKGSG   S TS++Y +D  DE+NLQ+GLEK+LRILAAAGAEEIG +HG G TLKVK 
Sbjct  600  AMDKGSGTITSSTSISYKMDDADEQNLQKGLEKVLRILAAAGAEEIGSHHGEGKTLKVKQ  659

Query  370  ASRXEFERFVKEESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  191
             S  EFE+FVKEES++S++       SAHQMGSCRMG DP++S VNP GETWEVEGL+V 
Sbjct  660  VSYHEFEQFVKEESARSIKGLSTPICSAHQMGSCRMGPDPRSSAVNPMGETWEVEGLYVA  719

Query  190  DGSVLPTALGVNPMVTIXSVSYCISQSXLEFLK  92
            D SV PTALGVNPMVT+ +++YC +QS LE L+
Sbjct  720  DTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  752



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 138/200 (69%), Gaps = 1/200 (1%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +GYG +IQTPA+ PG F++++PW SG + K RM +Y RTAH+F LARD+GSG       +
Sbjct  536  SGYGTIIQTPAIAPGSFASMIPWTSGLDMKERMQKYHRTAHVFCLARDRGSGSVGGEKDL  595

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
             Y   ++D++NL+ GL + ++IL AAGA E+G +   G  L VK A+  E E F+  +  
Sbjct  596  DYRFAESDKDNLKEGLRRCVQILIAAGATEVGTHRSDGERLAVKGATDDEIEEFLNNKGK  655

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
                  P    SAHQMGSCRMG D ++  V+ KGE+WEVEGLFV DGS+LPT++GVNPM+
Sbjct  656  GRRGVWPTF-FSAHQMGSCRMGKDEESGGVDWKGESWEVEGLFVCDGSLLPTSVGVNPMI  714

Query  145  TIXSVSYCISQSXLEFLKTH  86
            TI S+++C++   L+FL+T+
Sbjct  715  TIQSLAFCVANYILQFLRTN  734



>ref|XP_006857358.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
 gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 129/199 (65%), Gaps = 4/199 (2%)
 Frame = -2

Query  676  GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYD  497
            G +I+TP L P  FSA+ PW SG E K  M RYART HIF L RD GSGE      +TY+
Sbjct  578  GVIIETPFLGPASFSAIFPWLSGSEMKEAMRRYARTVHIFVLVRDTGSGEVMKERKITYN  637

Query  496  LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ES  329
            L +TD E  ++GL   LRIL AAGA E+G +   G  +K K     +FE F+        
Sbjct  638  LHRTDREKFKKGLRTALRILVAAGAVEVGTHRSDGQRIKTKGMRDEDFEEFLDGIEVFGG  697

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            + S  +   L  SAHQMGSCRMG D + S V+ +GE+WE EGLFV DGS++PTALGVNPM
Sbjct  698  AYSGEEKWNLYTSAHQMGSCRMGADEEKSAVDERGESWEAEGLFVCDGSLMPTALGVNPM  757

Query  148  VTIXSVSYCISQSXLEFLK  92
            +T+ S+++CIS + +EFL+
Sbjct  758  ITVQSIAHCISDNMVEFLR  776



>ref|XP_009376994.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Pyrus x bretschneideri]
Length=749

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 132/198 (67%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG FSAL PW SG++ K RM +++RTAH+  + RDKGSG       V+Y+ 
Sbjct  550  AIIETPALGPGTFSALSPWVSGEDIKNRMLKFSRTAHLISIIRDKGSGVVTKGGRVSYEF  609

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF----VKEESS  326
               D+EN++ GL + LRIL AAGA E+G +   GL LK K   + E E F    +  E  
Sbjct  610  SALDKENIKGGLRQALRILIAAGAIEVGTHRSDGLRLKCKGIDKEELEEFLDMVIANEGP  669

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            QSL ++    +SAHQMGSCRMG++ K   V+  GE+WE E LFV DGSVLP+A+GVNPM+
Sbjct  670  QSLVENWTTYSSAHQMGSCRMGINAKEGAVDENGESWEAESLFVCDGSVLPSAVGVNPMI  729

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   + L+
Sbjct  730  TIQSTAYCLSKRIADSLR  747



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 129/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I++P L PG F+AL PW SG E K R+ +YARTAH+F + RD+GSGE      + Y L
Sbjct  544  AIIESPILGPGQFAALCPWESGVEIKNRILKYARTAHLFSMIRDRGSGEVMLEGRINYKL  603

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF----VKEESS  326
            DK D+EN++ GL + LRIL AAGA E+G +   G  LK K  +  E E+F    + E+  
Sbjct  604  DKYDKENMKVGLRRALRILIAAGAVEVGTHQSDGQKLKCKGITEKEVEKFLDNVIAEDGP  663

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S+ +     +SAHQMGSCRM    K   V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  664  KSMVEKWTTYSSAHQMGSCRMAKSEKDGAVDENGESWEAEGLFVCDASVLPGAVGVNPMI  723

Query  145  TIXSVSYCISQSXLEFLK  92
            TI + SYC+S+   E LK
Sbjct  724  TIQTTSYCLSKKIAEKLK  741



>gb|KFK39637.1| hypothetical protein AALP_AA3G269600 [Arabis alpina]
Length=744

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  FSAL PW SG + K RMSRY+RTA++  + RD GSGE  +   + Y +
Sbjct  542  AIIETPALGPASFSALCPWTSGLDMKRRMSRYSRTANLITIVRDCGSGEVKTEGRIRYTV  601

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD ENL+ GL + LRIL AAGAEE+G N   G  L  K       E F+     EE  
Sbjct  602  DKTDRENLKAGLRQSLRILIAAGAEEVGTNTSDGQRLICKGVDEKSIEEFLDSVNAEEGP  661

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S+ ++  + +SAHQMGSCR+G D K   ++  GE+WE E LFV DGSVLP+A+GVNPM+
Sbjct  662  KSMTENWNVYSSAHQMGSCRIGEDEKEGALDLNGESWEAEKLFVCDGSVLPSAIGVNPMI  721

Query  145  TIXSVSYCIS  116
            TI S +YCIS
Sbjct  722  TIMSTAYCIS  731



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG FS+L PW SG++ K RM +Y RT H+  + RD+GSG       V+Y+ 
Sbjct  546  AIIETPALGPGAFSSLCPWESGEDIKKRMLKYGRTCHLISIIRDRGSGIVMKGGRVSYEF  605

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            + +D+ENL+ GL + LRIL AAGA E+G +   GL +K K   + + E F+     E+  
Sbjct  606  EASDKENLEAGLRQALRILIAAGAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAEKGP  665

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            QSL ++    +SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP+A+GVNPM+
Sbjct  666  QSLVENWTTYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMI  725

Query  145  TIXSVSYCISQ  113
            TI S +YC+S+
Sbjct  726  TIQSTAYCLSK  736



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG FS+L PW SG++ K RM +Y RT H+  + RD+GSG       V+Y+ 
Sbjct  520  AIIETPALGPGAFSSLCPWVSGEDIKKRMLKYGRTCHLISIIRDRGSGIVMKGGRVSYEF  579

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            + +D+ENL+ GL + LRIL AAGA E+G +   GL +K K   + + E F+     E+  
Sbjct  580  EASDKENLEAGLRQALRILIAAGAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAEKGP  639

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            QSL ++    +SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP+A+GVNPM+
Sbjct  640  QSLVENWTTYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMI  699

Query  145  TIXSVSYCISQ  113
            TI S +YC+S+
Sbjct  700  TIQSTAYCLSK  710



>emb|CDO99261.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I++PAL P  F+AL PW SG E K RM +YARTAH+F + RD+GSGE  S   +++  
Sbjct  546  ALIESPALGPASFAALRPWESGLESKKRMLKYARTAHLFSMIRDRGSGEVRSEGRISHTF  605

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
            D TD+ENL  GL + LRIL AAGA E+G     G   K K  S  E E F+ E ++    
Sbjct  606  DATDKENLTAGLRQALRILVAAGAVEVGTLQSDGQKFKCKGTSEGELEEFLDEVTAAGGP  665

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL ++     SAHQMGSCRMG   K   V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  666  KSLVQNWTTYFSAHQMGSCRMGKSEKVGAVDENGESWEAEGLFVCDASVLPGAVGVNPMI  725

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S    E LK
Sbjct  726  TIQSTAYCLSNKIAEILK  743



>ref|XP_011462285.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462286.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=697

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 133/200 (67%), Gaps = 4/200 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG F+AL PW SG + K RM R++RTAH+  + RDKGSG   +    +Y+L
Sbjct  487  AIIETPALGPGSFAALCPWESGLDMKKRMLRFSRTAHLITIIRDKGSGVIRTEGRASYEL  546

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            D +D+EN++ G+ + LRIL AAGA E+G +   GL LK +   +   E F+     EE  
Sbjct  547  DVSDKENMKAGMRQALRILIAAGAVEVGTHRSDGLRLKCEGIDKEGLEEFLDKVSAEEGP  606

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            QSL +     +SAHQMGSCRMG++ K   V+  GE+WE EGLFV DGSVLP+A+GVNPM+
Sbjct  607  QSLVEKWTPYSSAHQMGSCRMGINEKEGAVDQNGESWEAEGLFVCDGSVLPSAVGVNPMI  666

Query  145  TIXSVSYCISQSXLEFLKTH  86
            TI S +Y +S+   E L+  
Sbjct  667  TIESTAYYLSKRLAESLRNQ  686



>ref|XP_006354464.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Solanum 
tuberosum]
Length=667

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+ PAL PG F+AL PW SG++ K R+ +Y RTAH+F + +D GSGE  S   + Y  
Sbjct  464  AIIEAPALGPGSFAALCPWTSGEDIKNRLLKYDRTAHLFAMVKDVGSGEVRSEGRINYTF  523

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            + TD+E+L+ GL + LRIL AAGA E+G     G  +K K  S    E F+      E  
Sbjct  524  NGTDKESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCKGQSEKALESFLDTVTAAEGP  583

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL K      SAHQMGSCRMG++ K S V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  584  KSLVKDFTTYCSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMI  643

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E +K
Sbjct  644  TIQSTAYCLSKKIAEMIK  661



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 132/199 (66%), Gaps = 4/199 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE  +   ++Y +
Sbjct  542  AIIETPALGPASFSVLCPWTSGVDMKKRMSRYSRTANLITIVRDRGSGEVKTEGRISYVV  601

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD+ENL+ GL + LRIL AAGAEE+G +   G  L  K       E F+     EE  
Sbjct  602  DKTDKENLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVSAEEGP  661

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +++ +   + +SAHQMGSCR+G D K   ++  GE+WE E LFV DGSVLP+A+GVNPM+
Sbjct  662  KAMTEKWGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERLFVCDGSVLPSAVGVNPMI  721

Query  145  TIXSVSYCISQSXLEFLKT  89
            TI S +YCIS   ++ + T
Sbjct  722  TIMSTAYCISTRIVKSMTT  740



>emb|CDX85097.1| BnaC07g08090D [Brassica napus]
Length=743

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 132/200 (66%), Gaps = 4/200 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE  +   ++Y +
Sbjct  540  AIIETPALGPASFSVLCPWTSGVDMKKRMSRYSRTANLITIVRDRGSGEVKTEGRISYVV  599

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD+ENL+ GL + LRIL AAGAEE+G +   G  L  K       E F+     EE  
Sbjct  600  DKTDKENLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVSAEEGP  659

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +++ +   + +SAHQMGSCR+G D K   ++  GE+WE E LFV DGSVLP+A+GVNPM+
Sbjct  660  KAMTEKWGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERLFVCDGSVLPSAVGVNPMI  719

Query  145  TIXSVSYCISQSXLEFLKTH  86
            TI S +YCIS   ++ + T 
Sbjct  720  TIMSTAYCISTRIVKSMTTR  739



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 129/204 (63%), Gaps = 4/204 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            + +G  A+I++PAL PG F+AL PW SG E K R+ +YARTAH+F + RD+GSGE  +  
Sbjct  540  DDSGVRALIESPALGPGSFAALRPWESGLETKKRILKYARTAHLFSMIRDRGSGEVRAEG  599

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE-  335
             ++Y  D TD+EN+  GL + L IL AAGA E+G     G   K K  S  E E F+ E 
Sbjct  600  RISYTFDATDKENITAGLRQALMILVAAGAVEVGTLQSNGQKFKCKGTSERELEEFLDEV  659

Query  334  ---ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
               E  +SL ++     SAHQMGSCRMG   K S V+  GE+WE E LFV D SVLP A+
Sbjct  660  TAAEGPKSLVQNWTTYFSAHQMGSCRMGKSEKVSAVDENGESWEAEDLFVCDASVLPGAV  719

Query  163  GVNPMVTIXSVSYCISQSXLEFLK  92
            GVNPM+TI S ++C+S    E LK
Sbjct  720  GVNPMITIQSTAFCLSNKIAEILK  743



>ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=765

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 133/200 (67%), Gaps = 4/200 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG F+AL PW SG + K RM R++RTAH+  + RDKGSG   +    +Y+L
Sbjct  555  AIIETPALGPGSFAALCPWESGLDMKKRMLRFSRTAHLITIIRDKGSGVIRTEGRASYEL  614

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            D +D+EN++ G+ + LRIL AAGA E+G +   GL LK +   +   E F+     EE  
Sbjct  615  DVSDKENMKAGMRQALRILIAAGAVEVGTHRSDGLRLKCEGIDKEGLEEFLDKVSAEEGP  674

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            QSL +     +SAHQMGSCRMG++ K   V+  GE+WE EGLFV DGSVLP+A+GVNPM+
Sbjct  675  QSLVEKWTPYSSAHQMGSCRMGINEKEGAVDQNGESWEAEGLFVCDGSVLPSAVGVNPMI  734

Query  145  TIXSVSYCISQSXLEFLKTH  86
            TI S +Y +S+   E L+  
Sbjct  735  TIESTAYYLSKRLAESLRNQ  754



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  F+AL PW SG + K RM++YARTAH+  + RD GSG+  +   ++Y+L
Sbjct  544  AIIETPALGPSSFAALYPWVSGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEGRISYNL  603

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ---  323
            D  D+ENL+ GL + LRIL AAGA E+G +   G  +K +   + + E F+    +    
Sbjct  604  DAMDKENLKAGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATAGP  663

Query  322  -SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             SL +   L  SAHQMGSCRMG++ K   V+  GE+WE EGLF+ D SVLP+A+GVNPM+
Sbjct  664  LSLAEDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEGLFICDASVLPSAVGVNPMI  723

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  724  TIQSTAYCLSKKIAESLR  741



>ref|XP_004157702.1| PREDICTED: long-chain-alcohol oxidase FAO1-like, partial [Cucumis 
sativus]
Length=349

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 124/197 (63%), Gaps = 4/197 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TP L PG  + L+PW SG + K RM +Y+RTAH   + RD GSG   S   V+Y+L 
Sbjct  152  IIETPLLGPGSCAVLVPWVSGLDIKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLS  211

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ----  323
            + D ENL++GL + LRIL AAGA E+G +   G  L+ K   + E E F+   S++    
Sbjct  212  EEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLL  271

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            SL K   +  SAHQMGSC++GV      ++  GE+WE EGLFV D SVLPTA+GVNPM+T
Sbjct  272  SLSKDWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMIT  331

Query  142  IXSVSYCISQSXLEFLK  92
            I S +YCIS      L+
Sbjct  332  IQSTAYCISNRIAALLR  348



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+ PAL PG F+AL PW SG++ K R+ +Y RTAH+F + +D GSGE  S   + Y  
Sbjct  538  AIIEAPALGPGSFAALCPWTSGEDIKNRLLKYDRTAHLFAMVKDVGSGEVRSEGRINYTF  597

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            + TD+E+L+ GL + LRIL AAGA E+G     G  +K K  S    E F+      E  
Sbjct  598  NGTDKESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCKGQSEKALESFLDTVTAAEGP  657

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL K      SAHQMGSCRMG++ K S V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  658  KSLVKDFTTYCSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMI  717

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E +K
Sbjct  718  TIQSTAYCLSKKIAEMIK  735



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+  AL PG F+AL PW SG++ K R+ +Y+RTAH+F + +D GSGE  S   ++Y  
Sbjct  539  AIIEATALGPGSFAALCPWTSGEDLKNRLLKYSRTAHLFAMVKDVGSGEVRSDGRISYTF  598

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            + TD+E+L++GL++ LRIL AAGA+E+G     G  +K K  S  E E F+      E  
Sbjct  599  NATDKESLKQGLKQALRILIAAGADEVGTQRSDGQRMKCKGKSEKEIEAFLNTVTAAEGP  658

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL K+    +SAHQMGSCRMG+  K   V+  GE+WE  GLFV D SVLP A+GVNPM+
Sbjct  659  KSLVKNFTTYSSAHQMGSCRMGMSEKDGAVDENGESWEANGLFVCDASVLPGAVGVNPMI  718

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E +K
Sbjct  719  TIQSTAYCLSKKIAEMIK  736



>ref|XP_011459707.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=546

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 132/204 (65%), Gaps = 4/204 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            N     A+++TPA+ P  F+ L+PW SG + K RM++YARTAH+F L RDKGSGE  +  
Sbjct  337  NNQNVRAIVETPAIGPASFATLVPWVSGLDMKDRMAKYARTAHLFALVRDKGSGEVRAEN  396

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF---V  341
             + Y LD++D+EN+Q GL + +RIL AAGA E+G     G  +  K   + + E F   V
Sbjct  397  KIEYRLDRSDKENIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSV  456

Query  340  KEESSQSLR-KHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
                  S R +H  + +SAHQMGSC+MG   K   V+  GE+WE +GLFV DGS+LPTA+
Sbjct  457  IAVGGPSTRGEHWTMYSSAHQMGSCKMGATEKEGGVDENGESWEAKGLFVCDGSLLPTAV  516

Query  163  GVNPMVTIXSVSYCISQSXLEFLK  92
            GVNPM+TI S +YC+S+   + LK
Sbjct  517  GVNPMITIQSTAYCLSKKIADSLK  540



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  F +L+PW SG + K RM +YARTAH+F L RD+GSGE  S   +TY+ 
Sbjct  558  AIIETPALGPAAFGSLVPWVSGLDMKKRMVKYARTAHLFALIRDQGSGEVKSRGMITYEF  617

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ---  323
             K+D+ENL+ GL++ LRIL AAGA E+G +   G  +K K     + E F++  ++    
Sbjct  618  SKSDKENLKAGLQQALRILIAAGAVEVGTHRNDGQRIKCKGIKEEDLEEFLETVTTAGGF  677

