BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047O13

Length=582
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590611.1|  PREDICTED: tobamovirus multiplication protei...    254   5e-81   Nicotiana tomentosiformis
ref|XP_009788106.1|  PREDICTED: tobamovirus multiplication protei...    253   2e-80   Nicotiana sylvestris
emb|CDP12960.1|  unnamed protein product                                247   5e-79   Coffea canephora [robusta coffee]
ref|XP_011070225.1|  PREDICTED: tobamovirus multiplication protei...    247   3e-78   Sesamum indicum [beniseed]
ref|XP_004245872.1|  PREDICTED: tobamovirus multiplication protei...    246   1e-77   Solanum lycopersicum
gb|AIX10945.1|  putative tetraspanin family protein                     244   7e-77   Gardenia jasminoides
ref|XP_006358577.1|  PREDICTED: tobamovirus multiplication protei...    242   2e-76   Solanum tuberosum [potatoes]
gb|AFK40219.1|  unknown                                                 236   5e-74   Lotus japonicus
gb|KHG01123.1|  hypothetical protein F383_00667                         234   3e-73   Gossypium arboreum [tree cotton]
ref|XP_002527636.1|  conserved hypothetical protein                     234   3e-73   Ricinus communis
gb|KJB25374.1|  hypothetical protein B456_004G188200                    233   1e-72   Gossypium raimondii
gb|EYU33039.1|  hypothetical protein MIMGU_mgv1a011319mg                233   2e-72   Erythranthe guttata [common monkey flower]
ref|XP_011028243.1|  PREDICTED: tobamovirus multiplication protei...    231   4e-72   Populus euphratica
ref|XP_006385612.1|  GMFP4 family protein                               231   6e-72   Populus trichocarpa [western balsam poplar]
gb|KHG08208.1|  Tetraspanin-33                                          231   8e-72   Gossypium arboreum [tree cotton]
gb|KJB37690.1|  hypothetical protein B456_006G215600                    230   9e-72   Gossypium raimondii
ref|XP_006485406.1|  PREDICTED: tobamovirus multiplication protei...    228   1e-70   Citrus sinensis [apfelsine]
ref|XP_007039575.1|  Tobamovirus multiplication 2A isoform 1            226   4e-70   Theobroma cacao [chocolate]
ref|XP_009385932.1|  PREDICTED: tobamovirus multiplication protei...    226   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN01670.1|  hypothetical protein glysoja_012981                     224   1e-69   Glycine soja [wild soybean]
gb|KJB51696.1|  hypothetical protein B456_008G228700                    222   2e-69   Gossypium raimondii
ref|NP_001240069.1|  uncharacterized protein LOC100793680               224   2e-69   Glycine max [soybeans]
gb|KJB51694.1|  hypothetical protein B456_008G228700                    223   5e-69   Gossypium raimondii
ref|XP_010269960.1|  PREDICTED: tobamovirus multiplication protei...    222   1e-68   Nelumbo nucifera [Indian lotus]
gb|KHN21027.1|  hypothetical protein glysoja_034149                     221   1e-68   Glycine soja [wild soybean]
emb|CBI33948.3|  unnamed protein product                                220   2e-68   Vitis vinifera
ref|XP_009397919.1|  PREDICTED: tobamovirus multiplication protei...    222   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003524459.1|  PREDICTED: tobamovirus multiplication protei...    221   2e-68   
gb|KDP36200.1|  hypothetical protein JCGZ_10291                         221   3e-68   Jatropha curcas
gb|EYU33040.1|  hypothetical protein MIMGU_mgv1a011318mg                222   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_011018623.1|  PREDICTED: tobamovirus multiplication protei...    221   4e-68   Populus euphratica
ref|XP_002279170.2|  PREDICTED: tobamovirus multiplication protei...    221   5e-68   Vitis vinifera
ref|XP_006368443.1|  GMFP4 family protein                               219   3e-67   Populus trichocarpa [western balsam poplar]
gb|KHG29162.1|  Solute carrier family 28 member 3                       216   3e-67   Gossypium arboreum [tree cotton]
gb|KEH31557.1|  tetraspanin family protein                              218   5e-67   Medicago truncatula
ref|XP_004509001.1|  PREDICTED: tetraspanin-20-like isoform X1          218   7e-67   Cicer arietinum [garbanzo]
ref|XP_010104372.1|  hypothetical protein L484_023325                   216   1e-66   
gb|KHG29161.1|  Stk31                                                   216   3e-66   Gossypium arboreum [tree cotton]
gb|AFK47448.1|  unknown                                                 213   6e-66   Medicago truncatula
ref|XP_003611446.1|  GMFP4                                              213   7e-66   
gb|KHN42626.1|  hypothetical protein glysoja_018869                     213   4e-65   Glycine soja [wild soybean]
ref|XP_003517379.1|  PREDICTED: tobamovirus multiplication protei...    213   4e-65   Glycine max [soybeans]
ref|XP_003611447.1|  GMFP4                                              213   5e-65   Medicago truncatula
ref|XP_003611445.1|  GMFP4                                              213   5e-65   
ref|XP_002893721.1|  hypothetical protein ARALYDRAFT_473428             211   2e-64   
gb|EYU17843.1|  hypothetical protein MIMGU_mgv1a0124672mg               209   3e-64   Erythranthe guttata [common monkey flower]
gb|AAF81337.1|AC007767_17  Contains similarity to GMFP4 from Glyc...    209   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564399.1|  tobamovirus multiplication 2A protein                 210   6e-64   Arabidopsis thaliana [mouse-ear cress]
gb|ACU24289.1|  unknown                                                 210   8e-64   Glycine max [soybeans]
ref|XP_010275310.1|  PREDICTED: tobamovirus multiplication protei...    210   1e-63   Nelumbo nucifera [Indian lotus]
gb|EPS67767.1|  hypothetical protein M569_07007                         207   6e-63   Genlisea aurea
ref|XP_004148498.1|  PREDICTED: uncharacterized protein LOC101203030    207   7e-63   Cucumis sativus [cucumbers]
ref|XP_008465936.1|  PREDICTED: tobamovirus multiplication protei...    207   1e-62   Cucumis melo [Oriental melon]
ref|XP_006415200.1|  hypothetical protein EUTSA_v10008423mg             207   1e-62   Eutrema salsugineum [saltwater cress]
ref|XP_009398578.1|  PREDICTED: tobamovirus multiplication protei...    207   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003539155.1|  PREDICTED: tobamovirus multiplication protei...    207   1e-62   Glycine max [soybeans]
ref|XP_007209447.1|  hypothetical protein PRUPE_ppa009704mg             206   2e-62   Prunus persica
ref|XP_010499788.1|  PREDICTED: tobamovirus multiplication protei...    205   6e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009151428.1|  PREDICTED: tobamovirus multiplication protei...    205   8e-62   Brassica rapa
ref|XP_006305495.1|  hypothetical protein CARUB_v10009959mg             204   9e-62   
emb|CDY48874.1|  BnaA05g35820D                                          206   1e-61   Brassica napus [oilseed rape]
ref|XP_006305496.1|  hypothetical protein CARUB_v10009959mg             204   1e-61   Capsella rubella
ref|XP_007156641.1|  hypothetical protein PHAVU_002G005100g             204   2e-61   Phaseolus vulgaris [French bean]
emb|CDY32286.1|  BnaC05g28640D                                          206   3e-61   Brassica napus [oilseed rape]
ref|XP_008238361.1|  PREDICTED: tobamovirus multiplication protei...    203   3e-61   Prunus mume [ume]
ref|XP_010478663.1|  PREDICTED: tobamovirus multiplication protei...    203   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_004511769.1|  PREDICTED: tetraspanin-20-like isoform X1          203   5e-61   Cicer arietinum [garbanzo]
emb|CDX93836.1|  BnaA09g24360D                                          202   6e-61   
ref|XP_010677296.1|  PREDICTED: tobamovirus multiplication protei...    202   6e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010461064.1|  PREDICTED: tobamovirus multiplication protei...    202   6e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009114889.1|  PREDICTED: tobamovirus multiplication protei...    202   8e-61   Brassica rapa
ref|XP_007156640.1|  hypothetical protein PHAVU_002G005000g             202   9e-61   Phaseolus vulgaris [French bean]
ref|XP_010518876.1|  PREDICTED: tobamovirus multiplication protei...    202   1e-60   Tarenaya hassleriana [spider flower]
emb|CDY01278.1|  BnaC05g24540D                                          200   4e-60   
ref|XP_006847670.1|  hypothetical protein AMTR_s00149p00039360          200   7e-60   Amborella trichopoda
ref|XP_010055355.1|  PREDICTED: tobamovirus multiplication protei...    199   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010919853.1|  PREDICTED: tobamovirus multiplication protei...    199   1e-59   Elaeis guineensis
gb|KCW71821.1|  hypothetical protein EUGRSUZ_E00307                     198   1e-59   Eucalyptus grandis [rose gum]
ref|XP_007156638.1|  hypothetical protein PHAVU_002G004900g             198   4e-59   Phaseolus vulgaris [French bean]
ref|XP_009345636.1|  PREDICTED: tobamovirus multiplication protei...    196   3e-58   Pyrus x bretschneideri [bai li]
ref|XP_008784675.1|  PREDICTED: tobamovirus multiplication protei...    195   5e-58   Phoenix dactylifera
ref|XP_010933519.1|  PREDICTED: tobamovirus multiplication protei...    191   3e-56   Elaeis guineensis
ref|XP_006850026.1|  hypothetical protein AMTR_s00022p00189290          189   7e-56   
ref|XP_004983591.1|  PREDICTED: tetraspanin-18-like isoform X1          189   1e-55   
ref|XP_010538377.1|  PREDICTED: tobamovirus multiplication protei...    188   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_008788693.1|  PREDICTED: tobamovirus multiplication protei...    185   4e-55   
ref|NP_001150827.1|  tetraspanin family protein                         187   6e-55   Zea mays [maize]
ref|XP_009371175.1|  PREDICTED: tobamovirus multiplication protei...    186   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_008788690.1|  PREDICTED: tobamovirus multiplication protei...    186   2e-54   Phoenix dactylifera
gb|ACG40574.1|  tetraspanin family protein                              185   3e-54   Zea mays [maize]
ref|XP_010934868.1|  PREDICTED: tobamovirus multiplication protei...    183   2e-53   Elaeis guineensis
ref|XP_009391069.1|  PREDICTED: tobamovirus multiplication protei...    178   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK04010.1|  predicted protein                                      178   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573849.1|  PREDICTED: tobamovirus multiplication protei...    177   5e-51   Brachypodium distachyon [annual false brome]
ref|XP_006659267.1|  PREDICTED: tobamovirus multiplication protei...    177   5e-51   Oryza brachyantha
gb|EMS54049.1|  hypothetical protein TRIUR3_29725                       176   1e-50   Triticum urartu
gb|ABK25767.1|  unknown                                                 172   6e-50   Picea sitchensis
gb|ABK22053.1|  unknown                                                 173   2e-49   Picea sitchensis
gb|KDO40488.1|  hypothetical protein CISIN_1g033708mg                   167   3e-49   Citrus sinensis [apfelsine]
ref|NP_001061444.1|  Os08g0282000                                       172   4e-49   
gb|KCW77897.1|  hypothetical protein EUGRSUZ_D021561                    168   1e-48   Eucalyptus grandis [rose gum]
gb|KCW77895.1|  hypothetical protein EUGRSUZ_D021561                    168   2e-48   Eucalyptus grandis [rose gum]
ref|NP_001146619.1|  hypothetical protein                               169   4e-48   Zea mays [maize]
ref|XP_004300273.1|  PREDICTED: tobamovirus multiplication protei...    169   5e-48   Fragaria vesca subsp. vesca
ref|XP_010053569.1|  PREDICTED: tobamovirus multiplication protei...    169   6e-48   Eucalyptus grandis [rose gum]
ref|XP_004972786.1|  PREDICTED: tetraspanin-20-like isoform X2          167   3e-47   Setaria italica
gb|AAD09513.1|  GMFP4                                                   160   9e-47   Glycine max [soybeans]
ref|XP_002443902.1|  hypothetical protein SORBIDRAFT_07g004040          165   1e-46   Sorghum bicolor [broomcorn]
gb|ACN35034.1|  unknown                                                 164   5e-46   Zea mays [maize]
ref|XP_006659854.1|  PREDICTED: tobamovirus multiplication protei...    160   7e-45   
ref|XP_003573463.1|  PREDICTED: tobamovirus multiplication protei...    160   2e-44   Brachypodium distachyon [annual false brome]
ref|NP_001061041.1|  Os08g0159100                                       159   3e-44   
gb|EEC82932.1|  hypothetical protein OsI_27894                          160   3e-44   Oryza sativa Indica Group [Indian rice]
gb|AGW24511.1|  hypothetical protein                                    152   1e-43   Avicennia marina subsp. marina
dbj|BAD94952.1|  hypothetical protein                                   149   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|ACL54399.1|  unknown                                                 148   1e-41   Zea mays [maize]
gb|KCW71823.1|  hypothetical protein EUGRSUZ_E00307                     149   1e-40   Eucalyptus grandis [rose gum]
ref|XP_008354195.1|  PREDICTED: tobamovirus multiplication protei...    144   4e-40   
ref|XP_008373605.1|  PREDICTED: tobamovirus multiplication protei...    140   6e-39   
ref|XP_004972785.1|  PREDICTED: tetraspanin-20-like isoform X1          137   2e-35   
ref|XP_002972323.1|  hypothetical protein SELMODRAFT_172827             136   3e-35   
ref|XP_010934869.1|  PREDICTED: tobamovirus multiplication protei...    130   2e-33   
gb|EMT27731.1|  hypothetical protein F775_29713                         130   4e-33   
ref|XP_001775831.1|  predicted protein                                  127   8e-32   
gb|EAZ06370.1|  hypothetical protein OsI_28599                          120   7e-31   Oryza sativa Indica Group [Indian rice]
gb|AFW87792.1|  hypothetical protein ZEAMMB73_665682                    116   2e-29   
ref|XP_001762411.1|  predicted protein                                  119   1e-28   
gb|EMS68191.1|  hypothetical protein TRIUR3_27411                       106   4e-25   Triticum urartu
gb|ADE76479.1|  unknown                                                 105   2e-23   Picea sitchensis
ref|XP_004966578.1|  PREDICTED: tetraspanin-18-like                   99.4    9e-22   Setaria italica
ref|XP_002437655.1|  hypothetical protein SORBIDRAFT_10g031310        99.0    1e-21   Sorghum bicolor [broomcorn]
ref|XP_006854320.1|  hypothetical protein AMTR_s00039p00118150        99.4    2e-21   Amborella trichopoda
ref|XP_009388438.1|  PREDICTED: tetraspanin-20-like                   95.5    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD62494.1|  unknown protein                                      91.3    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058664.1|  Os06g0731400                                     90.9    1e-18   
ref|XP_010936082.1|  PREDICTED: tetraspanin-20-like                   90.9    1e-18   Elaeis guineensis
gb|EEC81360.1|  hypothetical protein OsI_24555                        90.9    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_003563209.1|  PREDICTED: tetraspanin-18-like isoform X1        88.6    6e-18   Brachypodium distachyon [annual false brome]
gb|ACJ84998.1|  unknown                                               88.2    1e-17   Medicago truncatula
gb|KEH42419.1|  tetraspanin family protein                            88.2    1e-17   Medicago truncatula
ref|XP_008235542.1|  PREDICTED: tetraspanin-18-like                   88.2    2e-17   Prunus mume [ume]
ref|XP_002984277.1|  hypothetical protein SELMODRAFT_229009           86.3    5e-17   Selaginella moellendorffii
gb|AFK47805.1|  unknown                                               86.3    5e-17   Medicago truncatula
ref|XP_008789493.1|  PREDICTED: tetraspanin-18 isoform X1             85.5    6e-17   Phoenix dactylifera
ref|XP_002972445.1|  hypothetical protein SELMODRAFT_228108           85.5    1e-16   Selaginella moellendorffii
emb|CDM86191.1|  unnamed protein product                              85.1    1e-16   Triticum aestivum [Canadian hard winter wheat]
gb|KJB26070.1|  hypothetical protein B456_004G223400                  84.0    4e-16   Gossypium raimondii
ref|XP_002517938.1|  conserved hypothetical protein                   82.0    1e-15   Ricinus communis
ref|XP_010652447.1|  PREDICTED: tetraspanin-18-like                   82.0    1e-15   Vitis vinifera
ref|XP_010038335.1|  PREDICTED: tetraspanin-20                        82.0    2e-15   Eucalyptus grandis [rose gum]
ref|XP_008372422.1|  PREDICTED: tetraspanin-18-like                   82.0    2e-15   Malus domestica [apple tree]
ref|XP_001763914.1|  predicted protein                                81.6    2e-15   
gb|KDP26433.1|  hypothetical protein JCGZ_17591                       81.3    3e-15   Jatropha curcas
ref|XP_007050068.1|  Tetraspanin family protein, putative             81.3    3e-15   Theobroma cacao [chocolate]
gb|EYU17845.1|  hypothetical protein MIMGU_mgv1a0219312mg             80.5    3e-15   Erythranthe guttata [common monkey flower]
ref|XP_008382665.1|  PREDICTED: tetraspanin-18-like                   79.7    1e-14   
ref|XP_008342921.1|  PREDICTED: tetraspanin-19-like isoform X2        77.8    1e-14   
ref|XP_008342920.1|  PREDICTED: tetraspanin-19-like isoform X1        78.2    1e-14   
ref|XP_010933200.1|  PREDICTED: tetraspanin-18-like                   79.0    2e-14   
ref|XP_008229174.1|  PREDICTED: tetraspanin-19                        78.6    2e-14   Prunus mume [ume]
ref|XP_006656530.1|  PREDICTED: tetraspanin-18-like                   79.0    2e-14   Oryza brachyantha
ref|XP_009371022.1|  PREDICTED: tetraspanin-18-like                   78.6    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_009342640.1|  PREDICTED: tetraspanin-19                        77.4    5e-14   Pyrus x bretschneideri [bai li]
ref|XP_007217759.1|  hypothetical protein PRUPE_ppa011228mg           77.0    6e-14   Prunus persica
ref|XP_009591228.1|  PREDICTED: tetraspanin-19                        77.0    6e-14   Nicotiana tomentosiformis
ref|XP_011080147.1|  PREDICTED: tetraspanin-18                        77.4    7e-14   Sesamum indicum [beniseed]
ref|XP_009775665.1|  PREDICTED: tetraspanin-19                        76.6    8e-14   Nicotiana sylvestris
ref|XP_004495030.1|  PREDICTED: tetraspanin-20-like                   76.3    1e-13   Cicer arietinum [garbanzo]
dbj|BAK01647.1|  predicted protein                                    75.9    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008789494.1|  PREDICTED: tetraspanin-18 isoform X2             75.5    2e-13   Phoenix dactylifera
ref|XP_005644373.1|  hypothetical protein COCSUDRAFT_44255            74.3    7e-13   Coccomyxa subellipsoidea C-169
gb|KDP20951.1|  hypothetical protein JCGZ_21422                       73.9    7e-13   Jatropha curcas
ref|XP_011083093.1|  PREDICTED: tetraspanin-18                        74.3    7e-13   Sesamum indicum [beniseed]
ref|XP_009407845.1|  PREDICTED: tetraspanin-18-like                   73.6    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009592671.1|  PREDICTED: tetraspanin-20-like                   73.2    1e-12   Nicotiana tomentosiformis
gb|KHG04274.1|  hypothetical protein F383_07750                       73.2    2e-12   Gossypium arboreum [tree cotton]
ref|XP_010051830.1|  PREDICTED: tetraspanin-19                        72.4    2e-12   Eucalyptus grandis [rose gum]
gb|KCW89519.1|  hypothetical protein EUGRSUZ_A01807                   72.4    2e-12   Eucalyptus grandis [rose gum]
ref|XP_002263228.1|  PREDICTED: tetraspanin-19                        72.4    2e-12   Vitis vinifera
ref|XP_008796410.1|  PREDICTED: tetraspanin-18-like isoform X1        71.6    5e-12   Phoenix dactylifera
ref|XP_008448284.1|  PREDICTED: tetraspanin-19                        71.2    5e-12   Cucumis melo [Oriental melon]
ref|XP_007201868.1|  hypothetical protein PRUPE_ppa009611mg           71.6    7e-12   Prunus persica
gb|KGN46747.1|  hypothetical protein Csa_6G128570                     70.9    7e-12   Cucumis sativus [cucumbers]
ref|XP_006350290.1|  PREDICTED: tetraspanin-20-like isoform X1        70.9    1e-11   Solanum tuberosum [potatoes]
gb|KFK40448.1|  hypothetical protein AALP_AA3G374400                  70.1    2e-11   Arabis alpina [alpine rockcress]
ref|XP_006357492.1|  PREDICTED: tetraspanin-19-like                   70.1    2e-11   Solanum tuberosum [potatoes]
ref|XP_004247113.1|  PREDICTED: tetraspanin-20                        70.1    2e-11   Solanum lycopersicum
gb|KJB22617.1|  hypothetical protein B456_004G057900                  70.5    2e-11   Gossypium raimondii
ref|XP_006443683.1|  hypothetical protein CICLE_v10021447mg           70.5    2e-11   Citrus clementina [clementine]
gb|KDO65807.1|  hypothetical protein CISIN_1g022738mg                 70.5    2e-11   Citrus sinensis [apfelsine]
ref|XP_004290026.1|  PREDICTED: tetraspanin-18-like                   70.1    2e-11   Fragaria vesca subsp. vesca
ref|XP_007144435.1|  hypothetical protein PHAVU_007G155900g           69.7    3e-11   Phaseolus vulgaris [French bean]
gb|EMS62359.1|  hypothetical protein TRIUR3_10377                     69.3    3e-11   Triticum urartu
gb|EMT02071.1|  hypothetical protein F775_29035                       68.9    4e-11   
ref|XP_010540868.1|  PREDICTED: tetraspanin-19                        68.6    5e-11   Tarenaya hassleriana [spider flower]
ref|XP_006408938.1|  hypothetical protein EUTSA_v10002082mg           68.6    6e-11   Eutrema salsugineum [saltwater cress]
ref|XP_001762323.1|  predicted protein                                66.6    9e-11   
ref|XP_004243344.1|  PREDICTED: tetraspanin-19                        67.8    9e-11   Solanum lycopersicum
ref|XP_009765194.1|  PREDICTED: tetraspanin-20-like                   67.8    1e-10   Nicotiana sylvestris
ref|XP_002519044.1|  conserved hypothetical protein                   67.4    1e-10   
ref|XP_008381481.1|  PREDICTED: tetraspanin-19-like                   67.4    1e-10   
ref|XP_008381480.1|  PREDICTED: tetraspanin-19-like                   67.4    1e-10   
ref|XP_010239204.1|  PREDICTED: tetraspanin-18-like isoform X2        67.4    1e-10   Brachypodium distachyon [annual false brome]
gb|EMT30864.1|  hypothetical protein F775_03218                       66.2    1e-10   
gb|KDO48162.1|  hypothetical protein CISIN_1g032113mg                 66.2    1e-10   Citrus sinensis [apfelsine]
gb|EMS53896.1|  hypothetical protein TRIUR3_15619                     66.6    1e-10   Triticum urartu
gb|KDO48163.1|  hypothetical protein CISIN_1g032113mg                 65.9    2e-10   Citrus sinensis [apfelsine]
emb|CDY31986.1|  BnaA07g00090D                                        67.4    2e-10   Brassica napus [oilseed rape]
gb|ADE77737.1|  unknown                                               66.6    2e-10   Picea sitchensis
gb|KDO36449.1|  hypothetical protein CISIN_1g035193mg                 63.9    3e-10   Citrus sinensis [apfelsine]
gb|KDP24147.1|  hypothetical protein JCGZ_25804                       66.2    3e-10   Jatropha curcas
ref|XP_010488999.1|  PREDICTED: tetraspanin-19-like                   66.2    3e-10   
ref|XP_006298516.1|  hypothetical protein CARUB_v10014594mg           65.9    4e-10   
ref|XP_011085968.1|  PREDICTED: tetraspanin-19                        65.9    4e-10   Sesamum indicum [beniseed]
ref|XP_008796411.1|  PREDICTED: tetraspanin-18-like isoform X2        65.9    4e-10   Phoenix dactylifera
ref|XP_002884219.1|  hypothetical protein ARALYDRAFT_480909           65.9    5e-10   
ref|XP_009101995.1|  PREDICTED: tetraspanin-19                        65.5    5e-10   
gb|EYU26161.1|  hypothetical protein MIMGU_mgv1a013675mg              65.5    5e-10   Erythranthe guttata [common monkey flower]
ref|XP_006409011.1|  hypothetical protein EUTSA_v10002095mg           65.5    5e-10   
ref|XP_006447344.1|  hypothetical protein CICLE_v10018057mg           64.7    6e-10   
ref|XP_001775784.1|  predicted protein                                64.7    6e-10   
emb|CDY65849.1|  BnaCnng48870D                                        65.9    7e-10   Brassica napus [oilseed rape]
ref|NP_001144543.1|  uncharacterized protein LOC100277543             65.1    8e-10   
gb|KDO48165.1|  hypothetical protein CISIN_1g032113mg                 63.5    9e-10   Citrus sinensis [apfelsine]
gb|KDO48167.1|  hypothetical protein CISIN_1g032113mg                 63.5    9e-10   Citrus sinensis [apfelsine]
gb|AAD20921.1|  hypothetical protein                                  63.2    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935654.1|  PREDICTED: tetraspanin-19-like                   64.3    1e-09   Elaeis guineensis
gb|KHG12596.1|  Diacylglycerol kinase eta                             65.5    1e-09   Gossypium arboreum [tree cotton]
ref|NP_973494.1|  tetraspanin family protein                          63.2    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006377340.1|  hypothetical protein POPTR_0011s05050g           64.3    1e-09   
ref|NP_973493.1|  tetraspanin family protein                          63.9    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802328.1|  PREDICTED: tetraspanin-19-like                   64.3    1e-09   Phoenix dactylifera
ref|XP_006594069.1|  PREDICTED: tetraspanin-18-like isoform X2        64.3    2e-09   Glycine max [soybeans]
ref|XP_010495917.1|  PREDICTED: tetraspanin-18-like                   65.1    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006350291.1|  PREDICTED: tetraspanin-20-like isoform X2        64.3    2e-09   
ref|XP_010240620.1|  PREDICTED: tetraspanin-19                        63.9    2e-09   
ref|XP_010489078.1|  PREDICTED: tetraspanin-18-like                   64.7    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006412912.1|  hypothetical protein EUTSA_v10025947mg           64.7    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_008352453.1|  PREDICTED: tobamovirus multiplication protei...  63.5    2e-09   
ref|XP_010467772.1|  PREDICTED: tetraspanin-19-like                   62.4    2e-09   
ref|XP_010684825.1|  PREDICTED: tetraspanin-20                        65.1    3e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010416099.1|  PREDICTED: tetraspanin-18                        64.3    3e-09   Camelina sativa [gold-of-pleasure]
gb|KHN05904.1|  hypothetical protein glysoja_026492                   63.9    3e-09   Glycine soja [wild soybean]
emb|CDY06872.1|  BnaC01g09710D                                        64.3    3e-09   
dbj|BAK03197.1|  predicted protein                                    62.4    3e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY35218.1|  BnaA01g08130D                                        64.3    3e-09   Brassica napus [oilseed rape]
ref|XP_009129299.1|  PREDICTED: tetraspanin-20                        63.9    3e-09   Brassica rapa
ref|XP_003542449.1|  PREDICTED: tetraspanin-18-like isoform X1        63.5    4e-09   Glycine max [soybeans]
ref|XP_006377339.1|  hypothetical protein POPTR_0011s05050g           63.2    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006653035.1|  PREDICTED: tetraspanin-19-like                   63.2    4e-09   Oryza brachyantha
ref|XP_008447349.1|  PREDICTED: tetraspanin-18                        63.9    4e-09   Cucumis melo [Oriental melon]
ref|NP_179667.2|  tetraspanin family protein                          62.8    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006443681.1|  hypothetical protein CICLE_v10021447mg           63.5    5e-09   
gb|KDO65809.1|  hypothetical protein CISIN_1g022738mg                 63.5    6e-09   Citrus sinensis [apfelsine]
gb|KHN48971.1|  hypothetical protein glysoja_025348                   63.5    6e-09   Glycine soja [wild soybean]
gb|ACF83532.1|  unknown                                               62.0    8e-09   Zea mays [maize]
ref|XP_006443682.1|  hypothetical protein CICLE_v10021447mg           63.2    8e-09   
ref|XP_008674064.1|  PREDICTED: uncharacterized protein LOC100191...  62.0    9e-09   
ref|NP_001130849.1|  uncharacterized protein LOC100191953             60.8    9e-09   
ref|XP_002885992.1|  hypothetical protein ARALYDRAFT_480447           62.8    9e-09   
gb|KDO65808.1|  hypothetical protein CISIN_1g022738mg                 62.8    1e-08   Citrus sinensis [apfelsine]
ref|XP_004152011.1|  PREDICTED: uncharacterized protein LOC101206480  62.8    1e-08   Cucumis sativus [cucumbers]
ref|XP_004165944.1|  PREDICTED: uncharacterized LOC101206480          62.8    1e-08   
ref|XP_010241967.1|  PREDICTED: tetraspanin-19 isoform X3             60.8    1e-08   Nelumbo nucifera [Indian lotus]
gb|EPS69019.1|  hypothetical protein M569_05751                       60.5    2e-08   Genlisea aurea
ref|XP_003539915.1|  PREDICTED: tetraspanin-19-like isoform 1         60.8    2e-08   Glycine max [soybeans]
gb|AAL47370.1|  unknown protein                                       61.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236362.1|  uncharacterized protein LOC100527459             60.8    2e-08   
ref|XP_007132701.1|  hypothetical protein PHAVU_011G117300g           60.5    2e-08   Phaseolus vulgaris [French bean]
ref|XP_010242945.1|  PREDICTED: tetraspanin-19-like                   60.8    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_011027860.1|  PREDICTED: tetraspanin-19-like                   60.8    3e-08   Populus euphratica
ref|XP_006580963.1|  PREDICTED: uncharacterized protein LOC100527...  60.8    3e-08   
ref|XP_010526469.1|  PREDICTED: tetraspanin-20                        61.6    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_010241963.1|  PREDICTED: tetraspanin-19 isoform X1             60.5    3e-08   Nelumbo nucifera [Indian lotus]
gb|KJB69491.1|  hypothetical protein B456_011G026600                  61.6    3e-08   Gossypium raimondii
ref|XP_010940414.1|  PREDICTED: tetraspanin-19-like                   60.5    3e-08   Elaeis guineensis
ref|NP_565468.1|  tetraspanin family protein                          61.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003605018.1|  Tetraspanin family protein                       61.2    4e-08   
ref|XP_003589423.1|  Tetraspanin family protein                       61.2    4e-08   
gb|AES87215.2|  tetraspanin family protein                            61.2    4e-08   
emb|CAN81513.1|  hypothetical protein VITISV_012029                   59.3    4e-08   
ref|XP_010940675.1|  PREDICTED: tetraspanin-18 isoform X1             60.5    4e-08   
ref|XP_002305145.2|  hypothetical protein POPTR_0004s04160g           60.1    5e-08   
emb|CEG00075.1|  unnamed product                                      60.8    5e-08   
ref|XP_003082582.1|  senescence-associated protein-like (ISS)         60.8    5e-08   
ref|XP_004514452.1|  PREDICTED: tetraspanin-19-like                   60.1    5e-08   
ref|XP_007132700.1|  hypothetical protein PHAVU_011G117300g           60.1    5e-08   
ref|XP_009390580.1|  PREDICTED: tetraspanin-19-like                   59.3    6e-08   
gb|AGV54188.1|  hypothetical protein                                  59.7    7e-08   
ref|XP_007025662.1|  Tetraspanin family protein isoform 2             59.7    7e-08   
ref|XP_008375915.1|  PREDICTED: tobamovirus multiplication protei...  60.1    7e-08   
gb|ABK93560.1|  unknown                                               60.5    7e-08   
ref|XP_002301831.1|  hypothetical protein POPTR_0002s25480g           60.5    8e-08   
gb|KDP43415.1|  hypothetical protein JCGZ_16702                       59.7    8e-08   
gb|KHN15670.1|  hypothetical protein glysoja_050252                   60.1    9e-08   
emb|CDY05788.1|  BnaC07g00150D                                        59.3    9e-08   
ref|XP_006298317.1|  hypothetical protein CARUB_v10014382mg           60.1    9e-08   
ref|XP_010672322.1|  PREDICTED: tobamovirus multiplication protei...  59.3    9e-08   
gb|EMT26254.1|  hypothetical protein F775_30948                       59.7    1e-07   
ref|XP_007025661.1|  Tetraspanin family protein, putative isoform 1   58.9    1e-07   
ref|XP_010540944.1|  PREDICTED: tetraspanin-18                        59.7    1e-07   
ref|XP_004140033.1|  PREDICTED: uncharacterized protein LOC101207092  58.2    2e-07   
gb|EYU17846.1|  hypothetical protein MIMGU_mgv1a0219311mg             55.5    2e-07   
ref|XP_010243645.1|  PREDICTED: tetraspanin-18                        59.7    2e-07   
ref|XP_003635421.2|  PREDICTED: tetraspanin-19-like                   58.2    2e-07   
gb|EEC83268.1|  hypothetical protein OsI_28600                        57.8    3e-07   
gb|EEE68396.1|  hypothetical protein OsJ_26735                        58.2    3e-07   
ref|XP_010467838.1|  PREDICTED: tetraspanin-19-like                   56.6    3e-07   
ref|XP_002319358.1|  hypothetical protein POPTR_0013s13770g           58.2    3e-07   
ref|XP_010689328.1|  PREDICTED: tetraspanin-19                        57.8    3e-07   
ref|XP_002448786.1|  hypothetical protein SORBIDRAFT_06g033120        57.8    4e-07   
ref|XP_011043359.1|  PREDICTED: tetraspanin-19-like isoform X1        57.0    5e-07   
ref|XP_011024533.1|  PREDICTED: tetraspanin-20-like                   57.8    6e-07   
ref|NP_001145473.1|  uncharacterized protein LOC100278862             56.6    7e-07   
gb|AFW59922.1|  hypothetical protein ZEAMMB73_645130                  56.6    7e-07   
ref|NP_001242107.1|  uncharacterized protein LOC100816955             57.0    8e-07   
ref|XP_008806539.1|  PREDICTED: tetraspanin-19 isoform X1             56.6    1e-06   
ref|XP_009400416.1|  PREDICTED: tetraspanin-19-like                   56.2    1e-06   
ref|XP_010467771.1|  PREDICTED: LOW QUALITY PROTEIN: tetraspanin-19   56.2    1e-06   
ref|XP_007043566.1|  Tetraspanin family protein                       55.8    1e-06   
ref|XP_008806541.1|  PREDICTED: tetraspanin-19 isoform X2             55.5    2e-06   
emb|CAN83474.1|  hypothetical protein VITISV_004797                   56.2    2e-06   
ref|XP_010241966.1|  PREDICTED: tetraspanin-19 isoform X2             55.1    3e-06   
ref|XP_002521157.1|  conserved hypothetical protein                   54.7    5e-06   
ref|NP_194606.1|  tetraspanin family protein                          55.1    5e-06   
ref|XP_011460242.1|  PREDICTED: tetraspanin-19-like isoform X2        54.3    5e-06   
ref|NP_001190864.1|  tetraspanin family protein                       55.1    6e-06   
ref|XP_004293588.1|  PREDICTED: tetraspanin-19-like isoform X1        54.3    6e-06   
ref|XP_010091855.1|  hypothetical protein L484_015924                 54.3    9e-06   
ref|XP_002867437.1|  hypothetical protein ARALYDRAFT_328819           54.3    9e-06   
ref|XP_006284299.1|  hypothetical protein CARUB_v10005468mg           54.3    1e-05   
ref|XP_007213966.1|  hypothetical protein PRUPE_ppa011429mg           53.5    1e-05   
ref|XP_008383761.1|  PREDICTED: tetraspanin-19-like isoform X2        53.1    1e-05   
ref|XP_011006807.1|  PREDICTED: tetraspanin-19-like isoform X2        53.5    1e-05   
ref|XP_010100540.1|  hypothetical protein L484_012095                 53.1    1e-05   
ref|XP_008345888.1|  PREDICTED: tetraspanin-19-like                   52.4    2e-05   
gb|ADT92198.1|  hypothetical protein                                  52.8    3e-05   
gb|KDO46091.1|  hypothetical protein CISIN_1g045785mg                 50.1    3e-05   
ref|XP_011039742.1|  PREDICTED: tetraspanin-19 isoform X2             52.4    4e-05   
ref|XP_009337122.1|  PREDICTED: tetraspanin-19-like                   52.0    4e-05   
ref|XP_011039741.1|  PREDICTED: tetraspanin-19 isoform X1             52.0    4e-05   
ref|XP_006371574.1|  hypothetical protein POPTR_0019s13290g           52.0    5e-05   
ref|XP_010052325.1|  PREDICTED: tetraspanin-19-like                   51.6    5e-05   
ref|XP_008778399.1|  PREDICTED: tetraspanin-19-like                   51.2    8e-05   
ref|XP_010438387.1|  PREDICTED: tetraspanin-20                        51.6    1e-04   
ref|XP_010433163.1|  PREDICTED: tetraspanin-20-like                   51.6    1e-04   
ref|XP_010447919.1|  PREDICTED: tetraspanin-20-like                   51.2    1e-04   
gb|ABK27062.1|  unknown                                               50.8    1e-04   
ref|XP_011006804.1|  PREDICTED: tetraspanin-19-like isoform X1        50.1    2e-04   
ref|XP_008225065.1|  PREDICTED: tetraspanin-19-like                   49.7    3e-04   
tpg|DAA35326.1|  TPA: hypothetical protein ZEAMMB73_410646            48.1    3e-04   
ref|XP_008812932.1|  PREDICTED: uncharacterized protein LOC103723703  47.4    4e-04   
ref|XP_009420868.1|  PREDICTED: tetraspanin-19-like isoform X1        48.1    8e-04   
ref|XP_009420870.1|  PREDICTED: tetraspanin-19-like isoform X2        48.1    0.001   
ref|XP_010910972.1|  PREDICTED: tetraspanin-19-like                   48.1    0.001   