Query  322  -SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  ++  L +SAHQMGSCRM    K   V+  GE+WE EGL+V DGSVLP A+GVNPM+
Sbjct  678  LSGEENWTLYSSAHQMGSCRMSSTEKEGAVDENGESWEAEGLYVCDGSVLPNAVGVNPMI  737

Query  145  TIXSVSYCISQ  113
            TI S++YC+S+
Sbjct  738  TIQSIAYCLSK  748



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  F +L+PW SG + K RM +YARTAH+F L RD+GSGE  S   +TY+ 
Sbjct  552  AIIETPALGPAAFGSLVPWVSGLDMKKRMVKYARTAHLFALIRDQGSGEVKSRGMITYEF  611

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ---  323
             K+D+ENL+ GL++ LRIL AAGA E+G +   G  +K K     + E F++  ++    
Sbjct  612  SKSDKENLKAGLQQALRILIAAGAVEVGTHRNDGQRIKCKGIKEEDLEEFLETVTTAGGF  671

Query  322  -SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  ++  L +SAHQMGSCRM    K   V+  GE+WE EGL+V DGSVLP A+GVNPM+
Sbjct  672  LSGEENWTLYSSAHQMGSCRMSSTEKEGAVDENGESWEAEGLYVCDGSVLPNAVGVNPMI  731

Query  145  TIXSVSYCISQ  113
            TI S++YC+S+
Sbjct  732  TIQSIAYCLSK  742



>ref|XP_002464495.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
 gb|EER91493.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
Length=774

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 128/198 (65%), Gaps = 6/198 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F++LMPW SG++ K RM RYARTAH F L RD+G+G       V Y  +
Sbjct  569  IIETPALGPGCFASLMPWESGRDMKERMRRYARTAHAFALVRDRGAGTVDGEGRVRYTPN  628

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR-XEFERFVKEESSQS--  320
            + D E L+ GL + LRIL AAGA E+G +   G  L+     R  E E F+ E +     
Sbjct  629  RADAEELRNGLRRALRILVAAGAAEVGTHRSDGFGLRCNGGVRDDELEAFLDEVTVAEGP  688

Query  319  LRKHP---XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            +R  P    L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM
Sbjct  689  MRPGPDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPM  748

Query  148  VTIXSVSYCISQSXLEFL  95
            +TI S+++C+S+   E L
Sbjct  749  ITIQSIAFCLSKGIAETL  766



>gb|AAL31049.1|AC078893_12 putative oxidase [Oryza sativa Japonica Group]
 gb|ABB47786.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=595

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 124/191 (65%), Gaps = 5/191 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+AL+PW SG++ K RM RYARTAH F L RD+G+G       V Y   
Sbjct  392  IIETPALGPGAFAALVPWESGRDMKERMRRYARTAHAFALVRDRGAGSVDGEGRVRYAPS  451

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D E L+ GL + LRIL AAGA E+G +   G  L+ K A   + E F+ E + +    
Sbjct  452  RDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLRCKGARDADVEAFLDEVTVEKGPM  511

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       +  SAHQMGSCRMG  P+   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  512  HSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVGVNPMI  571

Query  145  TIXSVSYCISQ  113
            TI S++YC+++
Sbjct  572  TIQSIAYCVAK  582



>gb|AAL31027.1|AC078948_11 putative alcohol oxidase [Oryza sativa Japonica Group]
 gb|AAP54254.1| GMC oxidoreductase family protein [Oryza sativa Japonica Group]
Length=637

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 126/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG FSA++PW SG++ K RM RYARTAH F L RD+G+G       V +   
Sbjct  439  IIETPALGPGAFSAVVPWESGRDMKERMRRYARTAHAFALVRDRGAGAVDGEGRVRFSPS  498

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D E L+ GL + LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  499  RDDAEELRAGLRRALRILVAAGAAEVGTHRSDGLRLRCKGVRDADVEAFLDEVTIEKGPM  558

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +P      +  SAHQMGSCRMG  P+   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  559  YPGSDKWAIFCSAHQMGSCRMGASPRDGAVDGAGESWEAEGLYVCDGSLLPTAVGVNPMI  618

Query  145  TIXSVSYCISQSXLEFL  95
            TI S++YC+S    + L
Sbjct  619  TIQSIAYCLSNGIADTL  635



>gb|AAL31021.1|AC078948_5 putative alcohol oxidase [Oryza sativa Japonica Group]
Length=590

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 124/191 (65%), Gaps = 5/191 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+AL+PW SG++ K RM RYARTAH F L RD+G+G       V Y   
Sbjct  387  IIETPALGPGAFAALVPWESGRDMKERMRRYARTAHAFALVRDRGAGSVDGEGRVRYAPS  446

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D E L+ GL + LRIL AAGA E+G +   G  L+ K A   + E F+ E + +    
Sbjct  447  RDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLRCKGARDADVEAFLDEVTVEKGPM  506

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       +  SAHQMGSCRMG  P+   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  507  HSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVGVNPMI  566

Query  145  TIXSVSYCISQ  113
            TI S++YC+++
Sbjct  567  TIQSIAYCVAK  577



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 130/198 (66%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+ PAL PG F+AL PW SG++ K R+ +Y+RTAH+F + +D GSG+  S   ++Y  
Sbjct  539  AIIEAPALGPGSFAALCPWTSGEDLKNRLLKYSRTAHLFAMVKDVGSGKVRSDGRISYKF  598

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            +  D+E+L++GL + LRIL AAGA+E+G     G  +K K  S  E E F+      E  
Sbjct  599  NAMDKESLKQGLRQALRILIAAGADEVGTQRSDGQRMKCKGKSEKEIEAFLDTVTAAEGP  658

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL K+    +SAHQMGSCRMG+  K   V+  GE+WE  GLFV D SVLP A+GVNPM+
Sbjct  659  KSLVKNFTTYSSAHQMGSCRMGMSKKDGAVDENGESWEANGLFVCDASVLPGAVGVNPMI  718

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E +K
Sbjct  719  TIQSTAYCLSKKIAETIK  736



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 130/197 (66%), Gaps = 4/197 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPA+ P  F+AL PW SG+E K  M +Y+RTAH+F L RD+G+GE     +V Y L
Sbjct  541  AIIETPAVGPASFAALFPWTSGREMKDAMVKYSRTAHLFALIRDQGAGEIKVKANVKYRL  600

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
            ++TD+ENL+ GL + LRIL AAGA E+G     G  ++ +  ++ E E F+    +    
Sbjct  601  NQTDKENLRIGLRQALRILIAAGATEVGTYRSDGQRIRCQGTNKEELEEFLDSVEAVGGP  660

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S +K+  +  SAHQM SCRMG   +   V+  GE+WE EGLFV DGSVLPTA+GVNPM+
Sbjct  661  LSRQKYWTMYCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMI  720

Query  145  TIXSVSYCISQSXLEFL  95
            TI S +YCIS+   E L
Sbjct  721  TIQSTAYCISKKIAESL  737



>tpg|DAA49655.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=448

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 127/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RY+RTAH F L RD+G G       V +   
Sbjct  244  IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPS  303

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D + L+ GL ++LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  304  REDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPM  363

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  364  HSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  423

Query  145  TIXSVSYCISQSXLEFL  95
            TI S+++C+S+   E +
Sbjct  424  TIQSIAFCLSKGIAETM  440



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 126/197 (64%), Gaps = 4/197 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+AL PW SG + K  M +YARTAH+F L RD+GSGE      +TY L 
Sbjct  546  IIETPALGPGSFAALFPWVSGLDMKECMVKYARTAHLFALVRDQGSGEVKIQGRITYRLS  605

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESSQ  323
            + D+ENL+ GL + LRIL AAGA E+G +   G  +K +     + E F+      E   
Sbjct  606  ELDKENLKAGLRRALRILIAAGAVEVGTHRSDGQRIKCRGIKEEDLEEFLDTVSAVEGPM  665

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            S  +H  + ASAHQMGSCRM    K   V+  GE+WE EGL+V DGSV P ALGVNPM+T
Sbjct  666  SREEHWTIYASAHQMGSCRMSAKEKDGAVDENGESWEAEGLYVCDGSVFPNALGVNPMIT  725

Query  142  IXSVSYCISQSXLEFLK  92
            I S++YC+S+   E L+
Sbjct  726  IQSIAYCLSKKIAESLE  742



>ref|XP_006589282.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Glycine 
max]
Length=649

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 132/198 (67%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++TPAL PG  S L+PW SG +FK RM +Y+RT H+  + RD G GE  S   V Y+L
Sbjct  450  AIVETPALGPGALSTLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSEGRVHYEL  509

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE-ESSQSL  317
            D++D+EN++ G+++ LRIL AAGA E+G +   G  ++    +  E ERFV+   +++ L
Sbjct  510  DESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATEGL  569

Query  316  RKHP---XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
              H     + +SAHQMGSCRMG+  K   V+  G +WE EGLFV D S+LPTA+GVNPM+
Sbjct  570  MSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMI  629

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+++    FLK
Sbjct  630  TIQSTAYCVAKRIAAFLK  647



>gb|KHN30591.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=649

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 132/198 (67%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++TPAL PG  S L+PW SG +FK RM +Y+RT H+  + RD G GE  S   V Y+L
Sbjct  450  AIVETPALGPGALSTLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSEGRVHYEL  509

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE-ESSQSL  317
            D++D+EN++ G+++ LRIL AAGA E+G +   G  ++    +  E ERFV+   +++ L
Sbjct  510  DESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATEGL  569

Query  316  RKHP---XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
              H     + +SAHQMGSCRMG+  K   V+  G +WE EGLFV D S+LPTA+GVNPM+
Sbjct  570  MSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMI  629

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+++    FLK
Sbjct  630  TIQSTAYCVAKRIAAFLK  647



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 129/197 (65%), Gaps = 4/197 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPA+ P  F+AL PW SG+E K  M +Y+RTAH+F L RD+G+GE     +V Y L
Sbjct  541  AIIETPAVGPASFAALFPWTSGREMKDAMVKYSRTAHLFALVRDQGAGEIKVKANVKYRL  600

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
            ++TD+ENL+ GL + LRIL AAGA EIG     G  ++ +   + + E F+    +    
Sbjct  601  NQTDKENLKIGLRQALRILIAAGATEIGTYRSDGQRIRCQGTKKEDLEEFLDSVEAVGGP  660

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S +K+  +  SAHQM SCRMG   +   V+  GE+WE EGLFV DGSVLPTA+GVNPM+
Sbjct  661  WSRQKYWTMYCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMI  720

Query  145  TIXSVSYCISQSXLEFL  95
            TI S +YCIS+   E L
Sbjct  721  TIQSTAYCISKKIAESL  737



>ref|XP_002464496.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
 gb|EER91494.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
Length=732

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 126/198 (64%), Gaps = 6/198 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +IQTPAL PG +++L+PW SG++ K RM RYARTAH F L RD+G+G       V Y   
Sbjct  529  IIQTPALGPGCWASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGHVDGEGRVRYAPS  588

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXE-FERFVKEESSQSLR  314
            + D E L+ GL + LRIL AAGA E+G +   GL L+     R E  E F+KE +     
Sbjct  589  REDVEELRNGLRQALRILVAAGAAEVGTHRSDGLRLRCDGGLRDEDLEAFLKEVTVGEGP  648

Query  313  KHP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
              P      L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGSVLPTA+GVNPM
Sbjct  649  MLPGPDKWALHCSAHQMGSCRMGCSPKDGAVDGRGESWEAEGLYVCDGSVLPTAVGVNPM  708

Query  148  VTIXSVSYCISQSXLEFL  95
            +TI S +YC+S+   E L
Sbjct  709  ITIQSTAYCVSKGIAESL  726



>ref|XP_010069617.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW58025.1| hypothetical protein EUGRSUZ_H00753 [Eucalyptus grandis]
Length=746

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG F++L PW SG E K  M +Y+RTAH+F L RD+GSG       +TY L
Sbjct  541  AIIETPALGPGSFASLFPWVSGAEVKNSMVKYSRTAHLFALVRDQGSGVVKEEGVITYRL  600

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ---  323
             + D+ENL+ GL + LRIL AAGA E+G     G  +K + A + + E F+   ++    
Sbjct  601  SQEDKENLKLGLRQALRILIAAGAVEVGTYRSDGQRIKCRGAKQEDIEEFLDSITTPGGL  660

Query  322  -SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S ++H  +  SAHQMGSCRMG +  A  V+  GE+WE +GLFV DGS+LP+A+GVNPM+
Sbjct  661  GSRQEHWTMYCSAHQMGSCRMGANEGAGAVDENGESWEAKGLFVCDGSMLPSAVGVNPMI  720

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YCIS+   E L+
Sbjct  721  TIQSTAYCISKRIAESLR  738



>gb|ACF88407.1| unknown [Zea mays]
Length=466

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 127/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RY+RTAH F L RD+G G       V +   
Sbjct  262  IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPS  321

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D + L+ GL ++LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  322  REDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPM  381

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  382  HSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  441

Query  145  TIXSVSYCISQSXLEFL  95
            TI S+++C+S+   E +
Sbjct  442  TIQSIAFCLSKGIAETM  458



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 127/199 (64%), Gaps = 6/199 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  F+ L PW SG + K R+++YARTAH+  + RD+G GE      + Y +
Sbjct  558  AIIETPLLGPATFTVLCPWESGLDIKDRLAKYARTAHLLTIVRDRGHGEVTREGIINYKM  617

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFE------RFVKEE  332
            D  D+EN++ GL + LRIL AAGA+E+G +   GL +K +  +  E++      R   E+
Sbjct  618  DSVDKENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTASEYQVEEFLDRVSAED  677

Query  331  SSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
               ++ +      SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLPTA+GVNP
Sbjct  678  GPLAMDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNP  737

Query  151  MVTIXSVSYCISQSXLEFL  95
            M+TI S +YCI+    E+L
Sbjct  738  MITIESTAYCIANRIAEYL  756



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 127/199 (64%), Gaps = 6/199 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  F+ L PW SG + K R+++YARTAH+  + RD+G GE      + Y +
Sbjct  558  AIIETPLLGPATFTVLCPWESGLDIKDRLAKYARTAHLLTIVRDRGHGEVTREGIINYKM  617

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFE------RFVKEE  332
            D  D+EN++ GL + LRIL AAGA+E+G +   GL +K +  +  E++      R   E+
Sbjct  618  DSVDKENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTASEYQVEEFLDRVSAED  677

Query  331  SSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
               ++ +      SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLPTA+GVNP
Sbjct  678  GPLAMDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNP  737

Query  151  MVTIXSVSYCISQSXLEFL  95
            M+TI S +YCI+    E+L
Sbjct  738  MITIESTAYCIANRIAEYL  756



>gb|EMS51759.1| Long-chain-alcohol oxidase FAO2 [Triticum urartu]
Length=515

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 126/195 (65%), Gaps = 5/195 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RMSRYARTAH F L RD+GSG       + +   
Sbjct  312  IIETPALGPGAFAAMVPWESGRDMKERMSRYARTAHAFALVRDRGSGFVDCEGRLRFTPS  371

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D   L+ GL  +LRIL AAGA E G +   GL L+ K     + E F+ E + +    
Sbjct  372  RDDARELRNGLRHVLRILVAAGAAEGGTHRSDGLRLRCKGVRDEDLEAFLDEVTIEKGPM  431

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       + +SAHQMGSCRMG  PK S V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  432  HSTADKWAVFSSAHQMGSCRMGSSPKDSAVDGSGESWEAEGLYVCDGSLLPTAVGVNPMI  491

Query  145  TIXSVSYCISQSXLE  101
            TI SV+YC+S+   E
Sbjct  492  TIQSVAYCLSKGIAE  506



>ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japonica Group]
 dbj|BAH94933.1| Os10g0474966 [Oryza sativa Japonica Group]
Length=760

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 126/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG FSA++PW SG++ K RM RYARTAH F L RD+G+G       V +   
Sbjct  562  IIETPALGPGAFSAVVPWESGRDMKERMRRYARTAHAFALVRDRGAGAVDGEGRVRFSPS  621

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D E L+ GL + LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  622  RDDAEELRAGLRRALRILVAAGAAEVGTHRSDGLRLRCKGVRDADVEAFLDEVTIEKGPM  681

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +P      +  SAHQMGSCRMG  P+   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  682  YPGSDKWAIFCSAHQMGSCRMGASPRDGAVDGAGESWEAEGLYVCDGSLLPTAVGVNPMI  741

Query  145  TIXSVSYCISQSXLEFL  95
            TI S++YC+S    + L
Sbjct  742  TIQSIAYCLSNGIADTL  758



>ref|XP_001763007.1| predicted protein [Physcomitrella patens]
 gb|EDQ72212.1| predicted protein [Physcomitrella patens]
Length=775

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSG----EA  524
            NG+   A+++ P+ HPG F++  PW S  +FK RM R++RT  +  + RD  +G    EA
Sbjct  562  NGSFPVALLEVPSTHPGSFASFQPWTSAADFKERMRRFSRTVTLCAVTRDTSNGQVSVEA  621

Query  523  FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF  344
                 + Y L+  DEE +  G+EK LR+L AAGA EIG +   G    VK A+  + E +
Sbjct  622  DGKPKIDYTLNAVDEETILEGIEKGLRVLIAAGATEIGTHQQDGERFCVKGANSRDIEAY  681

Query  343  VKEESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
            +K   S+ ++K+  +  S H MGSC+MG DP+ S V+ +GETWEVEGL+V DGSVLP+A+
Sbjct  682  IKRVRSRGVKKNKIIIGSGHHMGSCKMGSDPRRSAVDGEGETWEVEGLYVSDGSVLPSAI  741

Query  163  GVNPMVTIXSVSYCISQSXLEFLKTH  86
            GVNPMVTI SV+YCI+ S L+ L + 
Sbjct  742  GVNPMVTIQSVAYCIAHSVLQSLDSQ  767



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 128/197 (65%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RY+RTAH F L RD+G+G       V +   
Sbjct  559  IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGAGFVDGEGRVRFTPS  618

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D E L+ GL ++LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  619  REDVEELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEAFLDEVTIEKGPM  678

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L  SAHQMGSCRMG  P+   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  679  HSTADKWALHCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  738

Query  145  TIXSVSYCISQSXLEFL  95
            TI S++YC+S+   E L
Sbjct  739  TIQSIAYCLSKGIAETL  755



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 128/196 (65%), Gaps = 4/196 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TP+L PG FSA +PW SGQ+ K RM++YARTA+IF L RD+GSGE  +   VTY LD
Sbjct  542  IIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAEGRVTYRLD  601

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----SQ  323
            K D+E+L+ GL K LRIL AAGA E+G     G  +K K     + E F+   +     +
Sbjct  602  KEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPR  661

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            S  +   +  +AHQM SCRMG   +   ++  GETWE EGL+V DGSVLP+A+GVNPMVT
Sbjct  662  SRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVT  721

Query  142  IXSVSYCISQSXLEFL  95
            I S SYCI+    E L
Sbjct  722  IQSTSYCIASKIAESL  737



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 128/196 (65%), Gaps = 4/196 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TP+L PG FSA +PW SGQ+ K RM++YARTA+IF L RD+GSGE  +   VTY LD
Sbjct  521  IIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAEGRVTYRLD  580

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----SQ  323
            K D+E+L+ GL K LRIL AAGA E+G     G  +K K     + E F+   +     +
Sbjct  581  KEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPR  640

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            S  +   +  +AHQM SCRMG   +   ++  GETWE EGL+V DGSVLP+A+GVNPMVT
Sbjct  641  SRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVT  700

Query  142  IXSVSYCISQSXLEFL  95
            I S SYCI+    E L
Sbjct  701  IQSTSYCIASKIAESL  716



>gb|EAY78905.1| hypothetical protein OsI_34008 [Oryza sativa Indica Group]
Length=564

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 126/199 (63%), Gaps = 5/199 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RYARTAH   L RD+ +G       V +   
Sbjct  345  IIETPALGPGAFAAVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTVGGEGRVRFTPS  404

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D   L+ GL + LRIL AAGA E+G N   GL L+ K A   + E F+ E S +    
Sbjct  405  RGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPM  464

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            HP      L ASAHQMGSCRMG   K   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  465  HPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMI  524

Query  145  TIXSVSYCISQSXLEFLKT  89
            TI SV+YC+++   E L +
Sbjct  525  TIESVAYCVAKGIAESLAS  543



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 128/196 (65%), Gaps = 4/196 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TP+L PG FSA +PW SGQ+ K RM++YARTA+IF L RD+GSGE  +   VTY LD
Sbjct  542  IIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAEGRVTYRLD  601

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----SQ  323
            K D+E+L+ GL K LRIL AAGA E+G     G  +K K     + E F+   +     +
Sbjct  602  KEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPR  661

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            S  +   +  +AHQM SCRMG   +   ++  GETWE EGL+V DGSVLP+A+GVNPMVT
Sbjct  662  SRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVT  721

Query  142  IXSVSYCISQSXLEFL  95
            I S SYCI+    E L
Sbjct  722  IQSTSYCIASKIAESL  737



>emb|CDX92985.1| BnaA03g37070D [Brassica napus]
Length=721

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE  +   ++Y +
Sbjct  522  AIIETPALGPASFSVLCPWTSGLDMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISYVV  581

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DK D EN+  GL + LRIL AAGAEE+G +   G  L  K       E F+     EE  
Sbjct  582  DKIDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKSIEEFLDSVSAEEGP  641

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +++ ++  + +SAHQMGSCR+GVD     ++  GE+WE + LFV DGSVLP+A+GVNPM+
Sbjct  642  KAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLDGESWEADKLFVCDGSVLPSAVGVNPMI  701

Query  145  TIXSVSYCIS  116
            TI S +YCIS
Sbjct  702  TIMSTAYCIS  711



>ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine 
max]
Length=740

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 132/198 (67%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++TPAL PG  S L+PW SG +FK RM +Y+RT H+  + RD G GE  S   V Y+L
Sbjct  541  AIVETPALGPGALSTLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSEGRVHYEL  600

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE-ESSQSL  317
            D++D+EN++ G+++ LRIL AAGA E+G +   G  ++    +  E ERFV+   +++ L
Sbjct  601  DESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATEGL  660

Query  316  RKHP---XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
              H     + +SAHQMGSCRMG+  K   V+  G +WE EGLFV D S+LPTA+GVNPM+
Sbjct  661  MSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMI  720

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+++    FLK
Sbjct  721  TIQSTAYCVAKRIAAFLK  738



>gb|EEE51131.1| hypothetical protein OsJ_31875 [Oryza sativa Japonica Group]
Length=611

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 123/191 (64%), Gaps = 5/191 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+AL+PW SG++ K RM RYART H F L RD+G+G       V Y   
Sbjct  408  IIETPALGPGAFAALVPWESGRDMKERMRRYARTVHAFALVRDRGAGSVDGEGRVRYAPS  467

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D E L+ GL + LRIL AAGA E+G +   G  L+ K A   + E F+ E + +    
Sbjct  468  RDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLRCKGARDADVEAFLDEVTVEKGPM  527

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       +  SAHQMGSCRMG  P+   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  528  HSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVGVNPMI  587

Query  145  TIXSVSYCISQ  113
            TI S++YC+++
Sbjct  588  TIQSIAYCVAK  598



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 128/197 (65%), Gaps = 4/197 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  F AL PW SG + K RM++YARTAH+  + RD GSG+  +   ++Y+L
Sbjct  544  AIIETPALGPSSFVALCPWVSGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEGRISYNL  603

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
            D  D+ENL+ GL + LRIL AAGA E+G +   G  +K +   + + E F+    + +  
Sbjct  604  DAMDKENLKAGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATAGP  663

Query  313  KHP----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
              P     L  SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP+A+GVNPM+
Sbjct  664  LSPVEDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMI  723

Query  145  TIXSVSYCISQSXLEFL  95
            TI S +YC+S+   E L
Sbjct  724  TIQSTAYCLSKKIAESL  740



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 130/199 (65%), Gaps = 4/199 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE  +   ++Y +
Sbjct  542  AIIETPALGPASFSVLCPWTSGLDMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISYVV  601

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DK D EN+  GL + LRIL AAGAEE+G +   G  L  K       + F+     EE  
Sbjct  602  DKVDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKSIDEFLDSVSAEEGP  661

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +++ ++  + +SAHQMGSCR+GVD     ++  GE+WE + LFV DGSVLP+A+GVNPM+
Sbjct  662  KAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLNGESWEADKLFVCDGSVLPSAVGVNPMI  721

Query  145  TIXSVSYCISQSXLEFLKT  89
            TI S +YCI+   ++ + T
Sbjct  722  TIMSTAYCIATRIVKSMTT  740



>gb|ACR36076.1| unknown [Zea mays]
 tpg|DAA49651.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=544

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 127/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RY+RTAH F L RD+G G       V +   
Sbjct  340  IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPS  399

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D + L+ GL ++LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  400  REDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPM  459

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  460  HSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  519

Query  145  TIXSVSYCISQSXLEFL  95
            TI S+++C+S+   E +
Sbjct  520  TIQSIAFCLSKGIAETM  536



>ref|NP_001064839.2| Os10g0474800 [Oryza sativa Japonica Group]
 dbj|BAF26753.2| Os10g0474800 [Oryza sativa Japonica Group]
Length=614

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 126/200 (63%), Gaps = 5/200 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RYARTAH   L RD+ +G       V +   
Sbjct  395  IIETPALGPGAFAAVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTVGGEGRVRFTPS  454

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D   L+ GL + LRIL AAGA E+G N   GL L+ K A   + E F+ E S +    
Sbjct  455  RGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPM  514

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            HP      L ASAHQMGSCRMG   K   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  515  HPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMI  574

Query  145  TIXSVSYCISQSXLEFLKTH  86
            TI SV+YC+++   E L + 
Sbjct  575  TIESVAYCVAKGIAESLASR  594



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+ PAL PG F+AL PW SG++ K R+  Y RTAH+F + +D GSGE  S   ++Y  
Sbjct  538  AIIEAPALGPGSFAALCPWTSGEDIKNRLLNYDRTAHLFAMVKDVGSGEVRSEGRISYTF  597

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            +  D+E+L+ GL + LRIL AAGA E+G     G  +K    S    E F++     E  
Sbjct  598  NGMDKESLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCTGQSEKALESFLETVTAAEGP  657

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +SL K     +SAHQMGSCRMG++ K S V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  658  KSLVKDFTTYSSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMI  717

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E +K
Sbjct  718  TIQSTAYCLSKKIAEMIK  735



>ref|XP_008664883.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Zea mays]
 tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_936795 [Zea mays]
Length=762

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 126/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +IQTPAL PG +++L+PW SG++ K RM RYARTAH F L RD+G+G       V Y   
Sbjct  561  IIQTPALGPGCWASLVPWESGRDMKERMLRYARTAHAFALVRDRGAGHVDGEGRVRYTPS  620

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D + L+ GL + LRIL AAGA E+G +   GL L+       + E F+K+ + +    
Sbjct  621  REDVDELRNGLRQTLRILVAAGAAEVGTHRSDGLRLRCDGLRDEDLEAFLKQVTVEKGPM  680

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             P      L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  681  VPGHDKWALHCSAHQMGSCRMGSSPKHGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  740

Query  145  TIXSVSYCISQSXLEFL  95
            TI S +YC+S+   E L
Sbjct  741  TIQSTAYCVSKGIAESL  757



>ref|XP_002464494.1| hypothetical protein SORBIDRAFT_01g019460 [Sorghum bicolor]
 gb|EER91492.1| hypothetical protein SORBIDRAFT_01g019460 [Sorghum bicolor]
Length=587

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 126/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RY+RTAH F L RD+G G       V +   
Sbjct  385  IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGYVDGEGRVRFTPS  444

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D E L+ GL + LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  445  REDIEELRNGLRRTLRILVAAGAVEVGTHRSDGLRLRCKGLRDEDLEAFLDEVTIEKGPM  504

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  505  HSRTDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  564

Query  145  TIXSVSYCISQSXLEFL  95
            TI S+++C+S+   E +
Sbjct  565  TIQSIAFCLSKGIAETM  581



>ref|XP_004493801.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cicer arietinum]
Length=738

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 130/197 (66%), Gaps = 4/197 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+ PAL PG FSAL+PW SG + K R+ +YARTA++F L RDKGSGE  +   V+Y LD
Sbjct  540  IIEAPALGPGSFSALIPWTSGLDMKERLVKYARTANLFALVRDKGSGEIKTEGRVSYRLD  599

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----SQ  323
            K D+ENL+ GL + LRIL AAGA E+G     G  +K +     + E F+   +     +
Sbjct  600  KIDKENLRVGLRQSLRILVAAGAVEVGTYRSDGQRIKCRGIKDKDLEEFLDNVAVVGGPR  659

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            S  +   + +SAHQMGSCRMG + +   V+  GE+WE +GLFV DGSVLP+A+GVNPM+T
Sbjct  660  SRGEVWTVFSSAHQMGSCRMGANEEEGAVDENGESWEAKGLFVCDGSVLPSAVGVNPMIT  719

Query  142  IXSVSYCISQSXLEFLK  92
            I S +YCI+    E LK
Sbjct  720  IQSTAYCIASKIAESLK  736



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 129/204 (63%), Gaps = 4/204 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            N     ++I+T  L P  F+ L PW SG++ K +M RY+RTAH+F L RD+G+G      
Sbjct  546  NSNATRSIIETAVLGPASFATLFPWVSGKDMKEKMFRYSRTAHVFALVRDRGAGTIEGEG  605

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
             + Y LD++D+ENL+ GL + LRIL AAGA E+G +   G T+K K     E E F+   
Sbjct  606  RLKYRLDRSDKENLREGLRRALRILVAAGAAEVGTHRSDGQTIKCKGMKEEELEEFLDGI  665

Query  331  SS----QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
             S    +S      L  SAHQMGSCRMG   +   V+ +GE+WE  GLFV DGSV+PTA+
Sbjct  666  DSVGGPRSRSDVWTLHCSAHQMGSCRMGASEEEGGVDERGESWEAGGLFVCDGSVVPTAV  725

Query  163  GVNPMVTIXSVSYCISQSXLEFLK  92
            GVNPM+TI +++YC+S+   E+LK
Sbjct  726  GVNPMITIQAIAYCLSEGIAEYLK  749



>tpg|DAA49654.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=590

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 127/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RY+RTAH F L RD+G G       V +   
Sbjct  386  IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPS  445

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D + L+ GL ++LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  446  REDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPM  505

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  506  HSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  565

Query  145  TIXSVSYCISQSXLEFL  95
            TI S+++C+S+   E +
Sbjct  566  TIQSIAFCLSKGIAETM  582



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 128/197 (65%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +++TPAL PG F+A++PW SG++ K RM RYARTAH F L RD+G+G       + +   
Sbjct  584  IVETPALSPGAFAAMVPWESGRDMKERMRRYARTAHAFALVRDRGAGFVDCEGRLRFTPS  643

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D + L+ GL ++LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  644  RDDTDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGVRDEDLEAFLDEVTIEKGPM  703

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L +SAHQMGSCRMG  P+   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  704  HSTTDKWALFSSAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLPTAVGVNPMI  763

Query  145  TIXSVSYCISQSXLEFL  95
            TI SV+YC+S+   + L
Sbjct  764  TIQSVAYCLSKDIAQAL  780



>ref|XP_006379996.1| hypothetical protein POPTR_0008s18750g, partial [Populus trichocarpa]
 gb|ERP57793.1| hypothetical protein POPTR_0008s18750g, partial [Populus trichocarpa]
Length=388

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++TP L P  FS L PW SG + K RM +Y+RTAH+  + RD GSG+  +   ++Y L
Sbjct  189  AIVETPGLGPSSFSVLCPWVSGHDMKNRMMKYSRTAHLITIIRDSGSGKVTTEGRISYYL  248

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ---  323
            + +D +NL+ GL + LRIL AAGA E+G +   G  +K +     + E F+    +    
Sbjct  249  NASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKIEDLEEFLDTVYATGGA  308

Query  322  -SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             SL +     +SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP+A+GVNPM+
Sbjct  309  LSLEEDWMFYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMI  368

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  369  TIQSTAYCLSKKIAESLR  386



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 125/198 (63%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG F+AL PW SG + K RM RY RT H+F + RD+G+G+      ++Y+L
Sbjct  539  AIIETPALGPGSFAALCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVEGRISYNL  598

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
               D+ENL+ G+ + LRIL AAGA E+G     G  LK K  +  E E F+      E  
Sbjct  599  SAIDKENLRAGVRQGLRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAAEGP  658

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            QS      +  +AHQMGSCRMG   K   V+  GE+WE  GLFV DGSVLPTA+GVNPM+
Sbjct  659  QSFVDKWTITGTAHQMGSCRMGKSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMI  718

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   + L+
Sbjct  719  TIQSTAYCLSKKIADSLE  736



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 125/198 (63%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG F+AL PW SG + K RM RY RT H+F + RD+G+G+      ++Y+L
Sbjct  539  AIIETPALGPGSFAALCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVEGRISYNL  598

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
               D+ENL+ G+ + LRIL AAGA E+G     G  LK K  +  E E F+      E  
Sbjct  599  SAIDKENLRAGVRQGLRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAVEGP  658

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            QS      +  +AHQMGSCRMG   K   V+  GE+WE  GLFV DGSVLPTA+GVNPM+
Sbjct  659  QSFVDKWTITGTAHQMGSCRMGQSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMI  718

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   + L+
Sbjct  719  TIQSTAYCLSKKIADSLE  736



>ref|XP_010512451.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Camelina sativa]
Length=749

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+T +L PG FS L PW SG + K RMSRY+RTA +  + RD+GSGE  +   ++Y +
Sbjct  547  AIIETASLGPGSFSVLFPWTSGLDLKTRMSRYSRTASLITIVRDRGSGEVKTEGRISYVV  606

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFV----KEESS  326
            DKTD+EN++ GL + LRIL AAGAEE+G +   G  LK K       E F+     EE  
Sbjct  607  DKTDKENIKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEKSIEEFLDSVSSEEGP  666

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + + +   +  SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+GVNPM+
Sbjct  667  KGMTEKWNIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVCDASALPSAVGVNPMI  726

Query  145  TIXSVSYCIS  116
            T+ S +YCIS
Sbjct  727  TVMSTAYCIS  736



>ref|XP_009136067.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Brassica rapa]
Length=740

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE  +   ++Y +
Sbjct  541  AIIETPALGPASFSVLCPWISGLDMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISYVV  600

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DK D EN+  GL + LRIL AAGAEE+G +   G  L  K       E F+     EE  
Sbjct  601  DKIDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKLIEEFLDSVSAEEGP  660

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +++ ++  + +SAHQMGSCR+GVD     ++  GE+WE + LFV DGSVLP+A+GVNPM+
Sbjct  661  KAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLDGESWEADKLFVCDGSVLPSAVGVNPMI  720

Query  145  TIXSVSYCIS  116
            TI S +YCIS
Sbjct  721  TIMSTAYCIS  730



>gb|AAL31024.1|AC078948_8 putative alcohol oxidase [Oryza sativa Japonica Group]
Length=756

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 126/200 (63%), Gaps = 5/200 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RYARTAH   L RD+ +G       V +   
Sbjct  537  IIETPALGPGAFAAVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTVGGEGRVRFTPS  596

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D   L+ GL + LRIL AAGA E+G N   GL L+ K A   + E F+ E S +    
Sbjct  597  RGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPM  656

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            HP      L ASAHQMGSCRMG   K   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  657  HPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMI  716

Query  145  TIXSVSYCISQSXLEFLKTH  86
            TI SV+YC+++   E L + 
Sbjct  717  TIESVAYCVAKGIAESLASR  736



>ref|XP_007144044.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
 gb|ESW16038.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
Length=741

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 129/197 (65%), Gaps = 4/197 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++TPAL P + S L+PW SG +FK RM +Y+RT H+  + RDKG G   S   V YDL
Sbjct  542  AIVETPALGPAVLSTLLPWVSGSDFKERMLKYSRTVHLITIIRDKGCGVVRSEGRVHYDL  601

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            D++D+EN++ G+++ LRIL AAGA E+G +   G  ++    +  E ERFV+       S
Sbjct  602  DESDKENIRDGVKQALRILIAAGAVEVGTHRSDGQRIECNGNNEKELERFVESIYATGGS  661

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +   + +SAHQMGSC+MG+  K   V+  G +WE EGLFV D S+LPTA+GVNPM+
Sbjct  662  MSQEEKWSIYSSAHQMGSCKMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMI  721

Query  145  TIXSVSYCISQSXLEFL  95
            TI S +YC+++    FL
Sbjct  722  TIQSTAYCVAKRIAAFL  738



>gb|AAP54248.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=784

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 126/200 (63%), Gaps = 5/200 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RYARTAH   L RD+ +G       V +   
Sbjct  565  IIETPALGPGAFAAVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTVGGEGRVRFTPS  624

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D   L+ GL + LRIL AAGA E+G N   GL L+ K A   + E F+ E S +    
Sbjct  625  RGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSVEKGPM  684

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            HP      L ASAHQMGSCRMG   K   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  685  HPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMI  744

Query  145  TIXSVSYCISQSXLEFLKTH  86
            TI SV+YC+++   E L + 
Sbjct  745  TIESVAYCVAKGIAESLASR  764



>ref|XP_007035186.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 ref|XP_007035187.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06112.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06113.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
Length=657

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L P  ++AL PW SG + K RM  ++RTAH+  + RD+GSG+  +   VTY  
Sbjct  458  AIIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKVHAGGRVTYKF  517

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
            D  D +N+Q GL + LRIL AAGA E+G +   G +++ K  S  E E F++  S     
Sbjct  518  DALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGP  577

Query  313  KHPXLK----ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
              P  K     SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  578  MFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMI  637

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ S +YC+S+   E L+
Sbjct  638  TVQSTAYCLSKRIAESLR  655



>ref|XP_010102592.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
 gb|EXB93709.1| Long-chain-alcohol oxidase FAO1 [Morus notabilis]
Length=742

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 130/201 (65%), Gaps = 12/201 (6%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  ++AL+PW SG + K RM +Y+RTAH+  + RD+GSGE      V+++L
Sbjct  541  AIIETPALGPASYAALVPWTSGLDMKNRMMKYSRTAHLITIIRDRGSGEVKKEGRVSFEL  600

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE-------  335
            D TD+EN+  GL + LRIL AAGA E+G +   G  +K K  ++ E + F+         
Sbjct  601  DDTDKENMTAGLRQALRILVAAGAVEVGTHRSDGQRIKCKGINKNELDEFLDSVYAVGGA  660

Query  334  -ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  158
             E S+    +     SAHQ+GSCRMGV+ K   V+  GE+WE EGLFV D SVLP+A+GV
Sbjct  661  MEMSECWTNY----GSAHQLGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPSAVGV  716

Query  157  NPMVTIXSVSYCISQSXLEFL  95
            NPM+TI S +YC+S+   E L
Sbjct  717  NPMITIQSTAYCLSKKIAESL  737



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  F+AL+PW SG E K RM+RY+RTA +F L RD+GS +      V Y  
Sbjct  555  AIIETPGLGPAAFAALVPWVSGLETKERMTRYSRTAVLFALVRDRGSAKVEREGRVNYRF  614

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
            D++D ENL+ GL + LRIL AAGA E+G +   G  +K K     E E F+    +    
Sbjct  615  DRSDRENLRVGLRRALRILVAAGAVEVGTHRSDGQRIKCKGMKEEELEEFLDGIRTVGGP  674

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +   + ASAHQMGSCRMGV  +   V+ KGE+WE +GLFV DGSVLPTA+G+NP++
Sbjct  675  MSKSELWTMYASAHQMGSCRMGVSEEEGGVDEKGESWEAQGLFVCDGSVLPTAVGINPLI  734

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E LK
Sbjct  735  TIQSTAYCLSKGIAESLK  752



>ref|XP_007132926.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
 gb|ESW04920.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
Length=755

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 125/197 (63%), Gaps = 4/197 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L P  F+AL PW SG +FK RM  Y RTAH+  + RD   G+  S   + Y L
Sbjct  550  AIIETPSLGPACFAALFPWESGLDFKERMLNYPRTAHLITIIRDMACGQVTSEGRIIYKL  609

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            ++ D EN++ G+++ LRIL AAGA E+G +   G  L+    S  + + F+      E +
Sbjct  610  NEIDRENMRAGMQQALRILIAAGAVEVGTHRSDGQRLRCSGVSEDKVQEFLDSVCPMEGA  669

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S      L +SAHQMGSCRMGV+ K   V+  GETWE EGLFV D SVLPTA+GVNPM+
Sbjct  670  LSPGDKWNLYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPTAVGVNPMI  729

Query  145  TIXSVSYCISQSXLEFL  95
            TI S +YCIS   +++L
Sbjct  730  TIQSTAYCISNRIVDYL  746



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 129/198 (65%), Gaps = 5/198 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT-YD  497
            A+I+TPAL P  F+ L+PW SG++ K RM+RY+RTAH+F L RD+GSG       +  Y 
Sbjct  556  AIIETPALGPAAFATLVPWVSGRDMKERMARYSRTAHLFALVRDRGSGTVEGKEGIVRYR  615

Query  496  LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS---  326
             D  D EN++ GL + LRIL AAGA E+G +   G  +K K     + E F+   ++   
Sbjct  616  FDGLDRENMREGLRRALRILVAAGAVEVGTHRSDGQRIKCKGIKEEDLEEFLDGITAVGG  675

Query  325  -QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
             +S  +   +  SAHQMGSCRMGV  +   V+ +GE+WE +GLFV DGSVLPTALG+NPM
Sbjct  676  PRSRSELWTIYGSAHQMGSCRMGVSEEEGGVDERGESWEAQGLFVCDGSVLPTALGINPM  735

Query  148  VTIXSVSYCISQSXLEFL  95
            +TI SV+YC+S+   E L
Sbjct  736  ITIQSVAYCLSKGIAESL  753



>sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Lotus japonicus]
 emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
Length=749

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 129/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L PG F++L PW SG +FK RM  Y RTAH+  + RDK  G+  +   V+Y L
Sbjct  548  AIIETPSLGPGSFASLCPWESGLDFKERMLNYPRTAHLITIIRDKACGQVTTEGRVSYKL  607

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
               D+EN++ GL++ LRIL AAGA E+G +   G  +K  + S  E   F+      E +
Sbjct  608  SAFDKENMKCGLQQALRILKAAGAVEVGTHRSDGQRVKCGEVSENEMAEFIDSVCPMEGA  667

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  ++  +  SAHQMGSCRMG++ K   V+  GE+WE +GLFV D S+LPTA+GVNPM+
Sbjct  668  LSPGENWNIYTSAHQMGSCRMGMNEKEGAVDENGESWEAQGLFVCDASLLPTAVGVNPMI  727

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YCIS   +++LK
Sbjct  728  TIQSTAYCISNRVVDYLK  745



>ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gb|ACN25897.1| unknown [Zea mays]
 tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=675

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 127/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RY+RTAH F L RD+G G       V +   
Sbjct  471  IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPS  530

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D + L+ GL ++LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  531  REDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPM  590

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  591  HSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  650

Query  145  TIXSVSYCISQSXLEFL  95
            TI S+++C+S+   E +
Sbjct  651  TIQSIAFCLSKGIAETM  667



>ref|XP_010488398.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=750

 Score =   189 bits (480),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+T +L PG FS L PW SG + K RM+RY+RTA +  + RD+GSGE  +   ++Y +
Sbjct  548  AIIETASLGPGSFSVLFPWTSGLDMKTRMARYSRTASLITIVRDRGSGEVKTEGRISYVV  607

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFV----KEESS  326
            DKTD+EN++ GL + LRIL AAGAEE+G +   G  LK K       E F+     EE  
Sbjct  608  DKTDKENIKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEKSIEEFLDSVSSEEGP  667

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + + +   +  SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+GVNPM+
Sbjct  668  KGMTEKWNIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVCDASALPSAVGVNPMI  727

Query  145  TIXSVSYCIS  116
            T+ S +YCIS
Sbjct  728  TVMSTAYCIS  737



>ref|XP_008668721.1| PREDICTED: uncharacterized protein LOC100274574 isoform X1 [Zea 
mays]
 gb|ACR36691.1| unknown [Zea mays]
 tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=783

 Score =   189 bits (480),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 127/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F+A++PW SG++ K RM RY+RTAH F L RD+G G       V +   
Sbjct  579  IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPS  638

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D + L+ GL ++LRIL AAGA E+G +   GL L+ K     + E F+ E + +    
Sbjct  639  REDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPM  698

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            H       L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  699  HSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  758

Query  145  TIXSVSYCISQSXLEFL  95
            TI S+++C+S+   E +
Sbjct  759  TIQSIAFCLSKGIAETM  775



>ref|XP_007035183.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035184.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035185.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
Length=750

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L P  ++AL PW SG + K RM  ++RTAH+  + RD+GSG+  +   VTY  
Sbjct  548  AIIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKVHAGGRVTYKF  607

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
            D  D +N+Q GL + LRIL AAGA E+G +   G +++ K  S  E E F++  S     
Sbjct  608  DALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGP  667

Query  313  KHPXLK----ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
              P  K     SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  668  MFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMI  727

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ S +YC+S+   E L+
Sbjct  728  TVQSTAYCLSKRIAESLR  745



>ref|XP_003574052.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Brachypodium 
distachyon]
Length=757

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 127/197 (64%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F++L+PW SG++ K RM RYARTAH F L RD+G+G       V +   
Sbjct  555  IIETPALGPGAFASLVPWESGRDMKERMRRYARTAHAFALVRDRGAGSVDGEGRVHFVPS  614

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS-----  326
            + D E L+ GL + LRI+ AAGA E+G +   GL L+ K     + E F+ + +      
Sbjct  615  RDDNEELRNGLRRALRIMVAAGAAEVGTHRSDGLRLRCKGVRDEDLEAFLDDVAVARGPM  674

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            Q+      L  SAHQMGSCRMG  P+   V+  GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  675  QAGTDTWALLCSAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLPTAVGVNPMI  734

Query  145  TIXSVSYCISQSXLEFL  95
            TI S++YC+S++  E L
Sbjct  735  TIQSLAYCLSKNIAESL  751



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 125/196 (64%), Gaps = 4/196 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG FSAL+PW SG + K RM++YARTA+IF L RD GSG+  +   VTY LD
Sbjct  525  IIETPALGPGSFSALVPWLSGHDMKDRMAKYARTANIFALIRDHGSGKVKAEGRVTYRLD  584

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----SQ  323
            + D+ENL+ GL K LRIL AAGA E+G     G   K +     + E F+         +
Sbjct  585  QVDKENLRIGLRKALRILVAAGAVEVGTYRSDGQRFKCRGVKEEDLEEFLDTVKIVGGPR  644

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            S  +   +  SAHQM SCRMG   +   V+  GE+WE +GL+V DGSVLPTA+GVNPMVT
Sbjct  645  SRNELWTVLTSAHQMTSCRMGATEEEGAVDETGESWEAKGLYVCDGSVLPTAVGVNPMVT  704

Query  142  IXSVSYCISQSXLEFL  95
            I S +YCI+    E L
Sbjct  705  IQSTAYCIASKIAESL  720



>ref|XP_007035188.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
 gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
Length=655

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 125/197 (63%), Gaps = 4/197 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L P  ++AL PW SG + K RM  ++RTAH+  + RD+GSG+  +   VTY  
Sbjct  459  AIIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKVHAGGRVTYKF  518

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
            D  D +N+Q GL + LRIL AAGA E+G +   G +++ K  S  E E F++  S     
Sbjct  519  DALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGP  578

Query  313  KHPXLK----ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
              P  K     SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  579  MFPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMI  638

Query  145  TIXSVSYCISQSXLEFL  95
            T+ S +YC+S+   E L
Sbjct  639  TVQSTAYCLSKRIAESL  655



>gb|AES61079.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=538

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 128/199 (64%), Gaps = 5/199 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L PG FS ++PW SG +FK RM RY+RT H   + +DKG GE  S   + Y+L
Sbjct  338  AIIETPSLGPGAFSTMIPWESGFDFKERMLRYSRTVHFITIIQDKGCGEVKSEGRINYEL  397

Query  493  DKT-DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ES  329
            D+  D+EN++ GL++ LRIL AAGA E+G +   G  +     +  E  +FV+     E 
Sbjct  398  DEEFDKENMKHGLQRALRILIAAGAVEVGTHRSDGQRIVCSGTNEMELNKFVESVYAAEG  457

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
              S ++   + ASAHQMGSCR+G+  K   V+  G+ WE EGLFV D S+ PTA+G+NPM
Sbjct  458  PMSHQETWNMYASAHQMGSCRIGITDKEGTVDENGQNWEAEGLFVCDASLFPTAIGINPM  517

Query  148  VTIXSVSYCISQSXLEFLK  92
            +TI S++YC+++     L+
Sbjct  518  ITIQSIAYCVAKRIALILR  536



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 127/199 (64%), Gaps = 4/199 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L PGLFSAL PW SG   K RM +Y+RTAH+F L RDKGSGE      + Y+L
Sbjct  545  AIIETPSLGPGLFSALCPWTSGANMKERMRKYSRTAHLFTLVRDKGSGEVREEGKIVYNL  604

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
             + D+E+++ GL + LRIL AAGAEE+G +   G  +K +     + E F+ +       
Sbjct  605  SEFDKEHMKIGLRQALRILIAAGAEEVGTHRSDGQRMKCQGTKEEDIEEFLNDIVISGGP  664

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +   L   AH MGSCR+G   +   V+  GE+WE +GLFV DGS++PTA+GVNPM+
Sbjct  665  TSREELWNLYCCAHPMGSCRIGASERDGAVDESGESWEAKGLFVCDGSLMPTAIGVNPMI  724

Query  145  TIXSVSYCISQSXLEFLKT  89
            TI S +YCI++   E L +
Sbjct  725  TIESTAYCIAKKIAESLSS  743



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 126/197 (64%), Gaps = 4/197 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TP L PG  + L+PW SG + K RM +Y+RTAH   + RD GSG   S   V+Y+L 
Sbjct  540  IIETPLLGPGSCAVLVPWVSGLDTKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLS  599

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ----  323
            + D ENL++GL + LRIL AAGA E+G +   G  L+ K   + E E F+   S++    
Sbjct  600  EEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDNVSAEGGLL  659

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            SL ++  +  SAHQMGSC++GV  K   V+  GE+WE EGLFV D SVLPTA+GVNPM+T
Sbjct  660  SLSRNWNVYTSAHQMGSCKIGVSEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMIT  719

Query  142  IXSVSYCISQSXLEFLK  92
            I S +YCIS      L+
Sbjct  720  IQSTAYCISNRIAALLR  736



>dbj|BAJ86655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 124/197 (63%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TPAL PG F++L+PW SG++ K RM RYARTAH F L RD+ +G  +    V Y   
Sbjct  555  IIETPALGPGAFASLVPWESGRDMKERMRRYARTAHAFALVRDRAAGSVYGEGRVHYSPS  614

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
            + D E L+ GL + LRI+ AAGA E+G +   GL L+ K     + E F+ E +      
Sbjct  615  RDDIEELRDGLRRALRIMVAAGAAEVGTHRSDGLRLRCKGVQDKDLEAFLDEVTVPRGPM  674

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             P      L  SAHQMGSCRMG  PK   V+ +GE+WE E L+V DGS+LPTA+GVNPM+
Sbjct  675  QPGTDTWALLCSAHQMGSCRMGSSPKEGAVDGRGESWEAEDLYVCDGSLLPTAVGVNPMI  734

Query  145  TIXSVSYCISQSXLEFL  95
            TI S++YC++    + L
Sbjct  735  TIQSLAYCLAMDIAQSL  751



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 126/203 (62%), Gaps = 4/203 (2%)
 Frame = -2

Query  688  GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTS  509
            G    A+I+TP L P  F+ L PW SG + K RM +YART+H+F + RD+GSGE      
Sbjct  534  GNNTRAIIETPVLGPATFATLFPWVSGSDMKDRMVKYARTSHLFAMVRDQGSGEVKEEGM  593

Query  508  VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES  329
            V Y L + D+ENLQ GL + LRIL AAGA E+G     G  +K K     +FE F+   +
Sbjct  594  VKYRLTQLDKENLQCGLRQALRILVAAGAVEVGTYRSDGQRIKCKGLKEKDFEEFLDTVT  653

Query  328  SQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG  161
            +     +  +H  +  SAHQMGSCRMG + +   V+  GE+WE E LFV DGSVLPTA G
Sbjct  654  AVGGPGTRGEHWTIYCSAHQMGSCRMGANEEEGAVDENGESWEAESLFVCDGSVLPTAAG  713

Query  160  VNPMVTIXSVSYCISQSXLEFLK  92
            VNPM++I S ++CIS   ++ LK
Sbjct  714  VNPMISIESTAFCISTRIVKSLK  736



>ref|XP_003607676.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=606

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 129/199 (65%), Gaps = 5/199 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  F+++ PW SG +FK RM +Y RTAH+  + RDK SG+  +   ++Y L
Sbjct  403  AIIETPLLGPSSFASIYPWESGLDFKQRMLKYPRTAHLITIIRDKASGQVKTEGRISYKL  462

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS-RXEFERFVKE----ES  329
            +  D EN++ GL++ LRIL AAGA E+G +   G  +K  + +   E E F+      E 
Sbjct  463  NSIDRENMRAGLQQGLRILIAAGAVEVGTHRSDGQRIKCNENTGEKEIEEFIDSVYPMEG  522

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            +    ++  L  SAHQMGSCRMGV+ K   V+  GE+WE EGLFV D SVLPTA+GVNPM
Sbjct  523  ALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPM  582

Query  148  VTIXSVSYCISQSXLEFLK  92
            +TI S ++CIS   ++FL+
Sbjct  583  ITIQSTAFCISNRIVDFLR  601



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  F+AL PW SGQ+FK RM  Y RT+H+  + RD   G+  +   ++Y L
Sbjct  550  AIIETPLLGPASFAALCPWESGQDFKERMLNYPRTSHLITIIRDMACGQVTTEGRISYKL  609

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            ++ D+EN++ GL++ LRIL AAGA E+G +   G  LK       E + F+      E +
Sbjct  610  NEVDKENMKAGLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGA  669

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +   + +SAHQMGSCRMGV  K   V+  GETWE EGLFV D SVLP+A+GVNPM+
Sbjct  670  LSPGEKWNIYSSAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMI  729

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ S +YCIS   +++L+
Sbjct  730  TVQSTAYCISNRIVDYLR  747



>gb|KJB10007.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=665

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 123/198 (62%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+IQ PAL P  F+A+ PW SG+E K RM RY R AH+F L RD+GSGE      + Y L
Sbjct  466  AIIQAPALGPASFAAISPWVSGRELKERMVRYPRLAHLFTLIRDQGSGEVMEEGKIKYRL  525

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
             + D+ENL+ GL ++LR+L AAGA E+G +   G  +K K  +    + F+         
Sbjct  526  SEVDKENLKIGLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDNVPVVGGL  585

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  ++  L  +AHQ+GSCRMG   +   V+  G++WE EGLFV D SVLPTA+GVNPM+
Sbjct  586  SSKDEYWTLYLTAHQIGSCRMGATEEEGAVDENGQSWEAEGLFVCDASVLPTAIGVNPMI  645