>ref|XP_009590611.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
 ref|XP_009590612.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
Length=283

 Score =   254 bits (649),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W++EIP+D+TGNFD IYEFLED+WKI+KWVALGAV+LEAL+FLLALVVRAANRPADYDSD
Sbjct  139  WREEIPSDKTGNFDTIYEFLEDHWKIIKWVALGAVILEALIFLLALVVRAANRPADYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYIGGPRQQIRQP++NNR   P TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  199  DEYIGGPRQQIRQPLINNRPPNPATGVPVAGTLDNRPSRNDAWSTRMREKYGLDTSEFTY  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP +SNRY  T VQP EER  C IM
Sbjct  259  NPSDSNRYPQTAVQPQEERKGCAIM  283



>ref|XP_009788106.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
 ref|XP_009788107.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
Length=283

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W++EIP+D+TGNFD IY+FLED+WKI+KWVALGAV+LEAL+FLLALVVRAANRPADYDSD
Sbjct  139  WREEIPSDKTGNFDTIYDFLEDHWKIIKWVALGAVILEALIFLLALVVRAANRPADYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYIGGPRQQIRQP++NNR   P TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  199  DEYIGGPRQQIRQPLINNRPPNPATGVPVAGTLDNRPSRNDAWSTRMREKYGLDTSEFTY  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP +SNRY  T VQP EER  C IM
Sbjct  259  NPSDSNRYPQTAVQPQEERKGCAIM  283



>emb|CDP12960.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   247 bits (630),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP DRTG F MIY+FLE++WKIVKWVALGAVVLEAL+FLLALVVRAANRPA+YDSD
Sbjct  75   WKEEIPADRTGTFGMIYDFLEEHWKIVKWVALGAVVLEALVFLLALVVRAANRPANYDSD  134

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK--YGLDTSEF  226
            DEYIGGPRQQIRQP++N  Q AP TGVPVAGTLD RPSRNDAWS RMREK  YGLDTSEF
Sbjct  135  DEYIGGPRQQIRQPLINRPQPAPATGVPVAGTLDSRPSRNDAWSTRMREKACYGLDTSEF  194