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S SYCIS    + LK
Sbjct  646  TIQSTSYCISNKIAQLLK  663



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  F+AL PW SGQ+FK RM  Y RT+H+  + RD   G+  +   ++Y L
Sbjct  550  AIIETPLLGPASFAALCPWESGQDFKERMLNYPRTSHLITIIRDMACGQVTTEGRISYKL  609

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            ++ D+EN++ GL++ LRIL AAGA E+G +   G  LK       E + F+      E +
Sbjct  610  NEVDKENMKAGLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGA  669

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +   + +SAHQMGSCRMGV  K   V+  GETWE EGLFV D SVLP+A+GVNPM+
Sbjct  670  LSPGEKWNIYSSAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMI  729

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ S +YCIS   +++L+
Sbjct  730  TVQSTAYCISNRIVDYLR  747



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++TP L P  FS L PW SG + K RM +YARTAH+  + RD GSG+  +   ++Y L
Sbjct  545  AIVETPGLGPSSFSVLCPWVSGHDMKNRMMKYARTAHLITIIRDSGSGKVTTEGRISYKL  604

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ---  323
            D +D +NL+ GL + LRIL AAGA E+G +   G  +K +   + + E F+    +    
Sbjct  605  DASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATGGA  664

Query  322  -SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S+ +     +SAHQMGSCRMG+  K   V+  GE+WE EGLFV D SVLP+A+GVNPM+
Sbjct  665  LSMEEDWMFYSSAHQMGSCRMGIKEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMI  724

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  725  TIQSTAYCLSKKIAESLR  742



>gb|KGN56837.1| hypothetical protein Csa_3G134850 [Cucumis sativus]
Length=669

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 124/197 (63%), Gaps = 4/197 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TP L PG  + L+PW SG + K RM +Y+RTAH   + RD GSG   S   V+Y+L 
Sbjct  472  IIETPLLGPGSCAVLVPWVSGLDIKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLS  531

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ----  323
            + D ENL++GL + LRIL AAGA E+G +   G  L+ K   + E E F+   S++    
Sbjct  532  EEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLL  591

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            SL K   +  SAHQMGSC++GV      ++  GE+WE EGLFV D SVLPTA+GVNPM+T
Sbjct  592  SLSKDWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMIT  651

Query  142  IXSVSYCISQSXLEFLK  92
            I S +YCIS      L+
Sbjct  652  IQSTAYCISNRIAALLR  668



>emb|CDX89850.1| BnaA10g02320D [Brassica napus]
Length=752

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 128/204 (63%), Gaps = 5/204 (2%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            ++ T     ++TPAL PG F+AL+PW SG++ K+R+++YART+HIF + RD+G GE    
Sbjct  544  IDSTTPNITLETPALGPGTFAALIPWVSGKDTKVRLAKYARTSHIFVMVRDEGVGEVKGG  603

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              V Y L K DEENL  GL + LRIL AAGAEE+G     G  LK       + E+F++ 
Sbjct  604  I-VKYKLTKADEENLTTGLRRALRILVAAGAEEVGTYRSDGQRLKCGGVKEEDLEKFLET  662

Query  334  ESSQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  167
              +     S+ +      +AHQMG CRMG   +   V+  GE+WE EGL+V D SVLPTA
Sbjct  663  VDAPAGVVSMSRRWTHSFTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVLPTA  722

Query  166  LGVNPMVTIXSVSYCISQSXLEFL  95
            LGVNPMVTI S +YCIS+   E +
Sbjct  723  LGVNPMVTIQSTAYCISKRLAELM  746



>gb|KGN53996.1| hypothetical protein Csa_4G246910 [Cucumis sativus]
Length=139

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -2

Query  496  LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSL  317
            +D  DE NLQ+GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+E+FVKEESS+ L
Sbjct  1    MDDVDEHNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESSRPL  60

Query  316  RKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIX  137
            +       SAHQMGSCRMG+  K SVVN +GETWEVEGLF+ D SV PTALGVNPMVT+ 
Sbjct  61   KDLLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQ  120

Query  136  SVSYCISQSXLEFLK  92
            +++YC +QS LE LK
Sbjct  121  AIAYCTAQSVLETLK  135



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 128/199 (64%), Gaps = 5/199 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  FSAL PW SG ++K RM  Y RTAH   + RDK  G+  +   ++Y L
Sbjct  551  AIIETPLLGPSSFSALYPWESGLDYKQRMLNYPRTAHFITIIRDKAGGQVTTERRISYKL  610

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKV-KDASRXEFERFVKE----ES  329
            +  D+EN++ G+++ LRIL AAGA E+G +   G  +K  ++ S  E E F+      E 
Sbjct  611  NSIDKENMRAGIQQALRILIAAGAVEVGTHRSGGQRIKCNENTSEKEIEEFIDSVYPMEG  670

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            +    ++  L  SAHQMGSCRMGV+ K   V+  GE+WE EGLFV D SVLPTA+GVNPM
Sbjct  671  ALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPM  730

Query  148  VTIXSVSYCISQSXLEFLK  92
            +TI S ++CIS   ++FL+
Sbjct  731  ITIQSTAFCISNRIVDFLR  749



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=743

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++T AL P  F+ L+PW SG + K R+++YARTAH+F L RDKGSGE  +   + Y L
Sbjct  540  AIVETAALGPASFATLVPWVSGLDMKDRVAKYARTAHLFALVRDKGSGEVRAENKIEYRL  599

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
            D++D+EN+Q GL + +RIL AAGA E+G     G  +  K   + + E F+    +    
Sbjct  600  DRSDKENIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGP  659

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            ++  ++  + ++AHQMGSC+MG   K   V+  GE+WE EGLFV DGS+LPTA+GVNPM+
Sbjct  660  RTRGEYWTMYSTAHQMGSCKMGATEKEGGVDENGESWEAEGLFVCDGSLLPTAIGVNPMI  719

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   + LK
Sbjct  720  TIQSTAYCVSKKIADSLK  737



>gb|KJB10006.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=742

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 123/198 (62%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+IQ PAL P  F+A+ PW SG+E K RM RY R AH+F L RD+GSGE      + Y L
Sbjct  543  AIIQAPALGPASFAAISPWVSGRELKERMVRYPRLAHLFTLIRDQGSGEVMEEGKIKYRL  602

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
             + D+ENL+ GL ++LR+L AAGA E+G +   G  +K K  +    + F+         
Sbjct  603  SEVDKENLKIGLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDNVPVVGGL  662

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  ++  L  +AHQ+GSCRMG   +   V+  G++WE EGLFV D SVLPTA+GVNPM+
Sbjct  663  SSKDEYWTLYLTAHQIGSCRMGATEEEGAVDENGQSWEAEGLFVCDASVLPTAIGVNPMI  722

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S SYCIS    + LK
Sbjct  723  TIQSTSYCISNKIAQLLK  740



>gb|KJB10008.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=749

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 123/198 (62%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+IQ PAL P  F+A+ PW SG+E K RM RY R AH+F L RD+GSGE      + Y L
Sbjct  550  AIIQAPALGPASFAAISPWVSGRELKERMVRYPRLAHLFTLIRDQGSGEVMEEGKIKYRL  609

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
             + D+ENL+ GL ++LR+L AAGA E+G +   G  +K K  +    + F+         
Sbjct  610  SEVDKENLKIGLRQVLRVLIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDNVPVVGGL  669

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  ++  L  +AHQ+GSCRMG   +   V+  G++WE EGLFV D SVLPTA+GVNPM+
Sbjct  670  SSKDEYWTLYLTAHQIGSCRMGATEEEGAVDENGQSWEAEGLFVCDASVLPTAIGVNPMI  729

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S SYCIS    + LK
Sbjct  730  TIQSTSYCISNKIAQLLK  747



>ref|XP_003590828.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=576

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 128/199 (64%), Gaps = 5/199 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L PG FS ++PW SG +FK RM RY+RT H   + +DKG GE  S   + Y+L
Sbjct  376  AIIETPSLGPGAFSTMIPWESGFDFKERMLRYSRTVHFITIIQDKGCGEVKSEGRINYEL  435

Query  493  DKT-DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ES  329
            D+  D+EN++ GL++ LRIL AAGA E+G +   G  +     +  E  +FV+     E 
Sbjct  436  DEEFDKENMKHGLQRALRILIAAGAVEVGTHRSDGQRIVCSGTNEMELNKFVESVYAAEG  495

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
              S ++   + ASAHQMGSCR+G+  K   V+  G+ WE EGLFV D S+ PTA+G+NPM
Sbjct  496  PMSHQETWNMYASAHQMGSCRIGITDKEGTVDENGQNWEAEGLFVCDASLFPTAIGINPM  555

Query  148  VTIXSVSYCISQSXLEFLK  92
            +TI S++YC+++     L+
Sbjct  556  ITIQSIAYCVAKRIALILR  574



>ref|XP_002889487.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65746.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
Length=760

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 127/204 (62%), Gaps = 5/204 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            + T     ++TPA+ PG F+AL PW SG + K R+++YART+HIF + RD+G GE     
Sbjct  553  DSTTPNITLETPAIGPGTFAALAPWVSGPDMKERLAKYARTSHIFVMVRDEGVGEVKGDI  612

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
             V Y L K DEENL  GL++ LRIL AAGA E+G     G  +K     + + E F++  
Sbjct  613  -VKYRLTKADEENLTTGLKQALRILVAAGAAEVGTYRSDGQRMKCSGIKQEDVEAFLQAV  671

Query  331  SSQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
            ++     S+ KH     +AHQMG CRMG   KA  ++ KGE+WE E L+V D SVLPTAL
Sbjct  672  NAPAGVVSMSKHWTQSFTAHQMGCCRMGATEKAGAIDGKGESWEAEDLYVCDASVLPTAL  731

Query  163  GVNPMVTIXSVSYCISQSXLEFLK  92
            GVNPM+T+ S +YCIS    E +K
Sbjct  732  GVNPMITVQSTAYCISNRIAELMK  755



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 123/198 (62%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I++PA+ P  F+A  PW SG+E K RM RY R A +F L RD+GSGE      + Y L
Sbjct  543  AIIESPAMGPASFAASFPWISGRELKDRMLRYGRIAQLFALVRDQGSGEVKVEGKIKYRL  602

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
             K D+ENL+ GL + LRIL AAGAEE+G     G  ++ K     + E F+         
Sbjct  603  SKNDKENLKTGLRQALRILVAAGAEEVGTYRSDGHRIRCKGIKEEDLEEFIGSIEVVGGM  662

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +H  +  SAHQMGSCRMG   +   V+  GE+WE EGLFV DGSVLP+A+G+NPM+
Sbjct  663  ASRGEHWSVYFSAHQMGSCRMGATEEDGAVDENGESWEAEGLFVCDGSVLPSAIGINPMI  722

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S SYCIS+   + LK
Sbjct  723  TIESTSYCISKKIADSLK  740



>ref|XP_006296686.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
 gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
Length=744

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG FS L PW SG + K RM+RY+RTA++  + RD+GSGE  +   ++Y +
Sbjct  542  AIIETPALGPGSFSVLCPWTSGLDMKKRMARYSRTANLITIVRDRGSGEVKTEGRISYVV  601

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD +N++ GL + LRIL AAGAEE+G +   G  L  K       + F+     EE  
Sbjct  602  DKTDRDNIKAGLRQSLRILIAAGAEEVGTHRSDGQRLICKGVDEDSIQEFLDAVSTEEGP  661

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + + +   + +SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+GVNPM+
Sbjct  662  KGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMI  721

Query  145  TIXSVSYCIS  116
            T+ S +YCIS
Sbjct  722  TVMSTAYCIS  731



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cucumis sativus]
Length=738

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 124/197 (63%), Gaps = 4/197 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+TP L PG  + L+PW SG + K RM +Y+RTAH   + RD GSG   S   V+Y+L 
Sbjct  541  IIETPLLGPGSCAVLVPWVSGLDIKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLS  600

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ----  323
            + D ENL++GL + LRIL AAGA E+G +   G  L+ K   + E E F+   S++    
Sbjct  601  EEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLL  660

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            SL K   +  SAHQMGSC++GV      ++  GE+WE EGLFV D SVLPTA+GVNPM+T
Sbjct  661  SLSKDWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMIT  720

Query  142  IXSVSYCISQSXLEFLK  92
            I S +YCIS      L+
Sbjct  721  IQSTAYCISNRIAALLR  737



>ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
Length=743

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG FS L PW SG + K RM+RY+RTA +  + RD+GSGE  +   ++Y +
Sbjct  541  AIIETPALGPGSFSVLCPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEGRISYAV  600

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD +NL+ GL + L+IL AAGAEE+G +   G  L  K +     E F+     EE  
Sbjct  601  DKTDRDNLKAGLRQSLKILIAAGAEEVGTHRSDGQRLICKGSDENSIEEFLDSVSTEEGP  660

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + + +   + +SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+GVNPM+
Sbjct  661  KGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMI  720

Query  145  TIXSVSYCIS  116
            T+ S +YCIS
Sbjct  721  TVMSTAYCIS  730



>gb|AAD10696.1| Unknown protein [Arabidopsis thaliana]
Length=736

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 126/205 (61%), Gaps = 5/205 (2%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            ++ T     ++TPA+ PG F+AL PW SG + K RM++YARTAHIF + RD+G GE    
Sbjct  528  MDSTTPNITLETPAIGPGTFAALTPWVSGSDMKERMAKYARTAHIFAMVRDEGVGEVKGD  587

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              V Y L K DEENL  GL++ LRIL AAGA E+G     G  +K     + + E F+  
Sbjct  588  I-VKYRLTKADEENLTIGLKQALRILVAAGAAEVGTYRSDGQRMKCDGIKQKDLEAFLDT  646

Query  334  ESSQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  167
             ++     S+ KH     +AHQ+G CRMG   K   ++ KGE+WE E L+V D SVLPTA
Sbjct  647  VNAPPGVVSMSKHWTQSFTAHQIGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPTA  706

Query  166  LGVNPMVTIXSVSYCISQSXLEFLK  92
            LGVNPM+T+ S +YCIS    E +K
Sbjct  707  LGVNPMITVQSTAYCISNRIAELMK  731



>ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao]
 gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
Length=740

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 124/201 (62%), Gaps = 4/201 (2%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            T   A+IQTPAL P   +AL PW SG EFK RM RY R AH+F L RD+GSGE      +
Sbjct  537  TNVHAIIQTPALGPASVAALSPWVSGSEFKERMVRYPRLAHLFTLIRDQGSGEVMEEGKI  596

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE--  332
             Y   + D+ENL+ GL ++LRI+ AAGA E+G +   G  +K K  +    + F+ +   
Sbjct  597  RYRFSEMDKENLKIGLRQVLRIIIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDDVPV  656

Query  331  --SSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  158
               + S  ++  +  SAHQMGSCR+G   +   V+  G++WE EGLFV D SVLPTA+G+
Sbjct  657  VGGASSKEEYWTMYVSAHQMGSCRIGATQEEGAVDENGQSWEAEGLFVCDASVLPTAIGI  716

Query  157  NPMVTIXSVSYCISQSXLEFL  95
            NPM+TI S SYCIS    + L
Sbjct  717  NPMLTIQSTSYCISNKIADLL  737



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 123/198 (62%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I++PA+ P  F+A  PW SG+E K RM RY R A +F L RD+GSGE      + Y L
Sbjct  543  AIIESPAMGPASFAASFPWISGRELKDRMLRYGRIAQLFALVRDQGSGEVKVEGKIKYRL  602

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
             K D+ENL+ GL + LRIL AAGAEE+G     G  ++ K     + E F+         
Sbjct  603  SKNDKENLKTGLRQALRILIAAGAEEVGTYRSDGHRIRCKGIKEEDLEEFIGSIEVVGGM  662

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +H  +  SAHQMGSCRMG   +   V+  GE+WE EGLFV DGSVLP+A+G+NPM+
Sbjct  663  ASRGEHWSVYFSAHQMGSCRMGATEEDGAVDENGESWEAEGLFVCDGSVLPSAIGINPMI  722

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S SYCIS+   + LK
Sbjct  723  TIESTSYCISKKIADSLK  740



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 129/199 (65%), Gaps = 5/199 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  F+++ PW SG +FK RM +Y RTAH+  + RDK SG+  +   ++Y L
Sbjct  560  AIIETPLLGPSSFASIYPWESGLDFKQRMLKYPRTAHLITIIRDKASGQVKTEGRISYKL  619

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS-RXEFERFVKE----ES  329
            +  D EN++ GL++ LRIL AAGA E+G +   G  +K  + +   E E F+      E 
Sbjct  620  NSIDRENMRAGLQQGLRILIAAGAVEVGTHRSDGQRIKCNENTGEKEIEEFIDSVYPMEG  679

Query  328  SQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
            +    ++  L  SAHQMGSCRMGV+ K   V+  GE+WE EGLFV D SVLPTA+GVNPM
Sbjct  680  ALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPM  739

Query  148  VTIXSVSYCISQSXLEFLK  92
            +TI S ++CIS   ++FL+
Sbjct  740  ITIQSTAFCISNRIVDFLR  758



>emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]
Length=678

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L PG FS L PW SG + K RM+RY+RTA +  + RD+GSGE  +   + Y +
Sbjct  476  AIIETPQLGPGSFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEGRINYTV  535

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD +NL+ GL + LRIL AAGAEE+G +   G  L  K  +    + F+     EE +
Sbjct  536  DKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKGVNENSIQEFLDSVSTEEGA  595

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + + +   + +SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+GVNPM+
Sbjct  596  KGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMI  655

Query  145  TIXSVSYCIS  116
            T+ S +YCIS
Sbjct  656  TVMSTAYCIS  665



>ref|NP_171895.2| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
 sp|Q9ZWB9.2|FAO1_ARATH RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Arabidopsis thaliana]
 gb|AEE27643.1| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
Length=758

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 126/205 (61%), Gaps = 5/205 (2%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            ++ T     ++TPA+ PG F+AL PW SG + K RM++YARTAHIF + RD+G GE    
Sbjct  550  MDSTTPNITLETPAIGPGTFAALTPWVSGSDMKERMAKYARTAHIFAMVRDEGVGEVKGD  609

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              V Y L K DEENL  GL++ LRIL AAGA E+G     G  +K     + + E F+  
Sbjct  610  I-VKYRLTKADEENLTIGLKQALRILVAAGAAEVGTYRSDGQRMKCDGIKQKDLEAFLDT  668

Query  334  ESSQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  167
             ++     S+ KH     +AHQ+G CRMG   K   ++ KGE+WE E L+V D SVLPTA
Sbjct  669  VNAPPGVVSMSKHWTQSFTAHQIGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPTA  728

Query  166  LGVNPMVTIXSVSYCISQSXLEFLK  92
            LGVNPM+T+ S +YCIS    E +K
Sbjct  729  LGVNPMITVQSTAYCISNRIAELMK  753



>ref|XP_010532671.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=741

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 131/199 (66%), Gaps = 4/199 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P LF+AL PW+SG + K RM++Y+RTA++  + RD+GSGE  +   + Y L
Sbjct  542  ALIETPALGPSLFTALSPWSSGLDMKNRMTKYSRTANLVTIVRDRGSGEIKAEGRIKYAL  601

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD+EN+  GL + LRIL +AGA E+G +   G +LK K       E F+     E+  
Sbjct  602  DKTDKENIVAGLRQSLRILISAGAVEVGTHRSDGQSLKCKGIDEKAIEEFLDTVTAEDGP  661

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +   +  +  QMGSCR+GV+ +   ++P GE+WE E LFV DGSVLP+A+GVNPM+
Sbjct  662  GSFTEKWMVYGTTQQMGSCRIGVNEEEGALDPNGESWEAEKLFVCDGSVLPSAIGVNPMI  721

Query  145  TIXSVSYCISQSXLEFLKT  89
            T+ + +YCIS    + ++T
Sbjct  722  TVMATAYCISTGIAKSIRT  740



>gb|KEH23951.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=567

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 128/197 (65%), Gaps = 4/197 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+ PAL PG FS L+PW SG + K RM++YARTA++F L RD GSGE  S   ++Y LD
Sbjct  369  IIEAPALGPGSFSVLVPWISGLDMKDRMAKYARTANLFALVRDIGSGEVRSEGKISYRLD  428

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----SQ  323
            + D ENL+ GL K LRIL AAGA E+G     G  +K +     E E F+   S     +
Sbjct  429  QMDRENLRIGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLDTVSVVGGPR  488

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            S  +   + +SAHQMGSCRMG + +   V+  GE+WE +GL+V DGSVLP+A+GVNPMVT
Sbjct  489  SRSELWTMFSSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMVT  548

Query  142  IXSVSYCISQSXLEFLK  92
            I S +YCI+    E LK
Sbjct  549  IQSTAYCIASKIAESLK  565



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I++P L PG F+AL+P+ SG E K R+ +Y+RT H+F + +D GSG   S   + Y L
Sbjct  545  AIIESPILGPGSFAALLPFESGIELKNRIIKYSRTCHLFSMIKDNGSGSVLSEGRIDYKL  604

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            D +D+EN++ GL + LRIL AAGA E+G +   G  +K +       E F+K     E  
Sbjct  605  DSSDKENMKIGLVRALRILIAAGAVEVGTHQSDGQRVKCEGGDDEGVEEFLKGVVAPEGP  664

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S+ +      SAHQMGSCRMGVD +   V+  GE+WE EGLFV D SVLP A+GVNPM+
Sbjct  665  KSMVEKWSTYCSAHQMGSCRMGVDERCGAVDTWGESWEAEGLFVCDASVLPGAVGVNPMI  724

Query  145  TIXSVSYCISQSXLEFLK  92
            TI + +YCIS+   E LK
Sbjct  725  TIQATAYCISKKIAEKLK  742



>gb|KJB38384.1| hypothetical protein B456_006G252500 [Gossypium raimondii]
Length=748

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L PG ++AL PW SG +FK RM +++RTAH+  + +D+GSGE      VTY  
Sbjct  549  AIIETPSLGPGQYTALCPWVSGLDFKQRMLKFSRTAHLITIVKDRGSGEVHMGGRVTYKF  608

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQS--  320
            D TD ENL+ GL + LR+L AAGA E+G +   G  LK K  S+ E E F+    S    
Sbjct  609  DATDRENLRAGLRRSLRVLVAAGAVEVGTHRSDGQKLKCKGVSKEELEEFLDTVFSVGGP  668

Query  319  --LRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
                    +  +AHQMGSC+MG + K   V+  GE+WE EGL+V D SVLPTA+GVNPM+
Sbjct  669  LFWGDKWMVHTTAHQMGSCKMGRNEKDGGVDENGESWEAEGLYVCDASVLPTAIGVNPMI  728

Query  145  TIXSVSYCISQ  113
            T+ S +YC+S+
Sbjct  729  TVMSTAYCLSK  739



>ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
Length=747

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 124/201 (62%), Gaps = 7/201 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT------  512
            AV++ PA +PG    + PW SG  FK +M RY+R AH+  + RD+GSG     +      
Sbjct  543  AVLEVPAFYPGGLGVMFPWRSGLSFKEQMLRYSRLAHVVVITRDRGSGTVRPSSSSSSQL  602

Query  511  -SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              VTY +   DE+ L+ G EK +R+L AAGA E+G  H  G +L V+ +     E+F++ 
Sbjct  603  PKVTYTISAEDEKTLKAGAEKAIRVLIAAGAVEVGTQHPDGDSLVVEGSDEKALEKFLRV  662

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
              S+ L       ASAHQMGSCRMG DP +S V+P+GE WE  GLFV D SV PTALGVN
Sbjct  663  IGSKQLTHAAMATASAHQMGSCRMGNDPASSAVDPRGEAWESTGLFVADTSVFPTALGVN  722

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PMVT  SV+ CI++S   FL+
Sbjct  723  PMVTAQSVALCIAKSVHRFLE  743



>ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName: Full=Long-chain 
fatty alcohol oxidase 3 [Arabidopsis thaliana]
 gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
Length=746

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L PG FS L PW SG + K RM+RY+RTA +  + RD+GSGE  +   + Y +
Sbjct  544  AIIETPQLGPGSFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEGRINYTV  603

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD +NL+ GL + LRIL AAGAEE+G +   G  L  K  +    + F+     EE +
Sbjct  604  DKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKGVNENSIQEFLDSVSTEEGA  663

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + + +   + +SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+GVNPM+
Sbjct  664  KGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMI  723

Query  145  TIXSVSYCIS  116
            T+ S +YCIS
Sbjct  724  TVMSTAYCIS  733



>ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
Length=747

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 124/201 (62%), Gaps = 7/201 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT------  512
            AV++ PA +PG    + PW SG  FK +M RY+R AH+  + RD+GSG     +      
Sbjct  543  AVLEVPAFYPGGLGVMFPWRSGLSFKEQMLRYSRLAHVVVITRDQGSGTVRPSSSSSSQL  602

Query  511  -SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              VTY +   DE+ L+ G EK +R+L AAGA E+G  H  G +L V+ +     E+F++ 
Sbjct  603  PKVTYTISAEDEKTLKAGAEKAIRVLIAAGAVEVGTQHPDGDSLVVEGSDEKALEKFLRV  662

Query  334  ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
              S+ L       ASAHQMGSCRMG DP +S V+P+GE WE  GLFV D SV PTALGVN
Sbjct  663  IDSKQLTHAAMATASAHQMGSCRMGNDPASSAVDPRGEAWESTGLFVADTSVFPTALGVN  722

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PMVT  SV+ CI++S   FL+
Sbjct  723  PMVTAQSVALCIAKSVHRFLE  743



>ref|XP_006489751.1| PREDICTED: long-chain-alcohol oxidase FAO3-like, partial [Citrus 
sinensis]
Length=580

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 129/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP   P  FS   PW SG +FK  M +Y+RTAH+  + RD+GSGE      +++ L
Sbjct  379  ALIETPEFSPAKFSVFCPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  438

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            D+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  ++ E E+F+      E  
Sbjct  439  DQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQRLKCEGITKKEVEQFLDTVYAAEGP  498

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S  ++  +  +AHQMGSCRMGV+ K   V+  G++WE EGL+V D SVLP+A+GVNPM+
Sbjct  499  KSPVENWMVYGTAHQMGSCRMGVNEKEGAVDENGQSWEAEGLYVCDASVLPSAVGVNPMI  558

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  559  TIQSTAYCLSKRIAESLR  576



>ref|XP_002454188.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
 gb|EES07164.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
Length=773

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 121/198 (61%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++TPA+       L PW SG + K RM RY RT H+F L RD+GSG       V Y L
Sbjct  567  AILETPAMGLAGAGTLFPWVSGSDLKERMLRYGRTVHLFSLVRDRGSGSVLGERRVAYHL  626

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            D TD EN++ GL + LRILAAAGA EIG +   G     + A+    E F+         
Sbjct  627  DATDAENMREGLRRALRILAAAGAAEIGTHRSDGQRFACRGATEAALEEFLDGVDVVRGP  686

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            QS  +   L  +AHQMGSCRMGV  +   V+ +GE+WEVE L+V DGSVLP+A+GVNPMV
Sbjct  687  QSKAEAWSLCCTAHQMGSCRMGVTARDGAVDARGESWEVESLYVCDGSVLPSAVGVNPMV  746

Query  145  TIXSVSYCISQSXLEFLK  92
            TI SV+YC++    E L+
Sbjct  747  TIQSVAYCLATGIAESLR  764



>gb|EPS58840.1| hypothetical protein M569_15969, partial [Genlisea aurea]
Length=668

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A++++P L PG F+AL PW SG++ K RM RY+RTAH+F + +D+  GE      ++Y L
Sbjct  468  AIVESPILGPGSFAALCPWESGEDMKNRMMRYSRTAHLFSIIKDEAGGEVIREGRISYHL  527

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            ++ D+EN+  GL   LRIL +AGA E+G +   G  LK +  S  E E F+      E  
Sbjct  528  NQIDKENITSGLRTALRILISAGAVEVGTHRSDGQRLKCRGISEKEIEEFLDGVTAPEGP  587

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S+ +   +  SAHQMGSCRMG + +   V+  GE+WE EGLFV D S+LP A+GVNPM+
Sbjct  588  KSMVRDWSVYCSAHQMGSCRMGRNEEEGGVDENGESWEAEGLFVCDSSLLPGAIGVNPMI  647

Query  145  TIXSVSYCISQSXLEFLK  92
            TI + SYCIS +  + LK
Sbjct  648  TIQATSYCISLNIADNLK  665



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 128/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L P  F+AL PW SG +FK RM  Y RT+H+  + RD   G+  +   ++Y L
Sbjct  552  AIIETPSLGPASFAALCPWESGLDFKERMLNYPRTSHLITIIRDMACGQVSTEGRISYKL  611

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            ++ D+EN++ GL++ L+IL AAGA E+G +   G  LK       E + F+      E +
Sbjct  612  NEIDKENMKAGLKQALKILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGA  671

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  ++  + +SAHQMGSCRMGV+ K   V+  GETWE EGLFV D SVLP+A+GVNPM+
Sbjct  672  LSPGEYWNIYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMI  731

Query  145  TIXSVSYCISQSXLEFLK  92
            T+ S +YCIS    ++L+
Sbjct  732  TVQSTAYCISNRIADYLR  749



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+ PA+ P  F++L+PW SGQ+ K RM+RY+RTA +F L RD+GSG       V Y  
Sbjct  558  AIIEAPAMGPASFASLVPWVSGQDSKERMARYSRTALLFALVRDRGSGTVEGEGRVKYRF  617

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
            D  D ENL+ GL + LRIL AAGA E+G +   G  +K K     + E F+   S+    
Sbjct  618  DALDRENLREGLRRALRILVAAGAVEVGTHRSDGQRMKCKGIEEKDLEEFLDGISAVGGP  677

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S R+   L ASAHQ+GSCR+G   +   V+  GE+WE +GLFV D SVLP+A+G+NPM+
Sbjct  678  MSRRELWTLHASAHQIGSCRIGASEEEGGVDESGESWEAQGLFVCDASVLPSAVGINPMI  737

Query  145  TIXSVSYCISQSXLEFLK  92
            TI SV+YC+S+   E LK
Sbjct  738  TIQSVAYCLSKGIAESLK  755



>ref|XP_010532672.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=746

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 128/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPA+ P  F+A+ PW SG + K RM++Y+RTAH+  + RD+ SGE  +   + Y L
Sbjct  544  AIIETPAMGPASFTAICPWISGLDMKKRMTKYSRTAHLITIVRDRRSGEVMAEGRIRYTL  603

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD+EN+  GL + LRIL +AGA E+G +   G  LK K       E F+     E+  
Sbjct  604  DKTDKENIVAGLRQSLRILISAGAVEVGTHRSDGQRLKCKGIDEETIEAFLDTVTAEDGP  663

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +   + ASAHQMGSCR+G + +   ++  GE+WE +GLFV DGS LP+ALGVNPM+
Sbjct  664  GSYAEKWAVYASAHQMGSCRIGENEEKGALDLNGESWEAKGLFVCDGSALPSALGVNPMI  723

Query  145  TIXSVSYCISQSXLEFLK  92
            TI + SYCIS   ++ LK
Sbjct  724  TIMATSYCISTGIVKSLK  741



>ref|XP_006406028.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
 gb|ESQ47481.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
Length=746

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  F+ L PW SG + K RMSRY+RT ++  + RD+GSGE  +   V+Y +
Sbjct  544  AIIETPALGPASFAVLCPWISGLDMKKRMSRYSRTVNLITIVRDRGSGEVKTEGRVSYVV  603

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD+ENL  GL + LRIL  AGAEE+G +   G  L  K       E F+     EE  
Sbjct  604  DKTDKENLNAGLRQSLRILIQAGAEEVGTHRSDGQKLVCKGVDEKSIEEFLDSVNAEEGP  663

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +++ +   + +SAHQMGSC++G D +   ++  GE+WE E LFV DGS LP+A+GVNPM+
Sbjct  664  KAMTEKWSVYSSAHQMGSCKIGEDEEEGAIDLNGESWEAEKLFVCDGSALPSAVGVNPMI  723

Query  145  TIXSVSYCIS  116
            TI + +YCIS
Sbjct  724  TIMATAYCIS  733



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 124/191 (65%), Gaps = 4/191 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L PG ++AL PW SG +FK RM +++RTAH+  + +D+GSGE      VTY  
Sbjct  549  AIIETPSLGPGQYTALCPWVSGLDFKQRMLKFSRTAHLITIVKDRGSGEVHMGGRVTYKF  608

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
            D TD ENL+ GL + LR+L AAGA E+G +   G  LK K  S+ E E F+    S    
Sbjct  609  DATDRENLRAGLRRSLRVLVAAGAVEVGTHRSDGQKLKCKGVSKEELEEFLDTVFSVGGP  668

Query  313  ----KHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
                    +  +AHQMGSC+MG + K   V+  GE+WE EGL+V D SVLPTA+GVNPM+
Sbjct  669  LFGGDKWMVHTTAHQMGSCKMGRNEKDGGVDENGESWEAEGLYVCDASVLPTAIGVNPMI  728

Query  145  TIXSVSYCISQ  113
            T+ S +YC+S+
Sbjct  729  TVMSTAYCLSK  739



>gb|KDP26499.1| hypothetical protein JCGZ_17657 [Jatropha curcas]
Length=659

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 125/197 (63%), Gaps = 3/197 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+IQTPAL P  ++AL PW SGQ+FK +M +Y RTA +F L RD+GSGE  +   + +  
Sbjct  462  AIIQTPALGPSSYAALSPWVSGQDFKDKMVKYPRTAGLFALIRDQGSGEVKAEGRIKHWQ  521

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSL-  317
            ++ D+ENL+ GL + LRIL  AGA E+G     G  +  K     + E F+   +   L 
Sbjct  522  NQFDKENLKIGLRQALRILVGAGAVEVGTYRSDGQKIACKGIQDKDLEDFLDTVTVSGLT  581

Query  316  --RKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
               +H  L  SAHQMGSCRMG   K   V+  GE+WE + LFV DGSVLPTA+GVNPM+T
Sbjct  582  SKEEHWTLLFSAHQMGSCRMGATEKEGAVDENGESWEAKDLFVCDGSVLPTAIGVNPMIT  641

Query  142  IXSVSYCISQSXLEFLK  92
            I S +YCIS+  +E LK
Sbjct  642  IQSTAYCISRKIVESLK  658



>ref|XP_002528823.1| disulfide oxidoreductase, putative [Ricinus communis]
 gb|EEF33557.1| disulfide oxidoreductase, putative [Ricinus communis]
Length=747

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 127/199 (64%), Gaps = 4/199 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP L P  F+AL PW S  +FK R+ +Y+RTA++  + RD+GSGE  S   + Y+ 
Sbjct  546  AIIETPQLGPASFAALCPWESALDFKERLLKYSRTANLITIIRDRGSGEVKSEGRIAYNF  605

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ---  323
            D  D ENL+ GL + LRIL AAGA E+G +   G  LK +  ++ + E F+   S     
Sbjct  606  DALDIENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLKCQGITKKQLEEFLDTVSPPRGP  665

Query  322  -SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  K      SAHQ+GSCRMG+  K   V+  GE+WE EGLFV D SVLP+A+GVNPM+
Sbjct  666  LSPGKDWVAYTSAHQLGSCRMGISEKEGAVDENGESWEAEGLFVCDASVLPSAIGVNPMI  725

Query  145  TIXSVSYCISQSXLEFLKT  89
            TI S +YC+S+   ++L+T
Sbjct  726  TIQSTAYCLSERISKYLRT  744



>ref|XP_010457422.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Camelina sativa]
Length=752

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 127/205 (62%), Gaps = 5/205 (2%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            ++ T     ++TPA+ PG F+AL+PW SG + K R+++Y+RT+HIF + RD+G GE    
Sbjct  544  MDSTTSNITLETPAIGPGTFAALVPWVSGSDIKERLAKYSRTSHIFVMVRDEGVGEVKGG  603

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              V Y L K DEENL  GL++ L+ILAAAGA E+G     G  +K       + E F++ 
Sbjct  604  I-VKYRLTKADEENLTIGLKQALQILAAAGAAEVGTYRSDGQRIKCDGMKHNDLEAFLQT  662

Query  334  ESS----QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  167
              +     S+ KH     +AHQMG CRMG   K   ++ KGE+WE E L+V D SVLPTA
Sbjct  663  VEAPAGVMSMSKHWTHSFTAHQMGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPTA  722

Query  166  LGVNPMVTIXSVSYCISQSXLEFLK  92
            LGVNPM+TI S +YCIS    E +K
Sbjct  723  LGVNPMITIQSTAYCISNRIAELMK  747



>ref|XP_010526493.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=761

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 123/202 (61%), Gaps = 4/202 (2%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +G  AV++TP + P  ++ L+PW S  +FK RM RY RTAH+F L RD GSGE      V
Sbjct  556  SGSRAVLETPLIGPASYAGLVPWVSAADFKERMVRYGRTAHVFALVRDNGSGEVVKEGDV  615