Query  225  TYNPYESNRYQPTNVQPAEERGRCTIM  145
            TYNP +SNRY     QP EER RCTIM
Sbjct  195  TYNPSDSNRYPQGTAQPTEERSRCTIM  221



>ref|XP_011070225.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
 ref|XP_011070226.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
Length=281

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D+TGNFDM+YEFLE +WKI+KWVALGAV+LEA++FLLAL+VRAANRPADYDSD
Sbjct  138  WKEEIPNDKTGNFDMMYEFLEKHWKIIKWVALGAVILEAVIFLLALIVRAANRPADYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +EYIGGPRQQIRQP++ NRQ  P TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  198  EEYIGGPRQQIRQPLI-NRQPVPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRY     QP EER RC IM
Sbjct  257  NPNESNRYPQAATQPQEERSRCIIM  281



>ref|XP_004245872.1| PREDICTED: tobamovirus multiplication protein 2A [Solanum lycopersicum]
Length=284

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK EIP D+TGNF+ IY+FL+D+WKI+KWVALGAV+ EAL+FLLALVVRAANRPADYDSD
Sbjct  139  WKDEIPRDKTGNFETIYDFLDDHWKIIKWVALGAVIFEALIFLLALVVRAANRPADYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQA-PVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DEYIGGPRQQIRQP++NNR  A P TGVPV  TLD RPSRNDAWS RMREKYGLDTSEFT
Sbjct  199  DEYIGGPRQQIRQPLINNRPPANPATGVPVTATLDNRPSRNDAWSTRMREKYGLDTSEFT  258

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP ESNRY PT  QP EER  CTIM
Sbjct  259  YNPSESNRYPPTAAQPQEERKGCTIM  284



>gb|AIX10945.1| putative tetraspanin family protein [Gardenia jasminoides]
Length=286

 Score =   244 bits (622),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTDRTG F MIY+FLE++WKIVKWVALGAVVLEA +FLLALVVRAANR  DYDSD
Sbjct  142  WKQEIPTDRTGTFSMIYDFLEEHWKIVKWVALGAVVLEAFIFLLALVVRAANRTPDYDSD  201

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYIGG RQQ RQP++N  Q AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  202  DEYIGGSRQQTRQPLINRPQPAPATGVPVAGTLDSRPSRNDAWSTRMREKYGLDTSEFTY  261

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNR      QP EER RCTIM
Sbjct  262  NPSESNRTLQGAAQPTEERSRCTIM  286



>ref|XP_006358577.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358578.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Solanum tuberosum]
Length=284

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK EIP D+TGNF+ IY+FL+D+WKI+KWVALGAV+ EAL+FLLALVVRAANRPADYDSD
Sbjct  139  WKDEIPRDKTGNFETIYDFLDDHWKIIKWVALGAVIFEALIFLLALVVRAANRPADYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQA-PVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DEYIGGPRQQIRQP+++NR  A P TGVPV  TLD RPSRNDAWS RMREKYGLDTSEFT
Sbjct  199  DEYIGGPRQQIRQPLISNRPPANPATGVPVTATLDNRPSRNDAWSTRMREKYGLDTSEFT  258

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP ESNRY PT  QP EER  C IM
Sbjct  259  YNPSESNRYPPTATQPQEERKGCAIM  284



>gb|AFK40219.1| unknown [Lotus japonicus]
Length=282

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WKKEIPTD+TGNFDMIYEFL +NW IV+WVALG V+ EAL+F+LAL+VRAANRPADYDSD
Sbjct  140  WKKEIPTDKTGNFDMIYEFLRENWNIVRWVALGIVIFEALLFVLALIVRAANRPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I  PRQQ RQP++ NR  AP +GVPVAGT+D RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  200  EEFI-NPRQQARQPLL-NRPAAPASGVPVAGTIDQRPSRNDAWSTRMREKYGLDTSEFTY  257

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES R+Q  N QP EER RC IM
Sbjct  258  NPSESQRFQQVNSQPTEERSRCAIM  282



>gb|KHG01123.1| hypothetical protein F383_00667 [Gossypium arboreum]
Length=278

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+E+PTD+TG FDMIY+FLE+NW IVKWVALG VVLEA++FLLAL+VRAAN PADYDSD
Sbjct  136  WKEELPTDKTGYFDMIYQFLEENWSIVKWVALGIVVLEAVIFLLALMVRAANVPADYDSD  195

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQQIRQP++ NR   P TGVPV G+LD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  196  DEFI-APRQQIRQPLI-NRPPVPATGVPVTGSLDQRPSRNDAWSARMREKYGLDTSEFTY  253

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQ T  QPAE   RCTIM
Sbjct  254  NPSESNRYQQTAPQPAEGSSRCTIM  278



>ref|XP_002527636.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34707.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDMIY+FL++ WKIV+WVALG V+LEAL+F+LAL+VRAANRPA+YDSD
Sbjct  138  WKEEIPTDKTGDFDMIYDFLKEKWKIVRWVALGVVILEALLFVLALIVRAANRPAEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQIRQP++ NR   P TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEF+Y
Sbjct  198  DELI-APRQQIRQPLL-NRPPGPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFSY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q  + QP EER RCTIM
Sbjct  256  NPSESHRFQQVSTQPTEERSRCTIM  280



>gb|KJB25374.1| hypothetical protein B456_004G188200 [Gossypium raimondii]
Length=280

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK E+PTD+TG+FDMIY+FLE+NW I+KW ALG V+LEAL+FLLAL+VRAANRPADYDSD
Sbjct  138  WKDELPTDKTGDFDMIYDFLEENWTIIKWAALGIVILEALIFLLALLVRAANRPADYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PR QIRQP++ NR  AP  GVPV  TL+ RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  198  DEFI-APRPQIRQPLI-NRPPAPAAGVPVVPTLEQRPSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQP   QPAEER RCTIM
Sbjct  256  NPSESNRYQPVAPQPAEERSRCTIM  280



>gb|EYU33039.1| hypothetical protein MIMGU_mgv1a011319mg [Erythranthe guttata]
Length=285

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK EIPTD+TGNF MIY+FL+D+WKIVKWVALGAV+LEAL+FLLAL+VRAAN P+DYDSD
Sbjct  140  WKDEIPTDKTGNFSMIYDFLDDHWKIVKWVALGAVILEALIFLLALIVRAANSPSDYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +EYIGG RQQIRQP++N     PVTG PV   LD R SR D+WS RMREKYGLDTSEFTY
Sbjct  200  EEYIGGSRQQIRQPLINRPAGGPVTGPPVTNNLDQRTSRTDSWSTRMREKYGLDTSEFTY  259

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQ +  QP+EER RC I+
Sbjct  260  NPSESNRYQQSATQPSEERNRCCII  284



>ref|XP_011028243.1| PREDICTED: tobamovirus multiplication protein 2A-like [Populus 
euphratica]
Length=280

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D+TG+FDM+Y+FL++ W IVKWVALG V+LEAL+FLLAL+VRAANRP +YDSD
Sbjct  138  WKEEIPPDKTGDFDMLYDFLKEKWNIVKWVALGIVILEALIFLLALLVRAANRPLEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQ RQP++N R  AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  198  DELIA-PRQQNRQPLLN-RPPAPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+QP + QPAEER RCTIM
Sbjct  256  NPSESHRFQPVSAQPAEERSRCTIM  280



>ref|XP_006385612.1| GMFP4 family protein [Populus trichocarpa]
 gb|ABK92751.1| unknown [Populus trichocarpa]
 gb|ERP63409.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDM+Y+FL++ W IVKWVALG V+LEAL+FLLAL+VRAANRP +YDSD
Sbjct  138  WKEEIPTDKTGDFDMLYDFLKEKWNIVKWVALGIVILEALIFLLALLVRAANRPVEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQ RQP++N R  AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  198  DELIA-PRQQNRQPLLN-RPPAPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP E +R+QP + QP EER RCTIM
Sbjct  256  NPSEPHRFQPVSAQPTEERSRCTIM  280



>gb|KHG08208.1| Tetraspanin-33 [Gossypium arboreum]
Length=280

 Score =   231 bits (588),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK E+PTD+TG+FDMIY+FLE+NW I+KW ALG V+LEAL+FLLAL+VRAANRPADYDSD
Sbjct  138  WKDELPTDKTGDFDMIYDFLEENWTIIKWAALGIVILEALIFLLALMVRAANRPADYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PR QIRQP++ NR  AP  GVPV  +L+ RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  198  DEFI-APRSQIRQPLI-NRPPAPAAGVPVVPSLEQRPSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            +P ESNRYQP   QPAEER RCTIM
Sbjct  256  SPSESNRYQPVAPQPAEERSRCTIM  280



>gb|KJB37690.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
 gb|KJB37691.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
Length=277

 Score =   230 bits (587),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 123/145 (85%), Gaps = 3/145 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+E+PTD+TG FDMIY+FLE+NW IVKWVALG VVLEA++FLLAL+VRAAN PADYDSD
Sbjct  136  WKEELPTDKTGYFDMIYQFLEENWSIVKWVALGIVVLEAIIFLLALMVRAANVPADYDSD  195

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQQIRQP++  R   P TGVPV G+LD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  196  DEFI-APRQQIRQPLI--RPPVPATGVPVTGSLDQRPSRNDAWSARMREKYGLDTSEFTY  252

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQ    QPAEE   CTIM
Sbjct  253  NPSESNRYQQAAPQPAEESSCCTIM  277



>ref|XP_006485406.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Citrus sinensis]
 ref|XP_006485407.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Citrus sinensis]
Length=279

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W++EIP DRTG+F+MIY+FL +NW IVKWVALG V+L+AL+FLLA++VRAANRP +YDSD
Sbjct  137  WREEIPADRTGDFNMIYDFLRENWNIVKWVALGVVILQALIFLLAIIVRAANRPVEYDSD  196

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQIRQP++N R   P TGVPVAG+LD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  197  DELIA-PRQQIRQPLIN-RPTPPATGVPVAGSLDQRPSRNDAWSTRMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QPAEER RCTIM
Sbjct  255  NPSESHRFQQVATQPAEERSRCTIM  279



>ref|XP_007039575.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039576.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039577.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24076.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24077.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24078.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
Length=280

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK E+PTD+TG+FDMIY+FL+++W IVKW ALG V+LEAL+FLLAL+VRAANRP DYDSD
Sbjct  138  WKDELPTDKTGDFDMIYKFLKEHWSIVKWAALGVVILEALIFLLALMVRAANRPVDYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE++  PR QIRQP++N R   P TGVPVAG+L+ R SRNDAWS RMREKYGLDTSEFTY
Sbjct  198  DEFMA-PRPQIRQPLIN-RPPVPATGVPVAGSLEQRSSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQ    QPAEER RCTIM
Sbjct  256  NPSESNRYQQVTPQPAEERSRCTIM  280



>ref|XP_009385932.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385933.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TGNF+ IY FLEDNWKI KWVALGAV+LEA +F+LAL+VRAANRPA+YDSD
Sbjct  141  WKDLIPDDKTGNFETIYNFLEDNWKIAKWVALGAVILEAFVFVLALIVRAANRPAEYDSD  200

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PR  IRQP+MN RQ  P TGVPV GTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  201  DEYIA-PRSTIRQPLMN-RQGTPATGVPVLGTLDHRPSRNDAWSQRMREKYGLDTSEFTY  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP + NRYQP      EERGRC IM
Sbjct  259  NPSDPNRYQPATAPQVEERGRCIIM  283



>gb|KHN01670.1| hypothetical protein glysoja_012981 [Glycine soja]
Length=250

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D+TG+FDMIYEFL +NW +V+WVALG V+ EAL+F+LAL+VRAANRP +YDSD
Sbjct  108  WKEEIPKDKTGDFDMIYEFLRENWNVVRWVALGIVIFEALLFVLALIVRAANRPPEYDSD  167

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +EYI  PRQQ+RQP++N R   P +G P  GTLD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  168  EEYIN-PRQQVRQPLLN-RPAGPASGAPATGTLDKRPSRNDAWSARMREKYGLDTSEFTY  225

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+RYQ  N QP EER RC IM
Sbjct  226  NPSESHRYQQVNPQPTEERSRCAIM  250



>gb|KJB51696.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=219

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK EIPTD+TG+FDMIYEFLE+NW I+KWVALG VVLEA +FLLAL+VRAAN PADYDSD
Sbjct  77   WKDEIPTDKTGDFDMIYEFLEENWTILKWVALGIVVLEAFIFLLALMVRAANIPADYDSD  136

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PR+Q RQP+++     P +GVPV+ +LD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  137  DEFI-APREQ-RQPLISRPPSVPASGVPVSVSLDQRPSRNDAWSARMREKYGLDTSEFTY  194

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQ     PAEER RCTIM
Sbjct  195  NPAESNRYQQVVPPPAEERSRCTIM  219



>ref|NP_001240069.1| uncharacterized protein LOC100793680 [Glycine max]
 gb|ACU21254.1| unknown [Glycine max]
Length=277

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D+TG+FDMIYEFL +NW +V+WVALG V+ EAL+F+LAL+VRAANRP +YDSD
Sbjct  135  WKEEIPKDKTGDFDMIYEFLRENWNVVRWVALGIVIFEALLFVLALIVRAANRPPEYDSD  194

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +EYI  PRQQ+RQP++N R   P +G P  GTLD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  195  EEYIN-PRQQVRQPLLN-RPAGPASGAPATGTLDKRPSRNDAWSARMREKYGLDTSEFTY  252

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+RYQ  N QP EER RC IM
Sbjct  253  NPSESHRYQQVNPQPTEERSRCAIM  277



>gb|KJB51694.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
 gb|KJB51695.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=280

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK EIPTD+TG+FDMIYEFLE+NW I+KWVALG VVLEA +FLLAL+VRAAN PADYDSD
Sbjct  138  WKDEIPTDKTGDFDMIYEFLEENWTILKWVALGIVVLEAFIFLLALMVRAANIPADYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PR+Q RQP+++     P +GVPV+ +LD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  198  DEFI-APREQ-RQPLISRPPSVPASGVPVSVSLDQRPSRNDAWSARMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQ     PAEER RCTIM
Sbjct  256  NPAESNRYQQVVPPPAEERSRCTIM  280



>ref|XP_010269960.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269962.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269963.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269964.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
Length=280

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  +PTD+T +F+MIYEFL+ NWKI KWVALGAV+LEAL+FLLAL+VRAAN+PADYDSD
Sbjct  138  WKDALPTDKTRDFEMIYEFLKKNWKIAKWVALGAVILEALVFLLALMVRAANQPADYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PR   RQP++N RQ  P TG PVAG+LD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  198  DEYIA-PRSTARQPLIN-RQGVPSTGSPVAGSLDQRPSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP + NR+Q    QPAEER RCTIM
Sbjct  256  NPSDPNRFQQAPAQPAEERSRCTIM  280



>gb|KHN21027.1| hypothetical protein glysoja_034149 [Glycine soja]
Length=250

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+F+LAL+VRAANRP +YDSD
Sbjct  108  WKEEIPTDKTGDFDMIYGFLRENWNIVRWVALGIVIFEALLFVLALIVRAANRPTEYDSD  167

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +EYI  PRQQ RQP++ NR   PV+G P  GTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  168  EEYI-NPRQQARQPLL-NRPAGPVSGAPATGTLDQRPSRNDAWSTRMREKYGLDTSEFTY  225

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+RYQ  N QP EE  RC IM
Sbjct  226  NPSESHRYQQVNSQPTEEGSRCAIM  250



>emb|CBI33948.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ +IPTD+TG+FDMIY+FL++NWKIVKWVAL AV+LEAL+F+L L+VRAAN+P DYDSD
Sbjct  75   WEDDIPTDKTGDFDMIYDFLKENWKIVKWVALAAVILEALLFVLTLMVRAANKPDDYDSD  134

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I   RQ +RQP++N R     TGVPVAG +D RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  135  DEFIAQ-RQSVRQPLIN-RPPVAATGVPVAGAIDQRPSRNDAWSTRMREKYGLDTSEFTY  192

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRY P   QP EER RCTIM
Sbjct  193  NPSESNRYPPGQQQPTEERSRCTIM  217



>ref|XP_009397919.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=284

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  +P D+T NFD+IY FLEDNWKI KWVALG V+LEAL+F+LAL+VRA NRP +YDSD
Sbjct  141  WKDLVPDDKTRNFDIIYNFLEDNWKIAKWVALGVVILEALVFMLALIVRAVNRPIEYDSD  200

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            D+    PR  IRQP+M NRQ AP TGVPV GTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  201  DDVCIAPRSSIRQPLM-NRQGAPATGVPVLGTLDHRPSRNDAWSQRMREKYGLDTSEFTY  259

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP + +RYQ   V PAEERG CTI+
Sbjct  260  NPSDPSRYQQATVPPAEERGHCTIL  284



>ref|XP_003524459.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Glycine 
max]
 ref|XP_006579675.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Glycine 
max]
 ref|XP_006579676.1| PREDICTED: tobamovirus multiplication protein 2A isoform X3 [Glycine 
max]
Length=277

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+F+LAL+VRAANRP +YDSD
Sbjct  135  WKEEIPTDKTGDFDMIYGFLRENWNIVRWVALGIVIFEALLFVLALIVRAANRPTEYDSD  194

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +EYI  PRQQ RQP++ NR   PV+G P  GTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  195  EEYI-NPRQQARQPLL-NRPAGPVSGAPATGTLDQRPSRNDAWSTRMREKYGLDTSEFTY  252

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+RYQ  N QP EE  RC IM
Sbjct  253  NPSESHRYQQVNSQPTEEGSRCAIM  277



>gb|KDP36200.1| hypothetical protein JCGZ_10291 [Jatropha curcas]
Length=279

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG F+ IY+FL++NWKIVKWVALG V LEAL+F++AL+VRAANRP +YDSD
Sbjct  137  WKEEIPTDKTGVFNDIYDFLKENWKIVKWVALGIVALEALLFVIALMVRAANRPVEYDSD  196

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQ+RQP++N R   P  GVPVAG LD RPSRNDAWS RMREKYGLDTSEF+Y
Sbjct  197  DELIA-PRQQVRQPLIN-RPPGPAAGVPVAGALDQRPSRNDAWSTRMREKYGLDTSEFSY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES R+Q    QPAEER RCTIM
Sbjct  255  NPSESQRFQQVQTQPAEERSRCTIM  279



>gb|EYU33040.1| hypothetical protein MIMGU_mgv1a011318mg [Erythranthe guttata]
Length=285

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK +IPTD TGNF MIYEFL+ +WKI+KWVALGAV+LEAL+FLLAL+VRAAN PADYDSD
Sbjct  140  WKDKIPTDGTGNFAMIYEFLDKHWKIIKWVALGAVILEALIFLLALIVRAANTPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +EYIG PRQQ RQP++N     PVTGVPV  T D   SR D+WS RMREKYGLDTSE+TY
Sbjct  200  EEYIGRPRQQTRQPLINKPAGGPVTGVPVTNTPDNLTSRTDSWSRRMREKYGLDTSEYTY  259

Query  219  NPYESNRYQPTNVQPAEERGR-CTIM  145
            NP ESNRYQ +  QP+EER R CTIM
Sbjct  260  NPSESNRYQQSTTQPSEERSRGCTIM  285



>ref|XP_011018623.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018624.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018625.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
Length=280

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+ +PTD++G+FDMIY+FL++NW IVKWVALG VVLEAL+FLL LVVRAANRP +YDSD
Sbjct  138  WKEVLPTDKSGDFDMIYKFLKENWNIVKWVALGIVVLEALIFLLTLVVRAANRPVEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I   RQQ RQP++ NR  AP  GVPV GTLD RP RNDAWS RMREKYGLDTSEF+Y
Sbjct  198  DEFIAS-RQQTRQPLL-NRPPAPAAGVPVTGTLDQRPGRNDAWSTRMREKYGLDTSEFSY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP E +R QP + QP EER RCTIM
Sbjct  256  NPSEPHRLQPASAQPTEERSRCTIM  280



>ref|XP_002279170.2| PREDICTED: tobamovirus multiplication protein 2A [Vitis vinifera]
Length=280