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            TY L + D+E L  GL + LRIL AAGA E+G     G  +K K  ++   E F+    +
Sbjct  616  TYRLSQLDKERLSVGLRQALRILIAAGAVEVGTYRSDGQRMKCKGLTKQAMEEFLDSVDA  675

Query  325  ----QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  158
                ++  +H     SAHQMGSCRMG       V+  GE+WE +GLFV DGSVLP+A+G+
Sbjct  676  VGGVRTRGEHWTTYFSAHQMGSCRMGASAGEGAVDENGESWETQGLFVCDGSVLPSAVGI  735

Query  157  NPMVTIXSVSYCISQSXLEFLK  92
            NPM+TI S SYCIS    E L+
Sbjct  736  NPMITIQSTSYCISTRIAESLQ  757



>gb|KFK42743.1| hypothetical protein AALP_AA1G034000 [Arabis alpina]
Length=682

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 127/206 (62%), Gaps = 5/206 (2%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            ++ T     ++ PA+ PG+F+AL PW SG + K R+++YART+HIF + RD+G G+    
Sbjct  473  IDSTTPNITLEIPAIGPGMFAALTPWVSGSDMKTRLAKYARTSHIFVMVRDEGVGKVRGE  532

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              VTY L K+DEENL  GL++ LRIL AAGA E+G     G  LK       E E F+  
Sbjct  533  I-VTYKLTKSDEENLTIGLKQALRILVAAGATEVGTYRSDGQRLKCDGIKEEELETFLDT  591

Query  334  ESSQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  167
             +      S+ KH     +AHQ+G CRMG   K   ++  GE+WE E L+V D SVLPTA
Sbjct  592  VTVPPGVLSMSKHWTHSFTAHQIGCCRMGATEKEGALDGYGESWEAEDLYVCDASVLPTA  651

Query  166  LGVNPMVTIXSVSYCISQSXLEFLKT  89
            +GVNPM+TI S +YCIS+   E ++T
Sbjct  652  IGVNPMITIQSTAYCISKRIAELMET  677



>ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum]
Length=731

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 124/201 (62%), Gaps = 4/201 (2%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            T   A+I+  A+ P  F++L PW SGQ+ K +M++Y+RT  +  L +D+G GE      +
Sbjct  525  TNAQAIIEATAVGPASFASLFPWTSGQDMKEQMTKYSRTVTLLALVKDQGRGEVKKAGRI  584

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE---  335
             Y LD+ D+EN++ GL + LRIL AAGA E+G     G  +K KD    E E FV     
Sbjct  585  KYSLDRIDKENIKAGLRRALRILIAAGAVEVGTYRSDGQKIKCKDIKNEELEEFVDTVEA  644

Query  334  -ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  158
             E   S  ++  + ASAHQMGSCRMG   +   V+  GE WE +GL+V DGSVLPTA+GV
Sbjct  645  PEGPMSKEENWTVYASAHQMGSCRMGSSKEDGAVDENGECWEAKGLYVCDGSVLPTAVGV  704

Query  157  NPMVTIXSVSYCISQSXLEFL  95
            NPM+TI S +YCI++   E L
Sbjct  705  NPMITIQSTAYCIAKRIAESL  725



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 118/190 (62%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+  AL P  FS+LMPW SG +FK R+ +Y RTA +F L RDK SGE      V Y L
Sbjct  546  AIIEASALGPASFSSLMPWVSGLDFKERLVKYGRTASLFSLVRDKSSGEVKKEGRVRYRL  605

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF----VKEESS  326
            +  D+ENL+ GL + LRIL AAGA E+G     G  L  K     E E F    +    +
Sbjct  606  NNHDKENLKMGLRQCLRILVAAGAVEVGTYRSDGQRLNCKGVKEEEMEEFLDSVIAPGGA  665

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S  +H  +   AHQM SCRMG   +   V+  GETWE +GL+V DGSVLPTALGVNPM+
Sbjct  666  RSRTEHWTMYGCAHQMSSCRMGASKEDGAVDENGETWEAKGLYVCDGSVLPTALGVNPMI  725

Query  145  TIXSVSYCIS  116
            TI SV+YCIS
Sbjct  726  TIESVAYCIS  735



>ref|XP_006306477.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
 gb|EOA39375.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
Length=752

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 5/205 (2%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            ++ T     ++TPA+ PG F++L+PW SG + K R+++Y RT+HIF + RD+G GE    
Sbjct  544  MDSTTPNITLETPAIGPGTFASLIPWVSGSDIKERLAKYTRTSHIFVMVRDEGVGEVKGD  603

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              V Y L K DEENL  GL++ L+IL AAGA E+G     G  +K     R E E F+  
Sbjct  604  I-VKYRLTKADEENLTIGLKQALQILVAAGATEVGTYRSDGQRIKCDGIKREELEAFLHT  662

Query  334  ESSQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  167
             ++     S+ KH     +AHQMG CRMG   K   ++ KGE+WE E L+V D SVLPTA
Sbjct  663  VNAPAGVVSMSKHWTHSFTAHQMGCCRMGASEKEGAIDGKGESWEAEDLYVCDASVLPTA  722

Query  166  LGVNPMVTIXSVSYCISQSXLEFLK  92
            LGVNPM+T+ S +YCIS    E +K
Sbjct  723  LGVNPMITVQSTAYCISNRIAELMK  747



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 125/204 (61%), Gaps = 4/204 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            + T   A+I+TPAL P  F++L PW S  + K RM +YARTAH+F L RDKGSG      
Sbjct  545  DTTNVRAIIETPALGPASFASLSPWISRLDMKDRMEKYARTAHLFALVRDKGSGVVKREG  604

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF----  344
             + Y LD+ D+ENLQ GL + LRIL AAGA E+G     G  +K K     + E F    
Sbjct  605  RIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRNDGQRIKCKGTKHEDLEEFLDTV  664

Query  343  VKEESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
            V      S  +   + +SAHQMGSCRM    +   V+  GE+WE +GLFV DGS+LPTA+
Sbjct  665  VAPAGPSSREELWTIYSSAHQMGSCRMSASEEEGGVDENGESWEAKGLFVCDGSLLPTAI  724

Query  163  GVNPMVTIXSVSYCISQSXLEFLK  92
            GVNPM+TI S +YCIS+   E L+
Sbjct  725  GVNPMITIQSTAYCISKKIAESLE  748



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++TP L P  FS L PW SG + K RM +Y+RTAH+  + RD GSG+  +   ++Y L
Sbjct  545  AIVETPGLGPSSFSVLCPWVSGHDMKNRMMKYSRTAHLITIIRDSGSGKVTTEGRISYYL  604

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ---  323
            + +D +NL+ GL + LRIL AAGA E+G +   G  +K +     + E F+    +    
Sbjct  605  NASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKIEDLEEFLDTVYATGGA  664

Query  322  -SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             SL +     +SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP+A+GVNPM+
Sbjct  665  LSLEEDWMFYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMI  724

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  725  TIQSTAYCLSKKIAESLR  742



>ref|XP_006412937.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54390.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=600

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 124/201 (62%), Gaps = 4/201 (2%)
 Frame = -2

Query  682  GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            G  A+++ P + P  F+ L PW SG + + RM +Y RTAH+F L RD GSGE    + V 
Sbjct  392  GCRAILENPLIGPASFAGLSPWVSGADLEERMMKYGRTAHVFALVRDNGSGEVMKESEVR  451

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y   K D+ENL+ G+ + LR+L AAGA EIG     G  +K +  +R   E F+    + 
Sbjct  452  YRTSKKDKENLRVGIRQALRVLVAAGAVEIGTYRSDGQRMKCEGVTREAVEEFLDRVDAD  511

Query  322  ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
                + R++     SAHQMGSCRMG   +   V+  GE+WE EGLFV DGSVLP+A+GVN
Sbjct  512  GGVSTNREYWTTYFSAHQMGSCRMGHTEEEGAVDENGESWEAEGLFVCDGSVLPSAVGVN  571

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PM+TI S +YCIS+  ++ L+
Sbjct  572  PMITIQSAAYCISKRIVDSLQ  592



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 129/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP   P  FS   PW SG +FK  M +Y+RTAH+  + RD+GSGE      +++ L
Sbjct  543  ALIETPEFSPAKFSVFCPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  602

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            D+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  +  E E+F+      E  
Sbjct  603  DQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGP  662

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S  ++  + A+AHQMGSCRMGV+ K   V+  G++WE EGL+V D SVLP+A+GVNPM+
Sbjct  663  KSPVENWMVYATAHQMGSCRMGVNEKEGGVDENGQSWEAEGLYVCDASVLPSAVGVNPMI  722

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  723  TIQSTAYCLSKRIAESLR  740



>ref|XP_004982883.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=685

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 125/198 (63%), Gaps = 6/198 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +++TPAL PG F++++PW SG++ K RM RYARTAH F L RD+G+G       V Y   
Sbjct  482  IVETPALGPGCFASMVPWESGRDMKDRMRRYARTAHAFALVRDRGAGTVDGEGRVCYSPA  541

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR-XEFERFVKEESSQSLR  314
            + D + L+ GL + LRIL AAGA E+G +   G  L+     R  E + F+ E +  +  
Sbjct  542  RDDVDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDELDAFLDEVTVATGP  601

Query  313  KHP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
              P      L  SAHQMGSCRMG  P+   V+ +GE+WE EGL+V DGS+LPTA+GVNPM
Sbjct  602  MLPGSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPM  661

Query  148  VTIXSVSYCISQSXLEFL  95
            +TI S +YC+S+   E L
Sbjct  662  ITIQSTAYCLSEGIAESL  679



>sp|B5WWZ9.1|FAO2_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO2; AltName: Full=Long-chain 
fatty alcohol oxidase 2 [Lotus japonicus]
 emb|CAP15763.1| long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
Length=750

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 125/200 (63%), Gaps = 4/200 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+ PAL PG FSAL+PW SG + K RM +YARTA++F L RD GSGE  +   ++Y LD
Sbjct  551  IIEAPALGPGSFSALVPWVSGLDVKERMVKYARTANLFALVRDHGSGEVKAEGRISYKLD  610

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF---VKEESSQS  320
            K D E+LQ GL K LRIL AAGA E+G     G  +K +     + E F   V+     S
Sbjct  611  KIDRESLQTGLRKALRILVAAGAVEVGTYRSDGQRIKCRGIKESDLEEFLDSVRVVGGPS  670

Query  319  LRKHP-XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
             R     +  SAHQM SCRM    +   V+  GE+WE +GL+V DGSVLP+A+GVNPM+T
Sbjct  671  SRNEVWTVFTSAHQMTSCRMSATEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMIT  730

Query  142  IXSVSYCISQSXLEFLKTHD  83
            I S +YCI+ +  E LK  +
Sbjct  731  IQSTAYCIASNIAESLKKQN  750



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 128/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP   P  FS L PW SG +FK  M +Y+RTAH+  + RD+GSGE      +++ L
Sbjct  543  ALIETPEFSPAKFSVLWPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  602

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            D+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  +  E E+F+      E  
Sbjct  603  DQLDKENLKAGLRQALRILLAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGP  662

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S  ++  +  +AHQMGSCRMGV+ K   V+  G++WE EGL+V D SV P+A+GVNPM+
Sbjct  663  KSSVENWMVYGTAHQMGSCRMGVNDKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMI  722

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  723  TIQSTAYCLSKRIAESLR  740



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 128/198 (65%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP   P  FS L PW SG +FK  M +Y+RTAH+  + RD+GSGE      +++ L
Sbjct  543  ALIETPEFSPAKFSVLWPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  602

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            D+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  +  E E+F+      E  
Sbjct  603  DQLDKENLKAGLRQALRILLAAGAVEVGTHRSDGQRLKCEGITEKEVEQFLDTVYAAEGP  662

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S  ++  +  +AHQMGSCRMGV+ K   V+  G++WE EGL+V D SV P+A+GVNPM+
Sbjct  663  KSSVENWMVYGTAHQMGSCRMGVNDKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMI  722

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  723  TIQSTAYCLSKRIAESLR  740



>ref|XP_004982882.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=762

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 125/198 (63%), Gaps = 6/198 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +++TPAL PG F++++PW SG++ K RM RYARTAH F L RD+G+G       V Y   
Sbjct  559  IVETPALGPGCFASMVPWESGRDMKDRMRRYARTAHAFALVRDRGAGTVDGEGRVCYSPA  618

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR-XEFERFVKEESSQSLR  314
            + D + L+ GL + LRIL AAGA E+G +   G  L+     R  E + F+ E +  +  
Sbjct  619  RDDVDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDELDAFLDEVTVATGP  678

Query  313  KHP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
              P      L  SAHQMGSCRMG  P+   V+ +GE+WE EGL+V DGS+LPTA+GVNPM
Sbjct  679  MLPGSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPM  738

Query  148  VTIXSVSYCISQSXLEFL  95
            +TI S +YC+S+   E L
Sbjct  739  ITIQSTAYCLSEGIAESL  756



>gb|KEH23950.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=737

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 128/197 (65%), Gaps = 4/197 (2%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            +I+ PAL PG FS L+PW SG + K RM++YARTA++F L RD GSGE  S   ++Y LD
Sbjct  539  IIEAPALGPGSFSVLVPWISGLDMKDRMAKYARTANLFALVRDIGSGEVRSEGKISYRLD  598

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----SQ  323
            + D ENL+ GL K LRIL AAGA E+G     G  +K +     E E F+   S     +
Sbjct  599  QMDRENLRIGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLDTVSVVGGPR  658

Query  322  SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  143
            S  +   + +SAHQMGSCRMG + +   V+  GE+WE +GL+V DGSVLP+A+GVNPMVT
Sbjct  659  SRSELWTMFSSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMVT  718

Query  142  IXSVSYCISQSXLEFLK  92
            I S +YCI+    E LK
Sbjct  719  IQSTAYCIASKIAESLK  735



>ref|XP_009119340.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Brassica rapa]
Length=761

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 125/198 (63%), Gaps = 5/198 (3%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            ++ T     ++TPAL PG F+AL+PW SG++ K R+++Y+RT+HIF + RD+G GE    
Sbjct  551  IDSTTPNITLETPALGPGTFAALIPWVSGKDTKERLAKYSRTSHIFVMVRDEGVGEVKGG  610

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              V Y L K DEENL  GL + LRIL AAGAEE+G     G  LK       + E+F++ 
Sbjct  611  I-VKYKLTKADEENLTTGLRRALRILVAAGAEEVGTYRSDGQRLKCGGVKEEDLEKFLET  669

Query  334  ESSQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  167
              +     S+ +      +AHQMG CRMG   +   V+  GE+WE EGL+V D SVLPTA
Sbjct  670  VDAPAGVVSMSRRWTHSFTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVLPTA  729

Query  166  LGVNPMVTIXSVSYCISQ  113
            LGVNPMVTI S +YCIS+
Sbjct  730  LGVNPMVTIQSTAYCISK  747



>gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 128/204 (63%), Gaps = 4/204 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            N     A+I+TP L P  +  L PW SG + K R+ +Y+RTAH+  + RD+G+G+  +  
Sbjct  535  NDNNLRAIIETPQLGPSAYGVLCPWESGLDIKKRLVKYSRTAHLITIVRDRGAGKVKTEG  594

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE-  335
             ++Y+LD  D ENL+ GL + LRIL AAGA E+G +   G  L+ +  ++ + E F+   
Sbjct  595  RISYNLDPFDMENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLQCQGITKKDLEEFLDTV  654

Query  334  ---ESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
                   S  K   + +SAHQMGSC+MG++ K   V+  GE+WE EGLFV D SVLP+A+
Sbjct  655  FPCRGILSPVKDWMIYSSAHQMGSCKMGINEKEGAVDENGESWEAEGLFVCDASVLPSAV  714

Query  163  GVNPMVTIXSVSYCISQSXLEFLK  92
            GVNPM+TI S +YC+S+   E LK
Sbjct  715  GVNPMITIQSTAYCLSKGIAESLK  738



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 127/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP   P  FS   PW SG +FK  M +Y+RTAH+  + RD+GSGE      +++ L
Sbjct  543  ALIETPEFSPAKFSVFCPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEVKVEGRISHKL  602

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE----ESS  326
            D+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  +  E E+F+      E  
Sbjct  603  DQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQQLKCEGITEKEVEQFLDTVYAAEGP  662

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S  ++  +  +AHQMGSCRMGV+ K   V+  G++WE EGL+V D SV P+A+GVNPM+
Sbjct  663  KSPVENWMVYGTAHQMGSCRMGVNEKEGAVDENGQSWEAEGLYVCDASVFPSAVGVNPMI  722

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S +YC+S+   E L+
Sbjct  723  TIQSTAYCLSKRIAESLR  740



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 125/198 (63%), Gaps = 4/198 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPA+ P  F+ L+PW SG + K RM+RY+RTAH+F L RD+G+G       V Y  
Sbjct  554  AIIETPAVGPAAFATLVPWVSGLDMKERMARYSRTAHLFALVRDRGTGTVEGEGMVRYRF  613

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----S  326
            D  D EN++ GL + LRIL AAGA E+G +   G  ++ K     E E F+   +     
Sbjct  614  DALDRENMREGLRRALRILVAAGAVEVGTHRSDGQRIQCKGIKEAELEEFLDGITMVGGP  673

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            +S  +       AHQMGSCRMGV  +   V+  GE+WE +GLFV DGSVLP+A+G+NPM+
Sbjct  674  RSRNELWTFYCCAHQMGSCRMGVSEEEGGVDETGESWEAQGLFVCDGSVLPSAVGINPMI  733

Query  145  TIXSVSYCISQSXLEFLK  92
            TI S++YC+S+   + L+
Sbjct  734  TIQSIAYCLSKGIAKSLR  751



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 124/200 (62%), Gaps = 9/200 (5%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P   +AL PW SG + K RM RY+RTAH+F + RDKGSGE  S   ++Y+L
Sbjct  546  ALIETPALGPAACAALSPWESGNDIKKRMLRYSRTAHLFVMVRDKGSGEVKSERRISYEL  605

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
             + D EN+  GL + L+IL AAGA E+G     G  ++    +  E E F+    S S  
Sbjct  606  TQEDRENMTAGLRRALKILIAAGAVEVGTYRSDGQRIECIGKNEEEIEEFL---GSVSAT  662