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ +IPTD+TG+FDMIY+FL++NWKIVKWVAL AV+LEAL+F+L L+VRAAN+P DYDSD
Sbjct  138  WEDDIPTDKTGDFDMIYDFLKENWKIVKWVALAAVILEALLFVLTLMVRAANKPDDYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I   RQ +RQP++N R     TGVPVAG +D RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  198  DEFIA-QRQSVRQPLIN-RPPVAATGVPVAGAIDQRPSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRY P   QP EER RCTIM
Sbjct  256  NPSESNRYPPGQQQPTEERSRCTIM  280



>ref|XP_006368443.1| GMFP4 family protein [Populus trichocarpa]
 gb|ERP65012.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+ +PTD++G+FDMIY+FL++NW IV+WVALG V+LEAL+FLL LVVRAANRP +YDSD
Sbjct  138  WKEVLPTDKSGDFDMIYKFLKENWNIVRWVALGIVILEALIFLLTLVVRAANRPVEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I   RQQ RQP++ NR  AP  GVPV+GTLD RP RNDAWS RMREKYGLDTSEF+Y
Sbjct  198  DEFIAS-RQQTRQPLL-NRPPAPAAGVPVSGTLDQRPGRNDAWSTRMREKYGLDTSEFSY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP E +R QP   QP EER RCTIM
Sbjct  256  NPSEPHRLQPAAAQPTEERSRCTIM  280



>gb|KHG29162.1| Solute carrier family 28 member 3 [Gossypium arboreum]
Length=201

 Score =   216 bits (550),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK EIPTD+TG+FD+IYEFLE+NW IVKWVALG VVLEA +F LAL+VRAAN PADYDSD
Sbjct  59   WKDEIPTDKTGDFDLIYEFLEENWTIVKWVALGIVVLEAFIFWLALMVRAANIPADYDSD  118

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            D++I   R++ RQP+++     P +GVPV+ +LD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  119  DDFIA--RREQRQPLISRPPSVPASGVPVSVSLDQRPSRNDAWSARMREKYGLDTSEFTY  176

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQ     PAEER RCTIM
Sbjct  177  NPAESNRYQQVVPPPAEERSRCTIM  201



>gb|KEH31557.1| tetraspanin family protein [Medicago truncatula]
Length=280

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D+TG+FDM+Y FL +NW IVKWVALG V+ EAL+F+LAL+VRAANRP DYDSD
Sbjct  138  WKEEIPRDKTGDFDMVYNFLRENWTIVKWVALGIVIFEALLFILALIVRAANRPVDYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I  PRQQ RQP++ NR   P  GVPV GT D R +RNDAWS RMREKYGLDTSEFTY
Sbjct  198  EEFI-NPRQQARQPLL-NRPAGPAPGVPVTGTTDPRSNRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES R+Q  N QPAEER RCTIM
Sbjct  256  NPSESQRFQQVNSQPAEERSRCTIM  280



>ref|XP_004509001.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004509002.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
Length=280

 Score =   218 bits (555),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D++G+FDM+Y+FL  NW IVKWVALG V+ EAL+F+LAL+VRAANRPADYDSD
Sbjct  138  WKEEIPRDKSGDFDMLYQFLRANWNIVKWVALGIVIFEALLFILALIVRAANRPADYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I  PRQQ RQP++ NR   P  GVPV G +D R SRNDAWS RMREKYGLDTSEFTY
Sbjct  198  EEFI-NPRQQARQPLL-NRPAGPAPGVPVTGPVDQRSSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q  N QP EER RCTIM
Sbjct  256  NPSESHRFQQVNSQPTEERSRCTIM  280



>ref|XP_010104372.1| hypothetical protein L484_023325 [Morus notabilis]
 gb|EXB99792.1| hypothetical protein L484_023325 [Morus notabilis]
Length=251

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = -1

Query  570  EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEY  391
            EIPTD+TG+FDM+Y FL+D+WKIV+WVALGAVV EAL+FL AL+V++ANRPA+YDSDDE+
Sbjct  112  EIPTDKTGDFDMVYAFLKDHWKIVRWVALGAVVFEALLFLFALLVKSANRPAEYDSDDEF  171

Query  390  IGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTYNPY  211
            I  PRQQIRQP++N RQ AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTYNP 
Sbjct  172  IA-PRQQIRQPLIN-RQAAPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPS  229

Query  210  ESNRYQPTNVQPAEERGRCTIM  145
            ESNR+Q    QP EER RCTIM
Sbjct  230  ESNRFQQVAPQPTEERSRCTIM  251



>gb|KHG29161.1| Stk31 [Gossypium arboreum]
Length=259

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK EIPTD+TG+FD+IYEFLE+NW IVKWVALG VVLEA +F LAL+VRAAN PADYDSD
Sbjct  117  WKDEIPTDKTGDFDLIYEFLEENWTIVKWVALGIVVLEAFIFWLALMVRAANIPADYDSD  176

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            D++I   R++ RQP+++     P +GVPV+ +LD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  177  DDFIA--RREQRQPLISRPPSVPASGVPVSVSLDQRPSRNDAWSARMREKYGLDTSEFTY  234

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNRYQ     PAEER RCTIM
Sbjct  235  NPAESNRYQQVVPPPAEERSRCTIM  259



>gb|AFK47448.1| unknown [Medicago truncatula]
Length=220

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLLAL+VRA NRPADYDSD
Sbjct  77   WKEEIPTDKTGDFDMIYGFLRENWDIVRWVALGIVIFEALLFLLALIVRAVNRPADYDSD  136

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQ+RQP++NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSEFTY
Sbjct  137  DELIN-PRQQVRQPLLNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTY  195

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES R+Q  N QP EE+ RCTIM
Sbjct  196  NPSESQRFQQANFQPTEEKSRCTIM  220



>ref|XP_003611446.1| GMFP4 [Medicago truncatula]
Length=220

 Score =   213 bits (543),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLLAL+VRA NRPADYDSD
Sbjct  77   WKEEIPTDKTGDFDMIYGFLRENWDIVRWVALGIVIFEALLFLLALIVRAVNRPADYDSD  136

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQ+RQP++NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSEFTY
Sbjct  137  DELIN-PRQQVRQPLLNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTY  195

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES R+Q  N QP EE+ RCTIM
Sbjct  196  NPSESQRFQQANSQPTEEKSRCTIM  220



>gb|KHN42626.1| hypothetical protein glysoja_018869 [Glycine soja]
Length=283

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FD IY FL +NW IVKWVALG V+ EAL+FLLAL+VRAANRPADYDSD
Sbjct  140  WKEEIPTDKTGDFDAIYGFLIENWNIVKWVALGIVIFEALLFLLALIVRAANRPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I  PRQQ+RQP++N    +P TG+PVAGT+D RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  200  EEFIN-PRQQVRQPLLNRPAASPATGLPVAGTMDQRPSRNDAWSTRMREKYGLDTSEFTY  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNR+Q  N QP EE+ RCTIM
Sbjct  259  NPSESNRFQQVNSQPTEEKSRCTIM  283



>ref|XP_003517379.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
Length=283

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FD IY FL +NW IVKWVALG V+ EAL+FLLAL+VRAANRPADYDSD
Sbjct  140  WKEEIPTDKTGDFDAIYGFLIENWNIVKWVALGIVIFEALLFLLALIVRAANRPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I  PRQQ+RQP++N    +P TG+PVAGT+D RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  200  EEFIN-PRQQVRQPLLNRPAASPATGLPVAGTMDQRPSRNDAWSTRMREKYGLDTSEFTY  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNR+Q  N QP EE+ RCTIM
Sbjct  259  NPSESNRFQQVNSQPTEEKSRCTIM  283



>ref|XP_003611447.1| GMFP4 [Medicago truncatula]
 gb|AES94405.1| tobamovirus multiplication protein 2A [Medicago truncatula]
Length=289

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLLAL+VRA NRPADYDSD
Sbjct  146  WKEEIPTDKTGDFDMIYGFLRENWDIVRWVALGIVIFEALLFLLALIVRAVNRPADYDSD  205

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQ+RQP++NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSEFTY
Sbjct  206  DELIN-PRQQVRQPLLNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTY  264

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES R+Q  N QP EE+ RCTIM
Sbjct  265  NPSESQRFQQANSQPTEEKSRCTIM  289



>ref|XP_003611445.1| GMFP4 [Medicago truncatula]
Length=294

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLLAL+VRA NRPADYDSD
Sbjct  151  WKEEIPTDKTGDFDMIYGFLRENWDIVRWVALGIVIFEALLFLLALIVRAVNRPADYDSD  210

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQ+RQP++NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSEFTY
Sbjct  211  DELIN-PRQQVRQPLLNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTY  269

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES R+Q  N QP EE+ RCTIM
Sbjct  270  NPSESQRFQQANSQPTEEKSRCTIM  294



>ref|XP_002893721.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69980.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ E+P+DRTGNFD IY FL +NWKIV+WVALGAVV EAL+FLLAL+VRAAN P +YDSD
Sbjct  138  WRDELPSDRTGNFDTIYNFLRENWKIVRWVALGAVVFEALLFLLALIVRAANTPPEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PRQQIRQP +N RQ APVTGVPVA TLD RPSRND WSARMREKYGLDTSEFTY
Sbjct  198  DEYIA-PRQQIRQPFIN-RQAAPVTGVPVAPTLDQRPSRNDPWSARMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  256  NPSESHRFQQMPAQPNEEKGRCTIM  280



>gb|EYU17843.1| hypothetical protein MIMGU_mgv1a0124672mg, partial [Erythranthe 
guttata]
Length=221

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  558  DRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYIGGP  379
            D    F MIY+FL+D+WKIVKWVALGAV+LEAL+FLLAL+VRAAN P+DYDSD+EYIGG 
Sbjct  83   DVNWKFSMIYDFLDDHWKIVKWVALGAVILEALIFLLALIVRAANSPSDYDSDEEYIGGS  142

Query  378  RQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTYNPYESNR  199
            RQQIRQP++N     PVTG PV   LD R SR D+WS RMREKYGLDTSEFTYNP ESNR
Sbjct  143  RQQIRQPLINRPAGGPVTGPPVTNNLDQRTSRTDSWSTRMREKYGLDTSEFTYNPSESNR  202

Query  198  YQPTNVQPAEERGRCTIM  145
            YQ +  QP+EER RC I+
Sbjct  203  YQQSATQPSEERNRCCII  220



>gb|AAF81337.1|AC007767_17 Contains similarity to GMFP4 from Glycine max gb|U64915. ESTs 
gb|AV442477, gb|AV441037, gb|AV534954, gb|AV560678 and gb|AV518757 
come from this gene [Arabidopsis thaliana]
Length=252

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ E+P+DRTGNFD IY FL +NWKIV+WVALGAVV EAL+FLLAL+VRAAN PA+YDSD
Sbjct  110  WRDELPSDRTGNFDTIYNFLRENWKIVRWVALGAVVFEALLFLLALMVRAANTPAEYDSD  169

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEY+  PRQQIRQP +N RQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  170  DEYLA-PRQQIRQPFIN-RQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  227

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  228  NPSESHRFQQMPAQPNEEKGRCTIM  252



>ref|NP_564399.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_973952.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_001031127.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 sp|Q9C5W7.1|TOM2A_ARATH RecName: Full=Tobamovirus multiplication protein 2A; Short=AtTOM2A 
[Arabidopsis thaliana]
 gb|AAG50101.1|AF334723_1 unknown protein [Arabidopsis thaliana]
 gb|AAK60280.1|AF385687_1 At1g32400/F5D14_22 [Arabidopsis thaliana]
 gb|AAM66092.1| unknown [Arabidopsis thaliana]
 dbj|BAC24019.1| tobamovirus multiplication 2A [Arabidopsis thaliana]
 gb|AEE31476.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31477.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31478.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
Length=280

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ E+P+DRTGNFD IY FL +NWKIV+WVALGAVV EAL+FLLAL+VRAAN PA+YDSD
Sbjct  138  WRDELPSDRTGNFDTIYNFLRENWKIVRWVALGAVVFEALLFLLALMVRAANTPAEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEY+  PRQQIRQP +N RQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  198  DEYLA-PRQQIRQPFIN-RQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  256  NPSESHRFQQMPAQPNEEKGRCTIM  280



>gb|ACU24289.1| unknown [Glycine max]
Length=283

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FD IY FL +NW IVKWVALG V+ EAL+FLLAL+VRAANRPADYDSD
Sbjct  140  WKEEIPTDKTGDFDAIYGFLIENWNIVKWVALGIVIFEALLFLLALIVRAANRPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E I  PRQQ+RQP++N    +P TG+PVAGT+D RP RNDAWS RMREKYGLDTSEFTY
Sbjct  200  EELIN-PRQQVRQPLLNRPAASPATGLPVAGTMDQRPGRNDAWSTRMREKYGLDTSEFTY  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNR+Q  N QP EE+ RCTIM
Sbjct  259  NPSESNRFQQVNSQPTEEKSRCTIM  283



>ref|XP_010275310.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275311.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275312.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275313.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
Length=280

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  +PTD+TG+FDMIYEFLE NWKI KWVALGAVVLEAL+FLLALVVRAANRPADYDSD
Sbjct  138  WKDTLPTDKTGDFDMIYEFLEKNWKIAKWVALGAVVLEALLFLLALVVRAANRPADYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PR  +RQP++ NRQ  P TGVPVA  LD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  198  DEYI-APRSTVRQPLI-NRQGVPATGVPVACALDQRPSRNDAWSTRMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNR+Q   VQPAEER RCTIM
Sbjct  256  NPSESNRFQQGPVQPAEERSRCTIM  280



>gb|EPS67767.1| hypothetical protein M569_07007 [Genlisea aurea]
Length=281

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D+TGNFD IYEFL+DNW+I+KW+ALG V+ EAL+FLLALVVRA NRPADYDSD
Sbjct  138  WKEEIPRDKTGNFDQIYEFLDDNWEIIKWLALGFVIFEALLFLLALVVRAGNRPADYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +EYI  PRQQIRQP++ +R   P  G+PVAGTLD RPSRNDAWS RMREKYGLDT+EFTY
Sbjct  198  EEYITAPRQQIRQPLI-SRPPVPAAGIPVAGTLDQRPSRNDAWSTRMREKYGLDTTEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP + NRYQ +  QPAEER RCTIM
Sbjct  257  NPSDPNRYQQSATQPAEERSRCTIM  281



>ref|XP_004148498.1| PREDICTED: uncharacterized protein LOC101203030 [Cucumis sativus]
 ref|XP_004170668.1| PREDICTED: uncharacterized protein LOC101226567 [Cucumis sativus]
 gb|KGN60424.1| hypothetical protein Csa_3G904130 [Cucumis sativus]
Length=279

 Score =   207 bits (528),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIP DRTGNFD IYE LE  W+I++WVALG ++ EAL+FLLALVVRAANRP DYDSD
Sbjct  137  WRDEIPGDRTGNFDKIYELLESKWEIIRWVALGTIIFEALLFLLALVVRAANRPVDYDSD  196

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PRQQIRQP++N R  AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  197  DEYIA-PRQQIRQPLIN-RPVAPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QPAEE+ RCTIM
Sbjct  255  NPSESHRFQQVAPQPAEEKSRCTIM  279



>ref|XP_008465936.1| PREDICTED: tobamovirus multiplication protein 2A [Cucumis melo]
Length=279

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIP D+TGNFD IYE LE+ WKI++WVALG ++ EAL+FLLALVVRAANRP DYDSD
Sbjct  137  WRDEIPGDKTGNFDKIYELLENKWKIIRWVALGTIIFEALLFLLALVVRAANRPVDYDSD  196

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PRQQIRQP++N R  AP TGVPVAGTLD RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  197  DEYIA-PRQQIRQPLIN-RPVAPATGVPVAGTLDQRPSRNDAWSARMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    Q AEE+ RCTIM
Sbjct  255  NPSESHRFQQVAPQAAEEKSRCTIM  279



>ref|XP_006415200.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
 dbj|BAJ34310.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33553.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
Length=280

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIP+DRTGNFD IY FL +NWKIV+WVALGAVV EAL+FLLAL+VRAAN PA+YDSD
Sbjct  138  WRDEIPSDRTGNFDTIYNFLRENWKIVRWVALGAVVFEALLFLLALMVRAANSPAEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQIRQP + NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  198  DEII-APRQQIRQPFI-NRQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    Q  EE+GRCTIM
Sbjct  256  NPSESHRFQQMPTQQNEEKGRCTIM  280



>ref|XP_009398578.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TGNFD+IY+FLE+NWKI KWVALGAV+LEAL+FLLAL+VRAANRP +YDSD
Sbjct  141  WKHIIPVDKTGNFDVIYDFLEENWKIAKWVALGAVILEALVFLLALIVRAANRPVEYDSD  200

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI      IRQP++ N+Q AP TG+PV+GTLD RPSR+DAWS RMREKYGLDTS+FTY
Sbjct  201  DEYI-AQSSGIRQPLI-NQQGAPATGMPVSGTLDQRPSRHDAWSQRMREKYGLDTSKFTY  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            N  + NR Q +    +EERG C I+
Sbjct  259  NSSDPNRSQQSATPSSEERGGCNIL  283



>ref|XP_003539155.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
 gb|KHN34864.1| hypothetical protein glysoja_004630 [Glycine soja]
Length=283

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK++IPTD+TG FD IY FL +NW I+KWVALG V+ EAL+FLLAL+VRAANRPADYDSD
Sbjct  140  WKEQIPTDKTGEFDAIYGFLIENWNIMKWVALGIVIFEALLFLLALIVRAANRPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I  PRQQ++QP++N     P TG+PVAGT+D RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  200  EEFIN-PRQQVQQPLLNRLPAGPATGIPVAGTIDQRPSRNDAWSTRMREKYGLDTSEFTY  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNR+Q  N QP EE+ RC IM
Sbjct  259  NPSESNRFQQVNSQPTEEKSRCAIM  283



>ref|XP_007209447.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 ref|XP_007209448.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10646.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10647.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
Length=281

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIPTD++G+F+MIY FL+ +W IV+WVALGAVV EAL+FLLALVVRAANRPA+YDSD
Sbjct  138  WEAEIPTDKSGDFEMIYAFLKAHWDIVRWVALGAVVFEALLFLLALVVRAANRPAEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQIRQP++NNR   P TGVPVAG  D RP+RNDAWS RMREKYGLDT+EFTY
Sbjct  198  DELIA-PRQQIRQPLINNRPAVPATGVPVAGASDQRPNRNDAWSTRMREKYGLDTAEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNR+QP   QP EER RC+IM
Sbjct  257  NPSESNRFQPVPAQPQEERSRCSIM  281



>ref|XP_010499788.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Camelina 
sativa]
 ref|XP_010499789.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Camelina 
sativa]
Length=276

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W++EIP+DRTGNF+ IY FL +NW IV+WVALGAVV EAL+FLLAL+VR+AN P +YDSD
Sbjct  134  WREEIPSDRTGNFETIYNFLRENWMIVRWVALGAVVFEALLFLLALMVRSANSPPEYDSD  193

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQQIRQP +N RQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  194  DEFIA-PRQQIRQPFIN-RQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  251

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  252  NPSESHRFQQMPAQPNEEKGRCTIM  276



>ref|XP_009151428.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=279

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIP+DRTGNFD IY FL +NW IV+WVALGAVV EAL+FLLAL+VRAAN PA+YDSD
Sbjct  137  WRDEIPSDRTGNFDTIYNFLRENWNIVRWVALGAVVFEALLFLLALMVRAANTPAEYDSD  196

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PR QIRQP + NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  197  DEFITPPR-QIRQPFI-NRQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  255  NPSESHRFQQMPTQPNEEKGRCTIM  279



>ref|XP_006305495.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38393.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=256

 Score =   204 bits (519),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W++EIP+DRTGNF+ IY FL++NW IV+WVALGAVV EAL+FLLAL+VR+AN P +YDSD
Sbjct  114  WREEIPSDRTGNFETIYNFLQENWMIVRWVALGAVVFEALLFLLALMVRSANSPPEYDSD  173

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQQIRQP +N RQ  PVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  174  DEFIA-PRQQIRQPFIN-RQATPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  231

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  232  NPSESHRFQQMPAQPNEEKGRCTIM  256



>emb|CDY48874.1| BnaA05g35820D [Brassica napus]
Length=344

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIP+DRTGNFD IY FL +NW IV+WVALGAVV EAL+FLLAL+VRAAN PA+YDSD
Sbjct  202  WRDEIPSDRTGNFDTIYNFLRENWNIVRWVALGAVVFEALLFLLALMVRAANTPAEYDSD  261