Query  313  KHP------XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  152
            K P       +  +AHQMGSCRM        V+  GE+WE EGLFV DGSVLP+A+GVNP
Sbjct  663  KGPMAACFWAVYCTAHQMGSCRMSKRENEGAVDENGESWEAEGLFVCDGSVLPSAVGVNP  722

Query  151  MVTIXSVSYCISQSXLEFLK  92
            M+TI S +YCI++   E LK
Sbjct  723  MITIQSTAYCIAKKLAESLK  742



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 123/204 (60%), Gaps = 4/204 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            + T   A+I+TPAL P  F+ L PW S  + K RM +YARTAH+F L RDKGSG      
Sbjct  545  DTTNVRAIIETPALGPASFATLSPWISRLDMKDRMEKYARTAHLFALVRDKGSGVVKREG  604

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF----  344
             + Y LD+ D+ENLQ GL + LRIL AAGA E+G     G  +K K     + E F    
Sbjct  605  RIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRNDGQRIKCKGTKHEDLEEFLDSV  664

Query  343  VKEESSQSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
            V      S  +     +SAHQMGSCRM    +   V+  GE+WE +GLFV DGS+LPTA+
Sbjct  665  VAAAGPSSREELWTTYSSAHQMGSCRMSASEEEGGVDENGESWEAKGLFVCDGSLLPTAI  724

Query  163  GVNPMVTIXSVSYCISQSXLEFLK  92
            GVNPM+TI S +YCIS+   E L+
Sbjct  725  GVNPMITIQSTAYCISKKIAESLE  748



>ref|XP_006418179.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
 gb|ESQ36532.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
Length=763

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 122/189 (65%), Gaps = 5/189 (3%)
 Frame = -2

Query  667  IQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLDK  488
            ++TPA+ PG F+AL+PW SG + K R+++YART+HIF + RD+G GE      V Y L K
Sbjct  562  LETPAIGPGTFAALIPWVSGSDMKNRLAKYARTSHIFAMIRDEGVGEV-KGGLVKYRLTK  620

Query  487  TDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEES----SQS  320
             DEENL  GL++ LRIL AAGAEE+G     G  +K K     + E F++  +    + S
Sbjct  621  ADEENLAIGLKQALRILVAAGAEEVGTYRSDGQRIKCKGIKEEDLEAFLRTVNVPAGAVS  680

Query  319  LRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI  140
            + KH     +AHQMG CRMG   K   ++  GE+WE + L+V D SVLPTALGVNPM+TI
Sbjct  681  MSKHWTHSFTAHQMGCCRMGATEKEGAIDGYGESWEAQDLYVCDASVLPTALGVNPMITI  740

Query  139  XSVSYCISQ  113
             S +YCIS 
Sbjct  741  QSTAYCISN  749



>gb|KJB72415.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=654

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 10/201 (5%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L P  +SA+ PW SG + K RM +++RTAH+  + RD+GSG+  +   VTY  
Sbjct  454  AIIETPSLGPAQYSAVCPWVSGLDMKARMLKFSRTAHMITIIRDQGSGKVHAGGRVTYKF  513

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
            ++ D +NL+ GL + LRIL AAGA E+G +   G   + K  S  E E F+    S S+ 
Sbjct  514  EEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRKRCKGISNEELEEFL---DSVSML  570

Query  313  KHP-------XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
              P        +  SAHQMGSCRMG++ +   V+  GE+WE EGLFV D SVLP+A+GVN
Sbjct  571  TSPLCTGENWVVHTSAHQMGSCRMGINEEEGAVDENGESWEAEGLFVCDASVLPSAVGVN  630

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PM+T+ S +YC+S+   E L+
Sbjct  631  PMITVQSTAYCLSKKIAESLR  651



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 130/209 (62%), Gaps = 10/209 (5%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            N     A+I+TP+L P  +SA+ PW SG + K RM +++RTAH+  + RD+GSG+  +  
Sbjct  540  NDNKVQAIIETPSLGPAQYSAVCPWVSGLDMKARMLKFSRTAHMITIIRDQGSGKVHAGG  599

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
             VTY  ++ D +NL+ GL + LRIL AAGA E+G +   G  ++ K  S  E + F+   
Sbjct  600  RVTYKFEEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRIRCKGISNEELDEFL---  656

Query  331  SSQSLRKHP-------XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  173
             S S+   P        +  +AHQMGSCRMG++ K   V+  GE+WE EGLFV D S+LP
Sbjct  657  DSVSMLTSPLCTGENWVVHTTAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASILP  716

Query  172  TALGVNPMVTIXSVSYCISQSXLEFLKTH  86
            +A+GVNPM+T+ S +YC+S+   E L+  
Sbjct  717  SAVGVNPMITVQSTAYCLSKKIAESLRQQ  745



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 121/190 (64%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+T +L PG FS L PW SG + K RM+RY+RTA +  + RD+GSGE  +   + Y +
Sbjct  544  AIIETASLGPGSFSVLFPWTSGLDMKTRMARYSRTASLITIVRDRGSGEVKTEGRIRYVV  603

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFV----KEESS  326
            DKTD+ N+  GL + LRIL AAGAEE+G +   G  LK K       E F+     EE  
Sbjct  604  DKTDKGNIIAGLRQSLRILIAAGAEEVGTHRSDGKILKCKGVDENSIEEFLDSVSSEEGP  663

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
            + + +   +  SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+GVNPM+
Sbjct  664  KGMTEKWNIYCSAHQMGSCRIGENEKEGAIDLNGESWEAERLFVCDASALPSAVGVNPMI  723

Query  145  TIXSVSYCIS  116
            T+ S +YCIS
Sbjct  724  TVMSTAYCIS  733



>gb|KJB72416.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=677

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 10/201 (5%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TP+L P  +SA+ PW SG + K RM +++RTAH+  + RD+GSG+  +   VTY  
Sbjct  477  AIIETPSLGPAQYSAVCPWVSGLDMKARMLKFSRTAHMITIIRDQGSGKVHAGGRVTYKF  536

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLR  314
            ++ D +NL+ GL + LRIL AAGA E+G +   G   + K  S  E E F+    S S+ 
Sbjct  537  EEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRKRCKGISNEELEEFL---DSVSML  593

Query  313  KHP-------XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
              P        +  SAHQMGSCRMG++ +   V+  GE+WE EGLFV D SVLP+A+GVN
Sbjct  594  TSPLCTGENWVVHTSAHQMGSCRMGINEEEGAVDENGESWEAEGLFVCDASVLPSAVGVN  653

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PM+T+ S +YC+S+   E L+
Sbjct  654  PMITVQSTAYCLSKKIAESLR  674



>ref|XP_010475034.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Camelina sativa]
Length=752

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 125/205 (61%), Gaps = 5/205 (2%)
 Frame = -2

Query  694  VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSP  515
            ++ T     ++TPA+ PG F+AL+PW SG + K R+++Y+RT+HIF   RD+G GE    
Sbjct  544  MDSTTANITLETPAIGPGTFAALVPWVSGSDIKERLAKYSRTSHIFVTVRDEGVGEVKGG  603

Query  514  TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKE  335
              V Y L K DEENL  GL++ L+IL AAGA E+G     G  +K       + E F++ 
Sbjct  604  I-VKYRLTKADEENLTIGLKQALQILVAAGAAEVGTYRSDGQRIKCDGIKHKDLEAFLET  662

Query  334  ESSQ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  167
              +     S+ KH     +AHQMG CRMG   K   ++ KGE+WE E L+V D SVLPTA
Sbjct  663  VDAPAGVVSMSKHWTHSITAHQMGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPTA  722

Query  166  LGVNPMVTIXSVSYCISQSXLEFLK  92
            LGVNPM+TI S +YCIS    E +K
Sbjct  723  LGVNPMITIQSTAYCISNRIAELMK  747



>ref|XP_006412936.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54389.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=756

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 124/201 (62%), Gaps = 4/201 (2%)
 Frame = -2

Query  682  GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVT  503
            G  A+++ P + P  F+ L PW SG + + RM +Y RTAH+F L RD GSGE    + V 
Sbjct  548  GCRAILENPLIGPASFAGLSPWVSGADLEERMMKYGRTAHVFALVRDNGSGEVMKESEVR  607

Query  502  YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQ  323
            Y   K D+ENL+ G+ + LR+L AAGA EIG     G  +K +  +R   E F+    + 
Sbjct  608  YRTSKKDKENLRVGIRQALRVLVAAGAVEIGTYRSDGQRMKCEGVTREAVEEFLDRVDAD  667

Query  322  ----SLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  155
                + R++     SAHQMGSCRMG   +   V+  GE+WE EGLFV DGSVLP+A+GVN
Sbjct  668  GGVSTNREYWTTYFSAHQMGSCRMGHTEEEGAVDENGESWEAEGLFVCDGSVLPSAVGVN  727

Query  154  PMVTIXSVSYCISQSXLEFLK  92
            PM+TI S +YCIS+  ++ L+
Sbjct  728  PMITIQSAAYCISKRIVDSLQ  748



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 122/195 (63%), Gaps = 4/195 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+  AL P +F+ L PW SGQ+ K RM++Y+RT ++  LA+D+GSGE      + Y L
Sbjct  526  AIIEATALGPAIFAVLFPWTSGQDMKERMTKYSRTVNLLALAKDQGSGEVKKAGRIAYRL  585

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS----  326
            D+ D+EN++ GL + LRIL AAGA E+G     G  +  K     E E F+    +    
Sbjct  586  DEIDKENIKAGLRRALRILVAAGAVEVGTYQSDGQKISCKGIKNEELEEFLDTVRATGGP  645

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S  +   +  SAHQMGSCRMG + +   V+  GE WE +GL+V DGSVLPTA+GVNPM+
Sbjct  646  NSKGEQWTIYGSAHQMGSCRMGANEEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMI  705

Query  145  TIXSVSYCISQSXLE  101
            TI S +YCI++   E
Sbjct  706  TIQSTAYCIAKRIAE  720



>gb|KJB72414.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=746

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 129/207 (62%), Gaps = 10/207 (5%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            N     A+I+TP+L P  +SA+ PW SG + K RM +++RTAH+  + RD+GSG+  +  
Sbjct  540  NDNKVQAIIETPSLGPAQYSAVCPWVSGLDMKARMLKFSRTAHMITIIRDQGSGKVHAGG  599

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
             VTY  ++ D +NL+ GL + LRIL AAGA E+G +   G   + K  S  E E F+   
Sbjct  600  RVTYKFEEVDRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRKRCKGISNEELEEFL---  656

Query  331  SSQSLRKHP-------XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  173
             S S+   P        +  SAHQMGSCRMG++ +   V+  GE+WE EGLFV D SVLP
Sbjct  657  DSVSMLTSPLCTGENWVVHTSAHQMGSCRMGINEEEGAVDENGESWEAEGLFVCDASVLP  716

Query  172  TALGVNPMVTIXSVSYCISQSXLEFLK  92
            +A+GVNPM+T+ S +YC+S+   E L+
Sbjct  717  SAVGVNPMITVQSTAYCLSKKIAESLR  743



>ref|XP_010548742.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Tarenaya hassleriana]
Length=729

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 123/197 (62%), Gaps = 4/197 (2%)
 Frame = -2

Query  691  NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPT  512
            +G+G  AV++TP + P  ++ L+PW S  +FK RM RY RTAH+F L RD GSGE     
Sbjct  523  SGSGSRAVLETPLIGPASYAGLVPWVSAADFKDRMVRYGRTAHVFALVRDNGSGEVVKEG  582

Query  511  SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEE  332
             V Y L + D+E+L+ GL + LRIL AAGA E+G     G  +K +  +    E F+   
Sbjct  583  DVKYRLSQKDKESLRVGLRQALRILIAAGAAEVGTYRSDGQRMKCEGLTAEAMEEFLDSV  642

Query  331  SS----QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  164
             +    ++  +H     SAHQMGSCRMG       V+  G++WE EGLFV DGSVLP+A+
Sbjct  643  DAVGGVRTRGEHWTTYFSAHQMGSCRMGASAGEGAVDENGQSWEAEGLFVCDGSVLPSAI  702

Query  163  GVNPMVTIXSVSYCISQ  113
            G+NPM+TI S +YCIS+
Sbjct  703  GINPMITIQSTAYCISR  719



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 126/199 (63%), Gaps = 5/199 (3%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL PG FS L PW SG  FK RM RY+R  H   + +DK  GE  S   + Y+L
Sbjct  545  AIIETPALAPGTFSTLFPWESGFGFKERMLRYSRMVHFITIIQDKSCGEVKSEGRIKYEL  604

Query  493  DKT-DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS---  326
            D+  D+EN++ GL++ LRIL AAGA E+G +   G  +    ++  E  +FV+   +   
Sbjct  605  DEEFDKENIKDGLQQALRILIAAGAVEVGTHRSDGQRIACSGSNEKELNKFVESVYATGG  664

Query  325  -QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  149
              S  ++  + ASAHQMGSCR+GV  K   V+  G++WE EGLFV D S+LPTA+GVNPM
Sbjct  665  PMSHGENWSIYASAHQMGSCRVGVTEKEGAVDENGQSWEAEGLFVCDSSLLPTAIGVNPM  724

Query  148  VTIXSVSYCISQSXLEFLK  92
            +TI SV+YCI+      L+
Sbjct  725  ITIQSVAYCIANRIAVILR  743



>ref|XP_010532673.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=770

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 124/190 (65%), Gaps = 4/190 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+I+TPAL P  F+A+ PW SG + K RM +Y+RTAH+  + RD+GSGE  +   V Y +
Sbjct  573  AIIETPALGPSSFAAVCPWISGLDMKNRMIKYSRTAHLLTIVRDRGSGEIKTEGRVKYVV  632

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVK----EESS  326
            DKTD+EN+  GL + LRIL +A A E+G +   G   K K       E F+     E+ +
Sbjct  633  DKTDKENIVAGLRQSLRILISARAVEVGTHRSDGQRFKCKGMDEKAIEEFLDTVTAEDGA  692

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             SL +   +  SAHQMGSCR+G + +   ++P GE+WE EGLFV DGSVLP+A+GVNPM+
Sbjct  693  SSLTEKWAVYGSAHQMGSCRIGENEEEGALDPNGESWEAEGLFVCDGSVLPSAIGVNPMI  752

Query  145  TIXSVSYCIS  116
            TI + SY IS
Sbjct  753  TIMATSYGIS  762



>ref|XP_004982885.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=729

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 122/197 (62%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            ++QTPAL PG  ++L+PW SG++ K RM RYARTAH F L RD+G+G       V Y   
Sbjct  526  IVQTPALGPGSMASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGTVGREGRVRYVPS  585

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
              D E L+ GL + LRIL AAGA E+G +   GL L+ +     + E F+ E +      
Sbjct  586  SEDVEELRNGLRRALRILVAAGAAEVGTHRSDGLRLRCEGLRDEDLEAFLNEVTVAKGPM  645

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             P      L  SAHQMGSCRMG  P+   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  646  IPGSDTWALLCSAHQMGSCRMGSRPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  705

Query  145  TIXSVSYCISQSXLEFL  95
            TI S +Y +S+   E L
Sbjct  706  TIQSTAYYVSKGIAESL  722



>ref|XP_006283182.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
 gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
Length=754

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 125/205 (61%), Gaps = 4/205 (2%)
 Frame = -2

Query  685  TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSV  506
            +G  A+++ P + P  ++ L PW SG + K RM +YARTAH+F L RD GSGE      +
Sbjct  548  SGCKAILENPLIGPASYAGLSPWVSGADLKERMMKYARTAHLFALVRDIGSGEVMKENEI  607

Query  505  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESS  326
            TY   K D ENL+ GL + LR+L AAGA E+G     G  +K +  SR   E F+ E  +
Sbjct  608  TYRTTKKDRENLRAGLRQALRVLIAAGAAEVGTYRSDGQRIKCEGTSREAIEEFLDEVDA  667

Query  325  ----QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  158
                 +  ++     SAHQM SCRMG   +   ++  GE++E EGLFV DGSVLP+A+GV
Sbjct  668  VGGVSTKGEYWTTYFSAHQMSSCRMGATAEEGALDENGESFEAEGLFVCDGSVLPSAVGV  727

Query  157  NPMVTIXSVSYCISQSXLEFLKTHD  83
            NPM+TI S +YCIS   ++ L++ D
Sbjct  728  NPMITIQSTAYCISTRIVDSLQSKD  752



>ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera]
Length=749

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 122/201 (61%), Gaps = 4/201 (2%)
 Frame = -2

Query  673  AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDL  494
            A+++  AL P  F+A+ PW SG + K RM +Y+RTA +F LARDKG+GE      + Y L
Sbjct  545  AIVEPTALGPASFAAIHPWVSGLDMKERMVKYSRTATLFALARDKGAGEVKVERRIKYRL  604

Query  493  DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERF----VKEESS  326
               D+ENL+ GL + LRIL AAGA E+G     G ++K K       E F    V     
Sbjct  605  HPADKENLRVGLRQALRILIAAGAVEVGTYRSDGQSIKCKGVKEEAVEEFLDGVVAGGGP  664

Query  325  QSLRKHPXLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             S   H  L  SAHQMGSCRMG   +   V+  GETWE +GLFV DGSVLP+A+G+NPM+
Sbjct  665  CSRGDHWTLYCSAHQMGSCRMGATEEEGAVDENGETWEAKGLFVCDGSVLPSAVGINPMI  724

Query  145  TIXSVSYCISQSXLEFLKTHD  83
            TI + +YCIS+   E LK  +
Sbjct  725  TIQTTAYCISKRIAESLKKQE  745



>ref|XP_004982884.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=764

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 122/197 (62%), Gaps = 5/197 (3%)
 Frame = -2

Query  670  VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFXLARDKGSGEAFSPTSVTYDLD  491
            ++QTPAL PG  ++L+PW SG++ K RM RYARTAH F L RD+G+G       V Y   
Sbjct  561  IVQTPALGPGSMASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGTVGREGRVRYVPS  620

Query  490  KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRXEFERFVKEESSQSLRK  311
              D E L+ GL + LRIL AAGA E+G +   GL L+ +     + E F+ E +      
Sbjct  621  SEDVEELRNGLRRALRILVAAGAAEVGTHRSDGLRLRCEGLRDEDLEAFLNEVTVAKGPM  680

Query  310  HP-----XLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  146
             P      L  SAHQMGSCRMG  P+   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+
Sbjct  681  IPGSDTWALLCSAHQMGSCRMGSRPRDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI  740

Query  145  TIXSVSYCISQSXLEFL  95
            TI S +Y +S+   E L
Sbjct  741  TIQSTAYYVSKGIAESL  757



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340