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PR QIRQP + NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  262  DEFITPPR-QIRQPFI-NRQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  319

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  320  NPSESHRFQQMPTQPNEEKGRCTIM  344



>ref|XP_006305496.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38394.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=280

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W++EIP+DRTGNF+ IY FL++NW IV+WVALGAVV EAL+FLLAL+VR+AN P +YDSD
Sbjct  138  WREEIPSDRTGNFETIYNFLQENWMIVRWVALGAVVFEALLFLLALMVRSANSPPEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQQIRQP +N RQ  PVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  198  DEFIA-PRQQIRQPFIN-RQATPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  256  NPSESHRFQQMPAQPNEEKGRCTIM  280



>ref|XP_007156641.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 ref|XP_007156642.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28635.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28636.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
Length=279

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 122/145 (84%), Gaps = 4/145 (3%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FD IYEFL +NW IV+WVALG VV EAL+FLLAL+VRA N+PADYDSD
Sbjct  139  WKEEIPTDKTGDFDAIYEFLSENWNIVRWVALGIVVFEALLFLLALIVRAVNKPADYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I  PRQQ   P++N    APVTG+PVAGT+D RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  199  EEFIN-PRQQ---PLLNRPAAAPVTGLPVAGTIDQRPSRNDAWSARMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q  N Q  EE+ RCTIM
Sbjct  255  NPSESSRFQQVNSQSTEEKSRCTIM  279



>emb|CDY32286.1| BnaC05g28640D [Brassica napus]
Length=370

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIP+DRTGNFD IY FL +NW IV+WVALGAVV EAL+FLLAL+VRAAN PA+YDSD
Sbjct  228  WRDEIPSDRTGNFDTIYNFLRENWNIVRWVALGAVVFEALLFLLALMVRAANTPAEYDSD  287

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PR QIRQP + NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  288  DEFITPPR-QIRQPFI-NRQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  345

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  346  NPSESHRFQQMPTQPNEEKGRCTIM  370



>ref|XP_008238361.1| PREDICTED: tobamovirus multiplication protein 2A [Prunus mume]
Length=281

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIPTD++G+F+MIY FL+ +W IV+WVALGAVV EAL+FLLALVVRAAN+PA+YDSD
Sbjct  138  WEAEIPTDKSGDFEMIYAFLKAHWDIVRWVALGAVVFEALLFLLALVVRAANKPAEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I  PRQQIRQP++N+R   P TGVPVAG  D RP+RNDAWS RMREKYGLDT+EFTY
Sbjct  198  DELIA-PRQQIRQPLINSRPAVPATGVPVAGASDQRPNRNDAWSTRMREKYGLDTAEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ESNR+QP   QP EER RC+IM
Sbjct  257  NPSESNRFQPVPAQPQEERSRCSIM  281



>ref|XP_010478663.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=281

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W++EIP+DRTGNF+ IY FL +NW IV+WVALGAVV EAL+FLLAL+VR+AN P +YDSD
Sbjct  139  WREEIPSDRTGNFETIYNFLRENWMIVRWVALGAVVFEALLFLLALMVRSANSPPEYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQQIRQP +N RQ  PVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  199  DEFIA-PRQQIRQPFIN-RQATPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  257  NPSESHRFQQMPAQPNEEKGRCTIM  281



>ref|XP_004511769.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004511770.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
 ref|XP_004511771.1| PREDICTED: tetraspanin-20-like isoform X3 [Cicer arietinum]
Length=281

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLLAL+VRA NRP DYDSD
Sbjct  139  WKQEIPTDKTGDFDMIYGFLRENWNIVRWVALGIVIFEALLFLLALIVRAVNRPVDYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE I   RQQ+RQP++N RQ  P TG+PVAGT D RP+RNDAWS RMREKYGLDTSEFTY
Sbjct  199  DELII-QRQQVRQPLIN-RQTGPPTGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES R+Q  N QP EE+ RCTIM
Sbjct  257  NPSESQRFQQVNSQPTEEKSRCTIM  281



>emb|CDX93836.1| BnaA09g24360D [Brassica napus]
Length=281

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ +IP+D+TGNFD IY FL++NW IV+WVALGAVV EAL+FLLAL+VRAAN P +YDSD
Sbjct  139  WRDQIPSDKTGNFDTIYHFLKENWNIVRWVALGAVVFEALLFLLALMVRAANTPDEYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQ IRQP +N RQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  199  DEFIAPPRQ-IRQPFIN-RQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  257  NPSESHRFQQMPTQPNEEKGRCTIM  281



>ref|XP_010677296.1| PREDICTED: tobamovirus multiplication protein 2A [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W  EIPTD+TGNFDMI +FLE++W I KWV LG VVLEA +FLL ++VR+ NRPADYDSD
Sbjct  137  WNDEIPTDKTGNFDMINDFLEEHWSIAKWVLLGIVVLEAALFLLTVIVRSMNRPADYDSD  196

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I   RQ  +QP++N  +  P TGVPVAG +D RPSRNDAWSARMREKYGLDTSEFTY
Sbjct  197  EEFIN-QRQSAKQPLIN--RPPPATGVPVAGAIDQRPSRNDAWSARMREKYGLDTSEFTY  253

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES RYQ    QP  E  RCTIM
Sbjct  254  NPTESGRYQQPAAQPTVEGNRCTIM  278



>ref|XP_010461064.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=280

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W++EIP+DRTGNF+ IY FL +NW IV+WVALGAVV EAL+FLLAL+VR+AN P +YDSD
Sbjct  138  WREEIPSDRTGNFETIYNFLRENWMIVRWVALGAVVFEALLFLLALMVRSANSPPEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQQIRQP +N RQ APVTGVPVA T D RPSR+D WSARMREKYGLDTSEFTY
Sbjct  198  DEFIA-PRQQIRQPFIN-RQAAPVTGVPVAPTSDQRPSRSDPWSARMREKYGLDTSEFTY  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  256  NPSESHRFQQMPAQPNEEKGRCTIM  280



>ref|XP_009114889.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=281

 Score =   202 bits (514),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ +IP+D+TGNFD IY FL++NW IV+WVALGAVV EAL+FLLAL+VRAAN P +YDSD
Sbjct  139  WRDQIPSDKTGNFDTIYHFLKENWNIVRWVALGAVVFEALLFLLALMVRAANTPDEYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQ IRQP +N RQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  199  DEFIAPPRQ-IRQPFIN-RQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  257  NPSESHRFQQMPTQPNEEKGRCTIM  281



>ref|XP_007156640.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
 gb|ESW28634.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
Length=282

 Score =   202 bits (514),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIPTD+TG+FD IYEFL +NW IVKWVALG V+ EAL+FLLAL+VRAANRPA+YDSD
Sbjct  139  WKEEIPTDKTGDFDAIYEFLSENWNIVKWVALGIVIFEALLFLLALIVRAANRPAEYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E+I  PRQQ+RQP++N     P  G+P +GT D R SRNDAWS RMREKYGLDTSEFTY
Sbjct  199  EEFIN-PRQQVRQPLLNRPAAGPSAGLPASGTTDQRSSRNDAWSTRMREKYGLDTSEFTY  257

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q  N Q AEE+ RCTIM
Sbjct  258  NPSESSRFQQVNSQIAEEKSRCTIM  282



>ref|XP_010518876.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
 ref|XP_010518877.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
Length=279

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WKKEIP DRTGNF+MIY+FL+DNWKIVKWVALGAVVLEAL+FLLAL+VRAAN P DYDSD
Sbjct  137  WKKEIPADRTGNFNMIYKFLQDNWKIVKWVALGAVVLEALLFLLALMVRAANAPPDYDSD  196

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            ++ I  PRQQIRQP + NRQ    TGVPVA TLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  197  EDLI-VPRQQIRQPFI-NRQPVAATGVPVAPTLDQRPSRNDAWSTRMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    Q  EER RC +M
Sbjct  255  NPSESHRFQQMPAQQNEERSRCIVM  279



>emb|CDY01278.1| BnaC05g24540D [Brassica napus]
Length=281

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ +IP+D+TGNFD IY FL+ NW IV+WVALGAVV EAL+FLLAL+VRAAN P +YDSD
Sbjct  139  WRDQIPSDKTGNFDTIYHFLKQNWNIVRWVALGAVVFEALLFLLALMVRAANTPDEYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DE+I  PRQ IRQP +N RQ APVTGVPV  TLD RPSR+D WSARMREKYGLDTSEFTY
Sbjct  199  DEFIAPPRQ-IRQPFIN-RQPAPVTGVPVVPTLDQRPSRSDPWSARMREKYGLDTSEFTY  256

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    QP EE+GRCTIM
Sbjct  257  NPSESHRFQQMPTQPNEEKGRCTIM  281



>ref|XP_006847670.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
 gb|ERN09251.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
Length=284

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 115/148 (78%), Gaps = 3/148 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP-ADYDS  403
            WK+ IPTD+TG+FDMIY FL+ +W I KWVALGAV+LEAL FLLALVVRA N P  +YDS
Sbjct  137  WKETIPTDKTGDFDMIYNFLKKHWNIAKWVALGAVILEALTFLLALVVRATNWPQGEYDS  196

Query  402  DDEYIGGPRQQIRQPIMNNRQQA--PVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DDEYI  PR  I QP++ + +QA   VTGVPV+G  D R SRNDAWS R+REKYGLDTSE
Sbjct  197  DDEYIAAPRTGIWQPLIGSNRQAGAQVTGVPVSGASDQRLSRNDAWSTRLREKYGLDTSE  256

Query  228  FTYNPYESNRYQPTNVQPAEERGRCTIM  145
            FTYNP +S+R+Q      AEER RC+I+
Sbjct  257  FTYNPTDSSRFQQQAAPVAEERSRCSIL  284



>ref|XP_010055355.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 gb|KCW71822.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=279

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ E+PTD TG+F MIY+FLE++W IVKWVALG VVLEAL+FLLAL+VRAANRP +YDSD
Sbjct  138  WEDELPTDNTGDFAMIYDFLEEHWSIVKWVALGIVVLEALLFLLALMVRAANRPVEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PRQQIRQP +N  +  P TGVPVAGTLD RP RNDAW+ARMREKYGLDTSEFTY
Sbjct  198  DEYI-APRQQIRQPFIN--RPPPATGVPVAGTLDQRPIRNDAWTARMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    Q AEER RCTIM
Sbjct  255  NPSESSRHQQVPPQNAEERSRCTIM  279



>ref|XP_010919853.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
 ref|XP_010919854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=282

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
            RWK  IP D+TG+FDMIY+FL+ NWKI KWVALGAV+LEAL+FLLAL+VRAAN PADYDS
Sbjct  139  RWKDVIPADKTGDFDMIYDFLKKNWKIAKWVALGAVILEALLFLLALMVRAANTPADYDS  198

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DDEYI  P   IRQP+M +RQ  P TGVPV GTLD RPSRNDAWS RMREKYGLDTSEFT
Sbjct  199  DDEYI-TPASGIRQPLM-HRQGVPATGVPVHGTLDQRPSRNDAWSQRMREKYGLDTSEFT  256

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP + +R+Q  +  P +ERGRCTI+
Sbjct  257  YNPLDPSRHQQASAPPPDERGRCTIL  282



>gb|KCW71821.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=260

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ E+PTD TG+F MIY+FLE++W IVKWVALG VVLEAL+FLLAL+VRAANRP +YDSD
Sbjct  119  WEDELPTDNTGDFAMIYDFLEEHWSIVKWVALGIVVLEALLFLLALMVRAANRPVEYDSD  178

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PRQQIRQP +N  +  P TGVPVAGTLD RP RNDAW+ARMREKYGLDTSEFTY
Sbjct  179  DEYI-APRQQIRQPFIN--RPPPATGVPVAGTLDQRPIRNDAWTARMREKYGLDTSEFTY  235

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES+R+Q    Q AEER RCTIM
Sbjct  236  NPSESSRHQQVPPQNAEERSRCTIM  260



>ref|XP_007156638.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 ref|XP_007156639.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28632.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28633.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
Length=283

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D+TG+FD IY FL +NW IV+WVALG  + +AL+FLLAL+VRAANRPADYDSD
Sbjct  139  WKEEIPKDKTGDFDAIYGFLSENWNIVRWVALGIGIFQALLFLLALIVRAANRPADYDSD  198

Query  399  DEYIGGPRQQIRQPIMNN-RQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            +E+I  PRQQ+RQP++N     +  TG+PV+GT+D RPSR+DAWSARMREKYGLDTSEFT
Sbjct  199  EEFIN-PRQQVRQPLLNRPAAGSTTTGLPVSGTIDQRPSRSDAWSARMREKYGLDTSEFT  257

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP ES+R+Q  N QP EE+ RCTIM
Sbjct  258  YNPSESSRFQQVNSQPTEEKSRCTIM  283



>ref|XP_009345636.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009345644.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=282

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIPTD +G+F MIY FL+ +W IV+WVALGAVV EAL+FLLALVVRAANRPA+YDSD
Sbjct  138  WEDEIPTDSSGDFKMIYAFLKAHWNIVRWVALGAVVFEALLFLLALVVRAANRPAEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXR-PSRNDAWSARMREKYGLDTSEFT  223
            DE I  PRQQIRQP+++NR   P TGVPVAG LD R P+RNDAWS RMREKYGLDT+EFT
Sbjct  198  DELI-APRQQIRQPLISNRPAVPATGVPVAGALDQRTPNRNDAWSTRMREKYGLDTAEFT  256

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP ES+R+Q    QP EER RC +M
Sbjct  257  YNPSESHRFQQVAAQPQEERSRCIVM  282



>ref|XP_008784675.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784676.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784677.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
Length=282

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T +FDMIYEFL++NWKI KWVALGAV+LEAL+FLLAL+VRAAN PADYDSD
Sbjct  140  WKDVIPADKTRDFDMIYEFLKENWKIAKWVALGAVILEALLFLLALIVRAANTPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  P    RQP++ +RQ  P TGVPV GTLD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  200  DEYI-NPGSGFRQPLI-HRQAVPATGVPVPGTLDQRPSRNDAWSQRMREKYGLDTSEFTY  257

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP + +R+Q  +  PA ERGRCTI+
Sbjct  258  NPLDPSRHQQASAPPAAERGRCTIL  282



>ref|XP_010933519.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=283

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TG+FDM+Y FL++NWKI KWV LGAV+LEAL+F LAL+VRAANRPADYDSD
Sbjct  140  WKDLIPADKTGDFDMMYGFLKENWKIAKWVVLGAVILEALLFFLALIVRAANRPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            D+    PR  I+QP++ NRQ  P TGVPV   LD RPSRNDAWS RMREKYGLDTSEFT+
Sbjct  200  DDEYIAPRSGIQQPLI-NRQGVPATGVPVPAILDQRPSRNDAWSQRMREKYGLDTSEFTH  258

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP   +RY   +  PAEERGRCTI+
Sbjct  259  NPSGLSRYHQASAPPAEERGRCTIL  283



>ref|XP_006850026.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
 gb|ERN11607.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
Length=276

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 111/145 (77%), Gaps = 7/145 (5%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+KEIP D+TG+F+MIY FL++NWKI KWVALGAV+LEAL+FLLAL VRAAN P +YDSD
Sbjct  139  WEKEIPNDKTGDFNMIYNFLKENWKIAKWVALGAVILEALVFLLALAVRAANMPPEYDSD  198

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI       RQP++ +R  AP TG+PV    D R +R DAWS RM+EKYGLDTSEFTY
Sbjct  199  DEYIAP-----RQPLI-SRAGAPATGIPV-NIADQRQNRPDAWSTRMKEKYGLDTSEFTY  251

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP ES RY      PAEER RCTIM
Sbjct  252  NPSESGRYTAPAPAPAEERSRCTIM  276



>ref|XP_004983591.1| PREDICTED: tetraspanin-18-like isoform X1 [Setaria italica]
 ref|XP_004983592.1| PREDICTED: tetraspanin-18-like isoform X2 [Setaria italica]
Length=278

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T NFD++Y+FL+DNW+I +WVALG VV EA++FLLALVVRA N+PA+YDSD
Sbjct  135  WKDVIPKDKTHNFDVMYDFLKDNWEIARWVALGVVVFEAVLFLLALVVRAMNKPAEYDSD  194

Query  399  DEYIG-GPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE I  G    +RQP+++  Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FT
Sbjct  195  DEIIAIGRSPTLRQPLIHG-QNVPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFT  252

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP + +RYQ      AEER RCTI+
Sbjct  253  YNPSDPSRYQQNGAPQAEERSRCTIL  278



>ref|XP_010538377.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
 ref|XP_010538378.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
Length=280

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+EIP D+TGNFDMIY FL+DNWKIVKWVALGAVVLEAL+FLLAL+VRAAN P DYDSD
Sbjct  137  WKEEIPADKTGNFDMIYMFLQDNWKIVKWVALGAVVLEALLFLLALMVRAANAPPDYDSD  196

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            D+ I  PRQQIRQP + NRQ    TGVPV   +   PSR+DAWS RMREKYGLDTSEFTY
Sbjct  197  DDII-VPRQQIRQPFL-NRQPVTATGVPVTTAIPQPPSRDDAWSTRMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERG-RCTIM  145
            NP E+NR+Q    Q  +ERG RCTIM
Sbjct  255  NPSEANRFQQMPSQQNDERGSRCTIM  280



>ref|XP_008788693.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Phoenix dactylifera]
Length=202

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 5/145 (3%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TG+FDMIY FL++NWKI KWVALGAV+LEAL FLLAL++RA N+PADYDSD
Sbjct  63   WKDAIPADKTGDFDMIYNFLKENWKIAKWVALGAVILEALAFLLALMIRAVNQPADYDSD  122

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  P+  I QP++ NRQ  P +GVP   +LD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  123  DEYI-APKSAIHQPLI-NRQGLPPSGVP---SLDHRPSRNDAWSQRMREKYGLDTSEFTY  177

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP + +R+Q   V  AEE GRCTI+
Sbjct  178  NPSDPSRFQQATVTSAEESGRCTIL  202



>ref|NP_001150827.1| tetraspanin family protein [Zea mays]
 ref|XP_008678655.1| PREDICTED: tetraspanin family protein isoform X1 [Zea mays]
 gb|ACN27909.1| unknown [Zea mays]
 tpg|DAA46389.1| TPA: tetraspanin family protein isoform 1 [Zea mays]
 tpg|DAA46390.1| TPA: tetraspanin family protein isoform 2 [Zea mays]
Length=279

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T NFD++Y FL+ NW+I +WVALG VV EA++FLLALVVRA N+PA+YDSD
Sbjct  136  WKDVIPVDKTHNFDVMYGFLKKNWEIARWVALGVVVFEAVLFLLALVVRAMNKPAEYDSD  195

Query  399  DEYIG-GPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE I  G    +RQP++ + Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FT
Sbjct  196  DEIIAIGRSPTMRQPLI-HAQNVPATGVPVP-TLDQRSSRNDAWSQRMREKYGLDTSQFT  253

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP + +RYQ      AEER RCTIM
Sbjct  254  YNPSDPSRYQQNGAPQAEERSRCTIM  279



>ref|XP_009371175.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371176.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371177.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=280

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIPTD +G+F+MIY FL+ +W IV+WVALGAVV EAL+FLLALVVRAANRPA+YDSD
Sbjct  138  WEDEIPTDSSGDFEMIYAFLKAHWTIVRWVALGAVVFEALLFLLALVVRAANRPAEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXR-PSRNDAWSARMREKYGLDTSEFT  223
            DE I  PRQQIRQP++ NRQ  P TG PVAG LD R P+RNDAWS RMREKYGL+T+EFT
Sbjct  198  DELI-APRQQIRQPLIANRQAVPATGAPVAGALDQRPPNRNDAWSTRMREKYGLNTAEFT  256

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP ES      + QP EER RC IM
Sbjct  257  YNPSESQ--SQVSAQPQEERSRCIIM  280



>ref|XP_008788690.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788691.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788692.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
Length=279

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 5/145 (3%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TG+FDMIY FL++NWKI KWVALGAV+LEAL FLLAL++RA N+PADYDSD
Sbjct  140  WKDAIPADKTGDFDMIYNFLKENWKIAKWVALGAVILEALAFLLALMIRAVNQPADYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  P+  I QP++ NRQ  P +GVP   +LD RPSRNDAWS RMREKYGLDTSEFTY
Sbjct  200  DEYI-APKSAIHQPLI-NRQGLPPSGVP---SLDHRPSRNDAWSQRMREKYGLDTSEFTY  254

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            NP + +R+Q   V  AEE GRCTI+
Sbjct  255  NPSDPSRFQQATVTSAEESGRCTIL  279



>gb|ACG40574.1| tetraspanin family protein [Zea mays]
Length=279

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T NFD++Y FL+ NW+I +WVALG VV EA++FLLALVVRA N+PA+YDSD
Sbjct  136  WKDVIPVDKTHNFDVMYGFLKKNWEIARWVALGVVVFEAVLFLLALVVRAMNKPAEYDSD  195

Query  399  DEYIG-GPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE I  G    +RQP++ + Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FT
Sbjct  196  DEIIAIGRSPTMRQPLI-HAQNVPATGVPVP-TLDQRSSRNDAWSQRMREKYGLDTSQFT  253

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP + +RYQ      AEER +CTIM
Sbjct  254  YNPSDPSRYQQNGAPQAEERSQCTIM  279



>ref|XP_010934868.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Elaeis 
guineensis]
Length=280

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 6/146 (4%)
 Frame = -1

Query  579  WKKEI-PTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
            WK  I P D+TG+FDMIY FL+ NWKI KWVALGAV+LEAL FLLAL++RA N+P DYDS
Sbjct  140  WKDAIIPADKTGDFDMIYSFLKKNWKIAKWVALGAVILEALAFLLALMIRAVNQPTDYDS  199

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DDEYI  PR+ IRQP++ NRQ  P +GVP   +LD RPSRNDAWS RMREKYGLDTSEFT
Sbjct  200  DDEYI-APRRGIRQPLI-NRQGLPPSGVP---SLDHRPSRNDAWSQRMREKYGLDTSEFT  254

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP + +R+Q   +  AEERGRCTI+
Sbjct  255  YNPSDPSRFQQATITSAEERGRCTIL  280



>ref|XP_009391069.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391140.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391209.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391294.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 107/147 (73%), Gaps = 14/147 (10%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR-AANRPADYDS  403
            WK  IP D+TGNFD IYEFLE+NWKI KWVALGAV+LEAL+F+L+L+VR AANR  +YDS
Sbjct  141  WKDLIPDDKTGNFDTIYEFLENNWKITKWVALGAVILEALVFVLSLMVRAAANRAVEYDS  200

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DDEY       IRQP+M NRQ  P    PV GTLD RPSRNDAWS RMREKYGL+T EF 
Sbjct  201  DDEY-------IRQPLM-NRQGVP----PVLGTLDHRPSRNDAWSQRMREKYGLNTFEFA  248

Query  222  YNPYESNRYQPTNVQPAEERG-RCTIM  145
            Y     +RYQ      AEERG RC I+
Sbjct  249  YKQSNPSRYQQATASQAEERGSRCIIL  275



>dbj|BAK04010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T NFD +Y+FL++NWKI +WVALG V+ + L+FLLALVVRA N+PA+YDSD
Sbjct  142  WKDVIPVDKTQNFDAMYDFLKENWKIARWVALGVVIFQVLLFLLALVVRAMNKPAEYDSD  201

Query  399  DEYIGGPRQ-QIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE IG  R   IRQP++++ Q AP TGVPV  TLD R SRNDAWS RMREKYGLDTS+FT
Sbjct  202  DEIIGTARSTSIRQPLIHS-QNAPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFT  259

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP ++ RYQ     PAEER RCT+M
Sbjct  260  YNPSDATRYQQNGAPPAEERSRCTVM  285



>ref|XP_003573849.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=283

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 113/146 (77%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D T NFD +Y+FLE+NW+I +WVALG VV E L+FLLA+VVRA N+PA+YDSD
Sbjct  140  WKDVIPVDYTRNFDAMYDFLEENWEIARWVALGVVVFEVLLFLLAVVVRALNKPAEYDSD  199

Query  399  DEYIGGPRQ-QIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE IG  R   IRQP++++ Q AP TGVPV  TLD R SRNDAWS RMREKYGLDTS+FT
Sbjct  200  DEIIGTARSTSIRQPLIHS-QNAPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFT  257

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP +S RYQ     PAEER RCTI+
Sbjct  258  YNPSDSARYQQNGAPPAEERNRCTIL  283



>ref|XP_006659267.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=287

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T NFD++Y+FL+DNW+I +WVALG+VV E L+FLLALVVRA N+PA+YDSD
Sbjct  144  WKDVIPVDKTENFDVMYDFLKDNWEIARWVALGSVVFEVLLFLLALVVRAMNKPAEYDSD  203

Query  399  DEYIGGPRQ-QIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE +   R   IRQP++++ Q AP TGVPVA TL+ R SRNDAWS RMREKYGLDTS+FT
Sbjct  204  DEILATSRSTSIRQPLIHS-QNAPATGVPVA-TLEQRASRNDAWSQRMREKYGLDTSQFT  261

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP ++ RYQ     PAEER RC IM
Sbjct  262  YNPSDAGRYQQNGAPPAEERSRCVIM  287



>gb|EMS54049.1| hypothetical protein TRIUR3_29725 [Triticum urartu]
Length=285

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T NFD +Y+FL +NWKI +WVALG VV E L+FLLAL VRA N+PA+YDSD
Sbjct  142  WKDVIPVDKTQNFDAMYDFLNENWKIARWVALGVVVFEVLLFLLALAVRAMNKPAEYDSD  201

Query  399  DEYIGGPRQ-QIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE IG  R   IRQP++++ Q AP TGVPV  TLD R SRNDAWS RMREKYGLDTS+FT
Sbjct  202  DEIIGTARSTSIRQPLIHS-QNAPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFT  259

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP ++ RYQ     PAEER RCT+M
Sbjct  260  YNPSDATRYQQNGAPPAEERSRCTVM  285



>gb|ABK25767.1| unknown [Picea sitchensis]
Length=196

 Score =   172 bits (435),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANR-PADYD  406
            +W+K IPTD+TG FD I +FLE + KIV+WVALG V+L+    +LALVV+AANR P +YD
Sbjct  52   KWEKVIPTDKTGYFDDIKDFLEKHVKIVRWVALGIVILQVFAVILALVVKAANRGPEEYD  111

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
            SDDEY+      +RQP++N RQ A V  V   G+ + R SRNDAWS RMREKYGLDTSEF
Sbjct  112  SDDEYLTTRATSVRQPLIN-RQGAQVAAVSTPGS-EQRTSRNDAWSTRMREKYGLDTSEF  169

Query  225  TYNPYESNRYQPTNVQPAEERGRCTIM  145
            TYNP ++NRY      P EE+ RCTIM
Sbjct  170  TYNPTDANRYAQPAPPPPEEKSRCTIM  196



>gb|ABK22053.1| unknown [Picea sitchensis]
Length=282

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANR-PADYD  406
            +W+K IPTD+TG FD I +FLE + KIV+WVALG V+L+    +LALVV+AANR P +YD
Sbjct  138  KWEKVIPTDKTGYFDDIKDFLEKHVKIVRWVALGIVILQVFAVILALVVKAANRGPEEYD  197

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
            SDDEYI      +RQP++N RQ A V  V   G+ + R SRNDAWS RMREKYGLDTSEF
Sbjct  198  SDDEYIAARSTSVRQPLIN-RQGAQVAAVSTPGS-EQRTSRNDAWSTRMREKYGLDTSEF  255

Query  225  TYNPYESNRYQPTNVQPAEERGRCTIM  145
            TYNP ++NRY      P EE+ RCTIM
Sbjct  256  TYNPTDANRYAQPAPPPPEEKSRCTIM  282



>gb|KDO40488.1| hypothetical protein CISIN_1g033708mg [Citrus sinensis]
Length=113

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = -1

Query  471  LEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXR  292
            L+AL+FLLA++VRAANRP +YDSDDE I  PRQQIRQP++N R   P TGVPVAG+LD R
Sbjct  7    LQALIFLLAIIVRAANRPVEYDSDDELIA-PRQQIRQPLIN-RPTPPATGVPVAGSLDQR  64

Query  291  PSRNDAWSARMREKYGLDTSEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
            PSRNDAWS RMREKYGLDTSEFTYNP ES+R+Q    QPAEER RCTIM
Sbjct  65   PSRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVATQPAEERSRCTIM  113



>ref|NP_001061444.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAC99958.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF23358.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAG95056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T NFD++Y+FL++NW+I +WVALG+V+ E L+FLLALVVRA N+PA+YDSD
Sbjct  141  WKDVIPVDKTENFDVMYDFLKENWEIARWVALGSVIFEVLLFLLALVVRAMNKPAEYDSD  200

Query  399  DEYIGGPRQ-QIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE I   R   IRQP++++ Q  P TGVPVA TL+ R SRNDAWS RMREKYGLDTS+FT
Sbjct  201  DEIIATSRSTSIRQPLIHS-QNVPATGVPVA-TLEQRASRNDAWSQRMREKYGLDTSQFT  258

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP + +RYQ     PAEER RC I+
Sbjct  259  YNPSDPSRYQQNGAPPAEERNRCVIL  284



>gb|KCW77897.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=188

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ ++PTD TG+FDMIY+FL+++W IV+WVALG VVLEAL+FLLAL+VRAANRPA+YDSD
Sbjct  42   WEDDLPTDATGDFDMIYDFLKEHWTIVRWVALGVVVLEALVFLLALLVRAANRPAEYDSD  101

Query  399  DEYIGGPRQQIRQPIMNN---RQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DE I  P+QQIR+P+++        P  GV  AG LD RPSRNDAWS RMREKYGLDT+E
Sbjct  102  DELI-APQQQIRRPLLSRPPPPPPQPAAGVAAAGALDQRPSRNDAWSTRMREKYGLDTAE  160

Query  228  FTYNPYESNRYQPTNVQPAEERGRCTIM  145
            F+YNP ESNR+Q    QP EER RC+IM
Sbjct  161  FSYNPNESNRFQQGPTQPTEERSRCSIM  188



>gb|KCW77895.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
 gb|KCW77896.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=204

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ ++PTD TG+FDMIY+FL+++W IV+WVALG VVLEAL+FLLAL+VRAANRPA+YDSD
Sbjct  58   WEDDLPTDATGDFDMIYDFLKEHWTIVRWVALGVVVLEALVFLLALLVRAANRPAEYDSD  117

Query  399  DEYIGGPRQQIRQPIMN---NRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DE I  P+QQIR+P+++        P  GV  AG LD RPSRNDAWS RMREKYGLDT+E
Sbjct  118  DELI-APQQQIRRPLLSRPPPPPPQPAAGVAAAGALDQRPSRNDAWSTRMREKYGLDTAE  176

Query  228  FTYNPYESNRYQPTNVQPAEERGRCTIM  145
            F+YNP ESNR+Q    QP EER RC+IM
Sbjct  177  FSYNPNESNRFQQGPTQPTEERSRCSIM  204



>ref|NP_001146619.1| hypothetical protein [Zea mays]
 gb|ACF86508.1| unknown [Zea mays]
 gb|ACR38384.1| unknown [Zea mays]
 gb|AFW87797.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=279

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+T NFD++Y+FL++NW+I +WVALG VV EA++ LLAL VRA N+PA+YDSD
Sbjct  136  WKDVIPVDKTHNFDVMYDFLKENWEIARWVALGVVVFEAVLLLLALAVRAMNKPAEYDSD  195

Query  399  DEYIG-GPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            DE I  G    IRQP+++  Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FT
Sbjct  196  DEIIAIGRSPTIRQPLIHT-QNVPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFT  253

Query  222  YNPYESNRYQPTNVQPAEERGRCTIM  145
            YNP + +RYQ      AEER RCTIM
Sbjct  254  YNPSDPSRYQQNGTPRAEERSRCTIM  279



>ref|XP_004300273.1| PREDICTED: tobamovirus multiplication protein 2A [Fragaria vesca 
subsp. vesca]
Length=271

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 105/145 (72%), Gaps = 11/145 (8%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ EIPTD TG+F+MIY+FLE +W IVKWV LGAV+ EAL+FLLAL VRA NRP +YDSD
Sbjct  138  WETEIPTDATGDFEMIYDFLEAHWSIVKWVVLGAVIFEALIFLLALGVRAVNRPVEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            +E           P++N     P TGVPVAG  + RP+RNDAWS RMREKYGLDTS + Y
Sbjct  198  EE-----------PLINRPPPVPATGVPVAGAGNQRPTRNDAWSTRMREKYGLDTSLYPY  246

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
            +P +S+R Q    QP EER RC+IM
Sbjct  247  DPSDSSRLQQPQAQPQEERSRCSIM  271



>ref|XP_010053569.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053570.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053571.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
Length=284

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ ++PTD TG+FDMIY+FL+++W IV+WVALG VVLEAL+FLLAL+VRAANRPA+YDSD
Sbjct  138  WEDDLPTDATGDFDMIYDFLKEHWTIVRWVALGVVVLEALVFLLALLVRAANRPAEYDSD  197

Query  399  DEYIGGPRQQIRQPIMN---NRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DE I  P+QQIR+P+++        P  GV  AG LD RPSRNDAWS RMREKYGLDT+E
Sbjct  198  DELI-APQQQIRRPLLSRPPPPPPQPAAGVAAAGALDQRPSRNDAWSTRMREKYGLDTAE  256

Query  228  FTYNPYESNRYQPTNVQPAEERGRCTIM  145
            F+YNP ESNR+Q    QP EER RC+IM
Sbjct  257  FSYNPNESNRFQQGPTQPTEERSRCSIM  284



>ref|XP_004972786.1| PREDICTED: tetraspanin-20-like isoform X2 [Setaria italica]
Length=278

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 107/145 (74%), Gaps = 12/145 (8%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+ IP D+TGNFDM+Y FL++NW+I KWVALGAV+ EAL+F +A++V++ N+ ADYDSD
Sbjct  146  WKEVIPVDKTGNFDMMYSFLKENWRIAKWVALGAVIFEALLFTVAIIVQSGNQ-ADYDSD  204

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PR  IRQP++N +Q A    VP    LD RP RNDAWS RMREKYG+D+     
Sbjct  205  DEYI-VPRSGIRQPLVNQQQGAADPRVP---NLDYRPIRNDAWSQRMREKYGVDS-----  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
              ++ NR+Q   + PAE+R RCTI+
Sbjct  256  --FDPNRFQQATISPAEQRNRCTIL  278



>gb|AAD09513.1| GMFP4, partial [Glycine max]
Length=111

 Score =   160 bits (406),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = -1

Query  471  LEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXR  292
            L+AL+F+LAL+VRAANRP +YDSD+EYI  PRQQ RQP +N R   PV+G P  GTLD R
Sbjct  5    LQALLFVLALIVRAANRPTEYDSDEEYIN-PRQQARQPFLN-RPAGPVSGAPATGTLDQR  62

Query  291  PSRNDAWSARMREKYGLDTSEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
            PSRNDAWS RMREKYGLDTSEFTYNP ES+RYQ  N QP EE  RC IM
Sbjct  63   PSRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQPTEEGSRCAIM  111



>ref|XP_002443902.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
 gb|EES13397.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
Length=274

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 106/145 (73%), Gaps = 12/145 (8%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+ IP D+TGNFDM+Y FL++NW+I KWVALGAVV EAL+F +A++V++ N+ ADYDSD
Sbjct  142  WKEVIPVDKTGNFDMMYSFLKENWRIAKWVALGAVVFEALLFTVAIIVQSGNQ-ADYDSD  200

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI G R  IRQP++N  QQA  T  P    LD RP RNDAWS RMREKYG+D+     
Sbjct  201  DEYI-GARSGIRQPLVN--QQAAATD-PRVPNLDYRPIRNDAWSQRMREKYGVDS-----  251

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
              ++ NR+Q   + P E+R RCTI+
Sbjct  252  --FDPNRFQQATISPGEQRNRCTIL  274



>gb|ACN35034.1| unknown [Zea mays]
 gb|AFW61169.1| hypothetical protein ZEAMMB73_111506 [Zea mays]
Length=275

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 10/145 (7%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+ IP D+TGNFDM+Y FL++NW+I KWVALGAVV EAL+F +A++V++ N+  DYDSD
Sbjct  141  WKEVIPVDKTGNFDMMYSFLKENWRIAKWVALGAVVFEALLFTVAIIVQSGNQ-TDYDSD  199

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYIG  R  IRQP++ N+Q A     P    LD RP RNDAWS RMREKYG+D+     
Sbjct  200  DEYIGA-RSGIRQPLV-NQQAAAAAADPRVPNLDYRPIRNDAWSQRMREKYGVDS-----  252

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
              ++ NR+QP  + P E+R RCTI+
Sbjct  253  --FDPNRFQPATISPGEQRNRCTIL  275



>ref|XP_006659854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=250

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%), Gaps = 13/145 (9%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TGNFDM+Y FL+DNW+I KWVALGAV+ EA++F +A++V++ N+ ADYDSD
Sbjct  119  WKDVIPVDKTGNFDMMYSFLKDNWRIAKWVALGAVLYEAVLFTVAIIVQSGNQ-ADYDSD  177

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PR   RQP++N +  A     P    LD RP RNDAWS RMREKYG+DT     
Sbjct  178  DEYI-VPRSSTRQPLVNKQPVAD----PRVPNLDYRPIRNDAWSQRMREKYGVDT-----  227

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
              ++ NR+Q   + PAE+R RCTI+
Sbjct  228  --FDPNRFQQATISPAEQRSRCTIL  250



>ref|XP_003573463.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=278

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 102/145 (70%), Gaps = 13/145 (9%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TGNFDMIY FL++NW+I KWVALG+VV EAL+F +AL+V++  +  DYDSD
Sbjct  147  WKNVIPVDKTGNFDMIYSFLKENWRIAKWVALGSVVFEALLFTVALIVQSGIQD-DYDSD  205

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI G R  +RQP++N +  A     P    LD RP RNDAWS RMR+KYG+DT     
Sbjct  206  DEYI-GARSGVRQPLVNKQAAAD----PRVPNLDYRPIRNDAWSQRMRDKYGVDT-----  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
              ++ NR+Q   + PAE+R RCTI+
Sbjct  256  --FDPNRFQQATISPAEQRSRCTIL  278



>ref|NP_001061041.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAC99658.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF22955.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAG92210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91640.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68082.1| hypothetical protein OsJ_26119 [Oryza sativa Japonica Group]
Length=278

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 102/145 (70%), Gaps = 13/145 (9%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TGNFDM+Y FL++NW+I KWVALGAV+ EA++F +AL+V++ N+ ADYDSD
Sbjct  147  WKDVIPVDKTGNFDMMYSFLKENWRIAKWVALGAVLFEAVLFTVALIVQSGNQ-ADYDSD  205

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PR   RQP++N +  A     P    LD RP RNDAWS RMREKYG+DT     
Sbjct  206  DEYI-APRSSTRQPLVNKQPVAD----PRVPNLDYRPIRNDAWSQRMREKYGVDT-----  255

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
              ++ NR+Q   + PAE+R RC I+
Sbjct  256  --FDPNRFQQATISPAEQRNRCAIL  278



>gb|EEC82932.1| hypothetical protein OsI_27894 [Oryza sativa Indica Group]
Length=305

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 102/145 (70%), Gaps = 13/145 (9%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK  IP D+TGNFDM+Y FL++NW+I KWVALGAV+ EA++F +AL+V++ N+ ADYDSD
Sbjct  174  WKDVIPVDKTGNFDMMYSFLKENWRIAKWVALGAVLFEAVLFTVALIVQSGNQ-ADYDSD  232

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTY  220
            DEYI  PR   RQP++N +  A     P    LD RP RNDAWS RMREKYG+DT     
Sbjct  233  DEYI-APRSSTRQPLVNKQPVAD----PRVPNLDYRPIRNDAWSQRMREKYGVDT-----  282

Query  219  NPYESNRYQPTNVQPAEERGRCTIM  145
              ++ NR+Q   + PAE+R RC I+
Sbjct  283  --FDPNRFQQATISPAEQRNRCAIL  305



>gb|AGW24511.1| hypothetical protein, partial [Avicennia marina var. marina]
Length=91

 Score =   152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = -1

Query  465  ALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPS  286
            AL+FLLAL+VRAAN+PADYDSD+EYIGGPRQQIRQP++N R  AP TG PV GTLD RPS
Sbjct  1    ALLFLLALIVRAANKPADYDSDEEYIGGPRQQIRQPLIN-RPAAPTTGGPVVGTLDQRPS  59

Query  285  RNDAWSARMREKYGLDTSEFTYNPYESNR  199
            RNDAWS RMREKYGLDTSEFTY+P ESNR
Sbjct  60   RNDAWSQRMREKYGLDTSEFTYSPSESNR  88



>dbj|BAD94952.1| hypothetical protein [Arabidopsis thaliana]
Length=95

 Score =   149 bits (376),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = -1

Query  435  RAANRPADYDSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMR  256
            RAAN PA+YDSDDEY+  PRQQIRQP +N RQ APVTGVPVA TLD RPSR+D WSARMR
Sbjct  1    RAANTPAEYDSDDEYLA-PRQQIRQPFIN-RQAAPVTGVPVAPTLDQRPSRSDPWSARMR  58

Query  255  EKYGLDTSEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
            EKYGLDTSEFTYNP ES+R+Q    QP EE+GRCTIM
Sbjct  59   EKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  95



>gb|ACL54399.1| unknown [Zea mays]
 gb|AFW87793.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
 gb|AFW87794.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=129

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 99/131 (76%), Gaps = 3/131 (2%)
 Frame = -1

Query  534  IYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYIG-GPRQQIRQP  358
            +Y+FL++NW+I +WVALG VV EA++ LLAL VRA N+PA+YDSDDE I  G    IRQP
Sbjct  1    MYDFLKENWEIARWVALGVVVFEAVLLLLALAVRAMNKPAEYDSDDEIIAIGRSPTIRQP  60

Query  357  IMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFTYNPYESNRYQPTNVQ  178
            +++  Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNP + +RYQ     
Sbjct  61   LIHT-QNVPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTP  118

Query  177  PAEERGRCTIM  145
             AEER RCTIM
Sbjct  119  RAEERSRCTIM  129



>gb|KCW71823.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=251

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 3/110 (3%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+ E+PTD TG+F MIY+FLE++W IVKWVALG VVLEAL+FLLAL+VRAANRP +YDSD
Sbjct  138  WEDELPTDNTGDFAMIYDFLEEHWSIVKWVALGIVVLEALLFLLALMVRAANRPVEYDSD  197

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEYI  PRQQIRQP +N  +  P TGVPVAGTLD RP RNDAW+ARMREK
Sbjct  198  DEYI-APRQQIRQPFIN--RPPPATGVPVAGTLDQRPIRNDAWTARMREK  244



>ref|XP_008354195.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=111

 Score =   144 bits (362),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = -1

Query  435  RAANRPADYDSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXR-PSRNDAWSARM  259
            RAANRPA+YDSDDE I  PRQQIRQP+++NR   P TGVPVAG LD R P+RNDAWS RM
Sbjct  15   RAANRPAEYDSDDELIA-PRQQIRQPLISNRPAVPATGVPVAGALDQRTPNRNDAWSTRM  73

Query  258  REKYGLDTSEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
            REKYGLDT+EFTYNP ES+R+Q    QP EER RC +M
Sbjct  74   REKYGLDTAEFTYNPSESHRFQQVAAQPQEERSRCIVM  111



>ref|XP_008373605.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=109

 Score =   140 bits (354),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = -1

Query  435  RAANRPADYDSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRP-SRNDAWSARM  259
            RAANRPA+YDSDDE I  PRQQIRQP++ NRQ  P TG PVAGTLD RP SRNDAWS RM
Sbjct  15   RAANRPAEYDSDDELIA-PRQQIRQPLIANRQAVPATGAPVAGTLDQRPPSRNDAWSTRM  73

Query  258  REKYGLDTSEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
            REKYGLDT+EFTYNP ES R    + QP EER RC IM
Sbjct  74   REKYGLDTAEFTYNPSESQRQ--VSAQPQEERSRCIIM  109



>ref|XP_004972785.1| PREDICTED: tetraspanin-20-like isoform X1 [Setaria italica]
Length=332

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 5/110 (5%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK+ IP D+TGNFDM+Y FL++NW+I KWVALGAV+ EAL+F +A++V++ N+ ADYDSD
Sbjct  146  WKEVIPVDKTGNFDMMYSFLKENWRIAKWVALGAVIFEALLFTVAIIVQSGNQ-ADYDSD  204

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEYI  PR  IRQP++N +Q A    VP    LD RP RNDAWS RMREK
Sbjct  205  DEYI-VPRSGIRQPLVNQQQGAADPRVP---NLDYRPIRNDAWSQRMREK  250



>ref|XP_002972323.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
 gb|EFJ26409.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
Length=282

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 91/147 (62%), Gaps = 7/147 (5%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--YD  406
            W+K +P D TG FD I  F++ N+ I KWVALG ++LEAL   LA+V+R+    A   YD
Sbjct  141  WEKAVPEDPTGEFDRIAHFIKRNFAICKWVALGVIILEALSLFLAIVLRSVALGAQRGYD  200

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
            SDD+    P +  RQP++N RQ       P A   + RP RNDAWS RMREKYGLDT+EF
Sbjct  201  SDDDM---PVRNTRQPLLN-RQATQSNATPSAPA-ESRPPRNDAWSTRMREKYGLDTAEF  255

Query  225  TYNPYESNRYQPTNVQPAEERGRCTIM  145
            TYNP +S R    N  P E +  C IM
Sbjct  256  TYNPVDSKRVPAQNQPPPEPKRGCVIM  282



>ref|XP_010934869.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Elaeis 
guineensis]
Length=267

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 6/114 (5%)
 Frame = -1

Query  579  WKKEI-PTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
            WK  I P D+TG+FDMIY FL+ NWKI KWVALGAV+LEAL FLLAL++RA N+P DYDS
Sbjct  140  WKDAIIPADKTGDFDMIYSFLKKNWKIAKWVALGAVILEALAFLLALMIRAVNQPTDYDS  199

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGL  241
            DDEYI  PR+ IRQP++ NRQ  P +GVP   +LD RPSRNDAWS RMRE   L
Sbjct  200  DDEYI-APRRGIRQPLI-NRQGLPPSGVP---SLDHRPSRNDAWSQRMRESMVL  248



>gb|EMT27731.1| hypothetical protein F775_29713 [Aegilops tauschii]
Length=281

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 96/146 (66%), Gaps = 14/146 (10%)
 Frame = -1

Query  567  IPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYI  388
            IP D+TGNFDMIY FL++NW+  KWVALGAVV EAL+F +AL+V++ N+  DYDSDDEYI
Sbjct  35   IPVDKTGNFDMIYSFLKENWRTAKWVALGAVVFEALLFTVALIVQSGNQD-DYDSDDEYI  93

Query  387  GGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKY--GLDTSEFT---  223
             GPR  +RQP++ N+Q A    VP    LD RP RNDAWS RMR+K   G D S  T   
Sbjct  94   -GPRSGVRQPLV-NKQTATDPRVP---NLDYRPIRNDAWSQRMRDKVSTGDDISRRTKKQ  148

Query  222  -YNPYESNRYQPTNVQPAEERGRCTI  148
             +NP    R   ++V  +E    C I
Sbjct  149  MHNPLMLGRC--SSVPVSEFTASCAI  172



>ref|XP_001775831.1| predicted protein [Physcomitrella patens]
 gb|EDQ59370.1| predicted protein [Physcomitrella patens]
Length=297

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 87/148 (59%), Gaps = 4/148 (3%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--Y  409
             W+++IP D TG  D I  F+ DN  I KWV+LG V+LE L    A ++RA +  A   Y
Sbjct  152  HWREDIPEDPTGELDKIQNFVLDNLDICKWVSLGVVILEVLGLFFAFILRAISSNARRYY  211

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSDD+Y+  PR   R+P+ + +   P          + RP R+DAWS RMREKYGLDT+E
Sbjct  212  DSDDDYMA-PRSAPRRPVADRQANQPPLAAGSGAATETRP-RSDAWSIRMREKYGLDTTE  269

Query  228  FTYNPYESNRYQPTNVQPAEERGRCTIM  145
            FT NP ES R         E++ RCTIM
Sbjct  270  FTSNPSESMRLSNQTPAAEEQQSRCTIM  297



>gb|EAZ06370.1| hypothetical protein OsI_28599 [Oryza sativa Indica Group]
 gb|EAZ42170.1| hypothetical protein OsJ_26734 [Oryza sativa Japonica Group]
Length=134

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = -1

Query  435  RAANRPADYDSDDEYIGGPRQ-QIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARM  259
            RA N+PA+YDSDDE I   R   IRQP++++ Q  P TGVPVA TL+ R SRNDAWS RM
Sbjct  39   RAMNKPAEYDSDDEIIATSRSTSIRQPLIHS-QNVPATGVPVA-TLEQRASRNDAWSQRM  96

Query  258  REKYGLDTSEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
            REKYGLDTS+FTYNP + +RYQ     PAEER RC I+
Sbjct  97   REKYGLDTSQFTYNPSDPSRYQQNGAPPAEERNRCVIL  134



>gb|AFW87792.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=113

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 71/98 (72%), Gaps = 3/98 (3%)
 Frame = -1

Query  435  RAANRPADYDSDDEYIG-GPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARM  259
            RA N+PA+YDSDDE I  G    IRQP+++  Q  P TGVPV  TLD R SRNDAWS RM
Sbjct  18   RAMNKPAEYDSDDEIIAIGRSPTIRQPLIHT-QNVPATGVPVP-TLDQRASRNDAWSQRM  75

Query  258  REKYGLDTSEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
            REKYGLDTS+FTYNP + +RYQ      AEER RCTIM
Sbjct  76   REKYGLDTSQFTYNPSDPSRYQQNGTPRAEERSRCTIM  113



>ref|XP_001762411.1| predicted protein [Physcomitrella patens]
 gb|EDQ72878.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 87/148 (59%), Gaps = 3/148 (2%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPA--DY  409
             W+++IP D TG  D + EF+ +N  I KWV+LG VVLEAL    A ++R+ +  A  DY
Sbjct  152  HWREDIPEDPTGELDKVQEFVLNNLDICKWVSLGVVVLEALGLFFAFILRSISSSARRDY  211

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++Y+   R   R+P+++ +   P          + RP R+DAWS RMREKYGLDT+E
Sbjct  212  DSDEDYMVA-RSAPRRPVVDRQANQPPPASGSGAATEARPPRSDAWSTRMREKYGLDTTE  270

Query  228  FTYNPYESNRYQPTNVQPAEERGRCTIM  145
            F+ N  +  R         E++ RC IM
Sbjct  271  FSSNSPDMRRLPNQTPGAEEQQSRCIIM  298



>gb|EMS68191.1| hypothetical protein TRIUR3_27411 [Triticum urartu]
Length=150

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 83/132 (63%), Gaps = 14/132 (11%)
 Frame = -1

Query  525  FLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPIMNN  346
            FL++NW+  KWVALGAVV EAL+F +AL+V++ N+  DYDSDDEYI GPR  +RQP++ N
Sbjct  22   FLKENWRTAKWVALGAVVFEALLFTVALIVQSGNQD-DYDSDDEYI-GPRSGVRQPLV-N  78

Query  345  RQQAPVTGVPVAGTLDXRPSRNDAWSARMREKY--GLDTSEFT----YNPYESNRYQPTN  184
            +Q A    VP    LD RP RNDAWS RMR+K   G D S  T    +NP    R    +
Sbjct  79   KQTATDPRVP---NLDYRPIRNDAWSQRMRDKVSTGHDISRRTKKQMHNPLMLGRCN--S  133

Query  183  VQPAEERGRCTI  148
            V  +E    C I
Sbjct  134  VLVSEFTASCAI  145



>gb|ADE76479.1| unknown [Picea sitchensis]
Length=312

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 81/147 (55%), Gaps = 12/147 (8%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADYD  406
            W+K+IP D TG F+   EF+E N  I KWVAL  V+++A   LLA ++RA  + R  DYD
Sbjct  176  WEKDIPNDPTGEFENTKEFIEHNIDICKWVALTVVIIQAFSLLLATILRAMVSTRRPDYD  235

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
            SDD      R    QP+++   + P +G PV G    R    DAWS RMREKY L+ +EF
Sbjct  236  SDDGDYISSRGTSHQPLLSQGSETP-SG-PVTG--KNRSKSRDAWSKRMREKYALNPNEF  291

Query  225  TYNPYESNRYQPTNVQPAEERGRCTIM  145
            T++  E N   P          RC IM
Sbjct  292  TFSSTEPNITDPNT------ESRCAIM  312



>ref|XP_004966578.1| PREDICTED: tetraspanin-18-like [Setaria italica]
Length=251

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 81/133 (61%), Gaps = 11/133 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W +++P DRTG    +  F+ +N  + KWVAL     +AL   LA+++RA  + R  DY
Sbjct  127  HWIQDLPDDRTGELHNLLSFIHNNLDLCKWVALAIFATQALSLFLAMILRAMLSARTMDY  186

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P++    QAP   +P   T+D R  R D WS+RMR+KYGL+TS+
Sbjct  187  DSDEDFV-----VIRRPLL--VAQAPPPYLPT--TVDTRGFRPDLWSSRMRQKYGLNTSD  237

Query  228  FTYNPYESNRYQP  190
            +TYN  ++N   P
Sbjct  238  YTYNTVDANAAPP  250



>ref|XP_002437655.1| hypothetical protein SORBIDRAFT_10g031310 [Sorghum bicolor]
 gb|EER89022.1| hypothetical protein SORBIDRAFT_10g031310 [Sorghum bicolor]
Length=251

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 80/132 (61%), Gaps = 11/132 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W +++P DRTG    +  F+ +N  + KW AL     +AL  LLA+++RA  + R  DY
Sbjct  127  HWVQDLPEDRTGELHNLLSFIHNNLDLCKWAALAIFATQALSLLLAMILRAMLSARIVDY  186

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P++    QAP   +P   T+D R +R D WS+ +R KYGL+TS+
Sbjct  187  DSDEDFV-----VIRRPLLVT--QAPAPYLPT--TVDARGARPDLWSSTLRHKYGLNTSD  237

Query  228  FTYNPYESNRYQ  193
            +TYN  ++N  Q
Sbjct  238  YTYNTMDANAAQ  249



>ref|XP_006854320.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
 gb|ERN15787.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
Length=313

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 12/149 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPADY  409
             W K++P D TG FD +  F+EDN +I +WV L  + ++  +L+  L L    + R  DY
Sbjct  174  HWDKDLPYDPTGEFDTLKSFVEDNIEICQWVGLTLICIQALSLLLALILRAMVSTRWVDY  233

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSDD+Y G  R   +QP +N   Q       ++G  D +  R DAWSARMREKYGL+ +E
Sbjct  234  DSDDDY-GVGRINYQQPFLN--HQGGQNSTLISG--DIKNIRTDAWSARMREKYGLNPNE  288

Query  228  FTYNPYESNRYQPTNVQPAEE-RGRCTIM  145
            F YN  E++    T ++  EE +GRC IM
Sbjct  289  FAYNSIEAS----TGMRNGEENQGRCIIM  313



>ref|XP_009388438.1| PREDICTED: tetraspanin-20-like [Musa acuminata subsp. malaccensis]
Length=234

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 77/133 (58%), Gaps = 11/133 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADY  409
             W++++P D TG    +  F+EDN    KWVALG ++++AL  LLA+V+RA   +R  +Y
Sbjct  111  HWEEDLPYDSTGELKRVRTFIEDNMDTCKWVALGVIIIQALSLLLAMVLRAMIPSRRMEY  170

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P++N +   P T      ++D +   +D W +RMR KYGL+  E
Sbjct  171  DSDEDFV-----VIRRPLLNPQGGPPYT----TNSIDNKGLHSDIWGSRMRHKYGLNQGE  221

Query  228  FTYNPYESNRYQP  190
             T N  +     P
Sbjct  222  LTCNTVDPATQCP  234



>dbj|BAD62494.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG99901.1| unnamed protein product [Oryza sativa Japonica Group]
Length=141

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 11/133 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W +++P DRTG  D +  F++ N  + KW AL  V  +AL  LLA ++R+  +   ADY
Sbjct  17   HWIQDLPYDRTGELDNLLSFIQTNLDLCKWAALAIVATQALSLLLATILRSMLSTPSADY  76

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P++   Q AP     +  T D R    D WS+RMR KYGL++S 
Sbjct  77   DSDEDFV-----VIRRPLL-VAQGAPAY---LPTTADTRGFHPDLWSSRMRHKYGLNSSN  127

Query  228  FTYNPYESNRYQP  190
            +TYN  + N   P
Sbjct  128  YTYNTLDPNAPPP  140



>ref|NP_001058664.1| Os06g0731400 [Oryza sativa Japonica Group]
 dbj|BAD62493.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF20578.1| Os06g0731400 [Oryza sativa Japonica Group]
 dbj|BAG89447.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66406.1| hypothetical protein OsJ_22750 [Oryza sativa Japonica Group]
Length=242

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 11/129 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W +++P DRTG  D +  F++ N  + KW AL  V  +AL  LLA ++R+  +   ADY
Sbjct  118  HWIQDLPYDRTGELDNLLSFIQTNLDLCKWAALAIVATQALSLLLATILRSMLSTPSADY  177

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P++   Q AP     +  T D R    D WS+RMR KYGL++S 
Sbjct  178  DSDEDFV-----VIRRPLL-VAQGAPAY---LPTTADTRGFHPDLWSSRMRHKYGLNSSN  228

Query  228  FTYNPYESN  202
            +TYN  + N
Sbjct  229  YTYNTLDPN  237



>ref|XP_010936082.1| PREDICTED: tetraspanin-20-like [Elaeis guineensis]
Length=248

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 85/148 (57%), Gaps = 13/148 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADY  409
             W++ +P D T        F+++N  I KWVA+  +V++AL  LLA+++RA    R  DY
Sbjct  112  HWEENLPYDSTEELKRFCAFIKENMDICKWVAVTVIVIQALSLLLAMILRAMVPARRVDY  171

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P+++ +  +      V G    +   +D WS++MR+KYGL+ SE
Sbjct  172  DSDEDFV-----VIRRPLLDPQGGSSYASTSVGG----KGFHSDFWSSQMRQKYGLNQSE  222

Query  228  FTYNPYESNRYQPTNVQPAEERGRCTIM  145
            F+YN  +     P+    ++ R +C+I+
Sbjct  223  FSYNGVDQK--APSANGNSDNRKQCSIL  248



>gb|EEC81360.1| hypothetical protein OsI_24555 [Oryza sativa Indica Group]
Length=242

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 11/129 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W +++P DRTG  D +  F++ N  + KW AL  V  +AL  LLA ++R+  +   ADY
Sbjct  118  HWIQDLPYDRTGELDNLLSFIQTNLDLCKWAALAIVATQALSLLLATILRSMLSTPSADY  177

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P++   Q AP     +  T D R    D WS+RMR KYGL++S 
Sbjct  178  DSDEDFV-----VIRRPLL-VAQGAPAY---LPTTADTRGFHPDLWSSRMRHKYGLNSSN  228

Query  228  FTYNPYESN  202
            +TYN  + N
Sbjct  229  YTYNTLDPN  237



>ref|XP_003563209.1| PREDICTED: tetraspanin-18-like isoform X1 [Brachypodium distachyon]
Length=241

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            +W +++P DRTG  + +  F+++N  + KW A+  +  +AL   LA+V+RA  +    DY
Sbjct  117  QWIQDLPYDRTGELNNLVSFVQNNLDVCKWAAIATLATQALSLFLAMVLRAMVSTTNVDY  176

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P++   Q AP     +  T D      D WS+RMR+KYGL++S+
Sbjct  177  DSDEDFV-----VIRRPLL-LAQGAPAY---LPTTTDATGVHPDLWSSRMRQKYGLNSSD  227

Query  228  FTYNPYESNRYQP  190
            +TYN  + N   P
Sbjct  228  YTYNTLDQNAVPP  240



>gb|ACJ84998.1| unknown [Medicago truncatula]
Length=249

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            +W++++P D TG    I  F+EDN  I +WV +  +V++AL  L+AL++RA  + R AD+
Sbjct  130  QWQEDLPVDPTGQLASIRSFIEDNQDISRWVGIAVLVVQALSLLVALILRATVSTRRADF  189

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D ++EY    R + R+P++N+ Q    +G+      D R + +D WS+RMREKYGL+  +
Sbjct  190  DDEEEY--DVRGRSREPLLNH-QSGQTSGISKG---DIRGNLSDVWSSRMREKYGLNNGD  243



>gb|KEH42419.1| tetraspanin family protein [Medicago truncatula]
Length=249

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            +W++++P D TG    I  F+EDN  I +WV +  +V++AL  L+AL++RA  + R AD+
Sbjct  130  QWQEDLPVDPTGQLASIRSFIEDNQDISRWVGIAVLVVQALSLLVALILRATVSTRRADF  189

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D ++EY    R + R+P++N+ Q    +G+      D R + +D WS+RMREKYGL+  +
Sbjct  190  DDEEEY--DVRGRSREPLLNH-QSGQTSGISKG---DIRGNLSDVWSSRMREKYGLNNGD  243



>ref|XP_008235542.1| PREDICTED: tetraspanin-18-like [Prunus mume]
Length=285

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 73/117 (62%), Gaps = 8/117 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            RW+K++P D TG  D +  F++DN  I +W  L  ++L+AL  LLA+V+R   +   ADY
Sbjct  161  RWEKDLPFDPTGELDSLRSFVQDNIDICRWAGLAVIILQALSLLLAMVLRGMVSTWKADY  220

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLD  238
            D +D+Y    R + R+P++NN Q +  +G       D R + +D WS+R+R+KYGL+
Sbjct  221  DVEDDY--DFRGRTREPLLNN-QLSQASGSTKG---DGRGTHSDIWSSRIRDKYGLN  271



>ref|XP_002984277.1| hypothetical protein SELMODRAFT_229009 [Selaginella moellendorffii]
 gb|EFJ14787.1| hypothetical protein SELMODRAFT_229009 [Selaginella moellendorffii]
Length=258

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 75/150 (50%), Gaps = 28/150 (19%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA----NRPAD  412
            W+++ P D TG    I +F+E N +  KW+ L  V++E L  L  +++RA     NR + 
Sbjct  132  WERDFPKDPTGEIHSIRKFVEKNAEFCKWIGLSVVIVEVLSLLFGMILRAVIGDFNR-SG  190

Query  411  YDSDDEYIGGP-RQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDT  235
            YDSDD+Y+  P R  +R      RQ +P             P  +   S ++R+KY    
Sbjct  191  YDSDDDYVRPPTRSNVR------RQGSP-------------PELSSTRSTKLRDKY---A  228

Query  234  SEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
             EF+Y P ES R    N  P E R RCTIM
Sbjct  229  GEFSYTPSESRRLLQQNGAPEESRSRCTIM  258



>gb|AFK47805.1| unknown [Medicago truncatula]
Length=249

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 76/120 (63%), Gaps = 8/120 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            +W++++P D TG    I  F+ED+  I +WV +  +V++AL  L+AL++RA  + R AD+
Sbjct  130  QWQEDLPVDPTGQLASIRSFIEDDQDISRWVGIAVLVVQALSLLVALILRATVSTRRADF  189

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D ++EY    R + R+P++N+ Q    +G+      D R + +D WS+RMREKYGL+  +
Sbjct  190  DDEEEY--DVRGRSREPLLNH-QSGQTSGISKG---DIRGNLSDVWSSRMREKYGLNNGD  243



>ref|XP_008789493.1| PREDICTED: tetraspanin-18 isoform X1 [Phoenix dactylifera]
Length=223

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 15/123 (12%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADY  409
             W++++P D TG    +  F+E+N  I KWVAL  +V++AL  LLA+++RA    R  DY
Sbjct  112  HWEEDLPYDSTGELKSLCAFIEENMDICKWVALTVIVIQALSLLLAVILRATVPARRVDY  171

Query  408  DSDDEYIGGPRQQIRQPIMNNRQ--QAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDT  235
            DSD++ I   R     P++N +     P T V      D +   +D WS++MR+KYGL+ 
Sbjct  172  DSDEDLIVSTR-----PLLNAQGGPSYPTTSV------DGKGFHSDFWSSQMRQKYGLNQ  220

Query  234  SEF  226
            S+F
Sbjct  221  SKF  223



>ref|XP_002972445.1| hypothetical protein SELMODRAFT_228108 [Selaginella moellendorffii]
 gb|EFJ26531.1| hypothetical protein SELMODRAFT_228108 [Selaginella moellendorffii]
Length=260

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 75/150 (50%), Gaps = 28/150 (19%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA----NRPAD  412
            W+++ P D TG    I +F+E N +  KW+ L  V++E L  L  +++RA     NR + 
Sbjct  134  WERDFPKDPTGEIHSIRKFVEKNAEFCKWIGLTVVIVEVLGLLFGMILRAVIGDFNR-SG  192

Query  411  YDSDDEYIGGP-RQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDT  235
            YDSDD+Y+  P R  +R      RQ +P             P  +   S ++R+KY    
Sbjct  193  YDSDDDYVRPPTRSNVR------RQGSP-------------PELSSTRSTKLRDKY---A  230

Query  234  SEFTYNPYESNRYQPTNVQPAEERGRCTIM  145
             EF+Y P ES R    N  P E R RCTIM
Sbjct  231  GEFSYTPSESRRLLQQNGAPEESRSRCTIM  260



>emb|CDM86191.1| unnamed protein product [Triticum aestivum]
Length=246

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 79/134 (59%), Gaps = 12/134 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADY  409
             W +++P DRTG  + +  F+ +N  + KW AL     +AL   LA+V+RA   P  +DY
Sbjct  121  HWIQDLPYDRTGELENLVSFVNNNLDLCKWAALATFATQALSLFLAMVLRAMVSPTSSDY  180

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTS-  232
            DSD++++      IR+P++   Q AP + +P   T D R    + WS+ MR+KYGL++S 
Sbjct  181  DSDEDFV-----VIRRPLL-IAQGAP-SYLPT--TADPRGGHPNLWSSSMRQKYGLNSSG  231

Query  231  EFTYNPYESNRYQP  190
            ++TYN  + N  +P
Sbjct  232  DYTYNTLDQNAVRP  245



>gb|KJB26070.1| hypothetical protein B456_004G223400 [Gossypium raimondii]
Length=295

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 78/135 (58%), Gaps = 12/135 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W+K+IP D TG  D +  F+EDN  I KWV L  V+++ L  L+A+++RA  + R    
Sbjct  162  HWEKDIPFDPTGELDSLRSFIEDNIDICKWVGLSVVIIQVLALLVAVILRAMVSVRRRGI  221

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D +D+Y    R + R+P++N   Q+  T     G  D R S +D W +R+REKYG+++ +
Sbjct  222  DDEDDY---ERGRTREPLLN--PQSNHTSTSAKG--DGRVSHSDFWGSRIREKYGMNSGD  274

Query  228  FTYNPYESNRYQPTN  184
              YN   +++Y   N
Sbjct  275  -RYN--SADKYDLLN  286



>ref|XP_002517938.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44456.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 64/112 (57%), Gaps = 13/112 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+K+ P D TG+F+   +F+  N++I KW+ L  V ++ L FLLAL+++A       DSD
Sbjct  115  WEKDFPKDPTGSFNQFKDFIRSNFEICKWMGLSIVSVQGLSFLLALILKALGPHQYCDSD  174

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DE+        R P++NN    P  V G PV G      SRNDAWS R+ EK
Sbjct  175  DEFTPD-----RVPLLNNAAIPPPYVVGSPVVG------SRNDAWSIRINEK  215



>ref|XP_010652447.1| PREDICTED: tetraspanin-18-like [Vitis vinifera]
 emb|CBI37235.3| unnamed protein product [Vitis vinifera]
Length=274

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 8/117 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W+K++P D TG  +    F+E N  I KWV +  V ++AL  LLA+++RA  + R  DY
Sbjct  158  HWEKDLPFDPTGELENFRSFIEGNIDICKWVGITVVSIQALSLLLAMILRAMVSTRKTDY  217

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLD  238
            D +D+Y    R   R+P++N   QA  T     G  D + +  + WS+RMREKYGL+
Sbjct  218  DIEDDYTAAGRN--REPLLN--PQASQTSGSSKG--DGKGAYLETWSSRMREKYGLN  268



>ref|XP_010038335.1| PREDICTED: tetraspanin-20 [Eucalyptus grandis]
 gb|KCW50153.1| hypothetical protein EUGRSUZ_K03588 [Eucalyptus grandis]
Length=292

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 70/119 (59%), Gaps = 7/119 (6%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADY  409
            RW++ +P+D TG  D +  F+E N ++ KW+ +  VV++AL  LL+ V+RA   P  ADY
Sbjct  162  RWEQILPSDPTGELDSLRSFIESNIEMCKWIGIAVVVIQALSLLLSFVLRALASPRRADY  221

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTS  232
            D  D+Y      + R+P++N++  +  +G   +   D R      WS+ +REKYGL+ S
Sbjct  222  DGLDDY-DNVEGRTREPLLNHK-SSTTSG---SAKSDARGGHTGIWSSLVREKYGLNNS  275



>ref|XP_008372422.1| PREDICTED: tetraspanin-18-like [Malus domestica]
Length=287

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 69/118 (58%), Gaps = 8/118 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            RW+K++P D TG  D    F+E+N  I +WV LG +V++ L  LL++ +R   +    DY
Sbjct  163  RWEKDLPFDPTGQLDSFRSFVEENIDICRWVGLGVIVIQVLSLLLSITLRGMLSTHKPDY  222

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDT  235
            D +D+Y    R + R+P++  +QQ         G  D + + +D WS+R+R+KYGL +
Sbjct  223  DVEDDY--DARARTREPLL--KQQLNQASGSTKG--DGKGTHSDIWSSRIRDKYGLSS  274



>ref|XP_001763914.1| predicted protein [Physcomitrella patens]
 gb|EDQ71318.1| predicted protein [Physcomitrella patens]
Length=284

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 73/135 (54%), Gaps = 9/135 (7%)
 Frame = -1

Query  534  IYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--YDSDDEYIGGPRQQIRQ  361
            I+E++ED    ++   +   V+  + F  A V+RA    A   YDSD++YI   R   RQ
Sbjct  154  IWEWIEDYLDCLRLSLMNFSVVLGIFF--AFVLRAVTVSAQRGYDSDEDYIAA-RSAGRQ  210

Query  360  PIMNNRQQAPVTGVP-VAGTLDXRPSRNDAWSARMREKYGLDTSEFTYNPYESNR-YQPT  187
            P   NRQ       P  A  ++ R  R DAWS RMREKYGLDTSEFT  P ES R  QP 
Sbjct  211  P-GGNRQVNQANPAPGSAAAVEARAPRLDAWSTRMREKYGLDTSEFTSKPSESRRPLQPN  269

Query  186  NV-QPAEERGRCTIM  145
                P E++  CTIM
Sbjct  270  QTPGPVEQQNFCTIM  284



>gb|KDP26433.1| hypothetical protein JCGZ_17591 [Jatropha curcas]
Length=271

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 68/122 (56%), Gaps = 16/122 (13%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            RW+K+IP D TG    +  F+EDN  I KWV +  + ++AL  LLA+++RA  + R  D 
Sbjct  150  RWQKDIPFDPTGELQTLKSFIEDNVDICKWVGITVLTVQALSLLLAMILRAMVSTRREDS  209

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            + +D+Y  G R +  +P++N   Q                + +D WS RMREKYGL++ E
Sbjct  210  ECEDDYENG-RGRSWEPLLNQSGQT-------------SGAHSDIWSTRMREKYGLNSVE  255

Query  228  FT  223
             T
Sbjct  256  KT  257



>ref|XP_007050068.1| Tetraspanin family protein, putative [Theobroma cacao]
 gb|EOX94225.1| Tetraspanin family protein, putative [Theobroma cacao]
Length=297

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 78/135 (58%), Gaps = 10/135 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPA--DY  409
             W+K++P D TG  D +  F+EDN  + KWV +  V+++AL  L+A+++RA       D 
Sbjct  161  HWEKDLPFDETGELDSLRSFIEDNIDLCKWVGISVVIVQALSLLVAIILRAMVSSGRRDI  220

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D++D+Y    R +  +P++N++     T    +   D + + +D W +R+REKYGL++ +
Sbjct  221  DNEDDY-ENIRGRTWKPLLNSQSSHTST----SAKTDGKGTHSDIWGSRIREKYGLNSGD  275

Query  228  FTYNPYESNRYQPTN  184
              YN   +++Y   N
Sbjct  276  -RYN--SADKYNLLN  287



>gb|EYU17845.1| hypothetical protein MIMGU_mgv1a0219312mg, partial [Erythranthe 
guttata]
Length=207

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 9/63 (14%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVV---------LEALMFLLALVVRA  430
             WK +IPTD TGNF MIYEFL+ +WKI+KWVALGAV          ++AL+FLLAL+VRA
Sbjct  139  SWKDKIPTDGTGNFAMIYEFLDKHWKIIKWVALGAVYTRVILTTVKMQALIFLLALIVRA  198

Query  429  ANR  421
            AN 
Sbjct  199  ANS  201



>ref|XP_008382665.1| PREDICTED: tetraspanin-18-like [Malus domestica]
Length=287

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 16/122 (13%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR---AANRPAD  412
            RW+K++P D TG  D +  F+++N  I +WV L  +V++AL  LL++ +R   +  +P D
Sbjct  163  RWEKDLPFDPTGQLDSLRSFVKENIDICRWVGLTVIVIQALSLLLSITLRGMLSICKP-D  221

Query  411  YDSDDEYIGGPRQQIRQPIMN---NRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGL  241
            YD +D+     R + R+P++N   N+      G       D R + +D WS+R+REKYGL
Sbjct  222  YDVEDD--SDARARTREPLLNQKLNQASGSTKG-------DGRGTHSDIWSSRIREKYGL  272

Query  240  DT  235
             +
Sbjct  273  SS  274



>ref|XP_008342921.1| PREDICTED: tetraspanin-19-like isoform X2 [Malus domestica]
Length=146

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 8/112 (7%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDSD
Sbjct  38   WEEDFPDDPTGRFDQFKEFVRSNFDICKWIGLSIVCVQGLSLLLAMILKALGPHPYYDSD  97

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEYI  P    R P++ N    P  V G PV G+ +   S++D+W+ R+ +K
Sbjct  98   DEYI--PE---RVPLLKNAVLPPPYVVGDPVYGS-NVYGSKSDSWNIRINDK  143



>ref|XP_008342920.1| PREDICTED: tetraspanin-19-like isoform X1 [Malus domestica]
Length=168

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 8/112 (7%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDSD
Sbjct  60   WEEDFPDDPTGRFDQFKEFVRSNFDICKWIGLSIVCVQGLSLLLAMILKALGPHPYYDSD  119

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEYI  P    R P++ N    P  V G PV G+ +   S++D+W+ R+ +K
Sbjct  120  DEYI--PE---RVPLLKNAVLPPPYVVGDPVYGS-NVYGSKSDSWNIRINDK  165



>ref|XP_010933200.1| PREDICTED: tetraspanin-18-like [Elaeis guineensis]
Length=238

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 13/130 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR--AANRPADY  409
             W++++P D TG    +  F+E N  I KWVA+  +V++AL  LLA+++R  A+ R  DY
Sbjct  112  HWEEDLPHDATGQLKSLRAFIEANIGICKWVAVTVLVVQALSLLLAVILRGMASPRSVDY  171

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGT-LDXRPSRNDAWSARMREKYGLDTS  232
            DSD+E+       +R+P++N     P  G   A T  D     +D W++R+++KY    S
Sbjct  172  DSDEEFF-----TVRKPLLN-----PQGGPTFASTSFDNTVVSSDTWNSRIKQKYVFGQS  221

Query  231  EFTYNPYESN  202
            + + N  + N
Sbjct  222  QLSDNAMDPN  231



>ref|XP_008229174.1| PREDICTED: tetraspanin-19 [Prunus mume]
Length=218

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 13/112 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDSD
Sbjct  115  WEEDFPDDPTGRFDQFKEFVRSNFDICKWIGLSIVCVQGLSLLLAMILKALGPHQYYDSD  174

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEY+  P    R P++ N    P  V G PV G      S+NDAW+ R+ +K
Sbjct  175  DEYV--PE---RVPLLKNAVLPPPYVIGDPVYG------SKNDAWNIRINDK  215



>ref|XP_006656530.1| PREDICTED: tetraspanin-18-like [Oryza brachyantha]
Length=243

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 75/128 (59%), Gaps = 11/128 (9%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR--AANRPADYD  406
            W +++P DRTG  + +  F++ N  + KW A+  V  +A   LLA ++R   +   ADYD
Sbjct  120  WIQDLPYDRTGELNNLLSFIQSNLDLCKWAAVAIVAAQAFSLLLATILRTMVSTLRADYD  179

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
            SD++++      IR+P++   Q AP     +  T+D R    D WS+RMR+KYGL++S +
Sbjct  180  SDEDFV-----VIRRPLLV-AQGAPAY---LPTTVDSRGFHPDLWSSRMRQKYGLNSSSY  230

Query  225  TYNPYESN  202
            TYN  + N
Sbjct  231  TYNTLDPN  238



>ref|XP_009371022.1| PREDICTED: tetraspanin-18-like [Pyrus x bretschneideri]
 ref|XP_009371028.1| PREDICTED: tetraspanin-18-like [Pyrus x bretschneideri]
Length=287

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 68/118 (58%), Gaps = 8/118 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            RW+K++P D TG  D    F+E+N  I +WV LG + ++ L  LL++ +R   +    DY
Sbjct  163  RWEKDLPFDPTGQLDSFRSFVEENIDICRWVGLGVIAIQVLCVLLSITLRGLLSTHKPDY  222

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDT  235
            D +D+Y    R + R+P++  +QQ         G  D + + +D WS+R+R+KYGL +
Sbjct  223  DIEDDY--DARARTREPLL--KQQLNQASGSNKG--DGKGTHSDIWSSRIRDKYGLSS  274



>ref|XP_009342640.1| PREDICTED: tetraspanin-19 [Pyrus x bretschneideri]
Length=220

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 13/112 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDSD
Sbjct  117  WEEDFPDDPTGRFDQFKEFVRSNFDICKWIGLSIVCVQGLSLLLAMILKALGPHPYYDSD  176

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            D+YI  P    R P++NN    P  V G PV G      S++D+W+ R+ +K
Sbjct  177  DDYI--PE---RVPLLNNAVLPPPYVVGDPVYG------SKSDSWNIRINDK  217



>ref|XP_007217759.1| hypothetical protein PRUPE_ppa011228mg [Prunus persica]
 gb|EMJ18958.1| hypothetical protein PRUPE_ppa011228mg [Prunus persica]
Length=218

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 13/112 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDSD
Sbjct  115  WEEDFPDDPTGRFDQFKEFVRLNFDICKWIGLSIVCVQGLSLLLAMILKALGPHQYYDSD  174

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEY+       R P++ N    P  V G PV G      S+NDAW+ R+ +K
Sbjct  175  DEYVTE-----RVPLLKNAVLPPPYVIGDPVYG------SKNDAWNIRINDK  215



>ref|XP_009591228.1| PREDICTED: tetraspanin-19 [Nicotiana tomentosiformis]
Length=222

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 16/115 (14%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD---Y  409
            W+++ P D TGNFD +  FL++N+ I KWV L  V ++ L  LLA++++A     +   Y
Sbjct  116  WEEDFPEDTTGNFDELKHFLKENFDICKWVGLSVVTVQGLTILLAMILKALGPHPERYHY  175

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            +SDD+YI       R P++ N   +P  V G PV G      S+NDAW+ R+  K
Sbjct  176  ESDDDYIPD-----RVPLLKNYVPSPSCVVGDPVYG------SKNDAWNIRINSK  219



>ref|XP_011080147.1| PREDICTED: tetraspanin-18 [Sesamum indicum]
Length=270

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 9/127 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
             W+K+IP D TG  D ++ F+EDN  I  WV +  +V++ L  L A+++R+       D 
Sbjct  146  HWEKDIPFDPTGELDSLWTFIEDNVDIFTWVGITVIVIQVLSLLFAIILRSLVSGPREDD  205

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
            D E   G R   R+P++     AP +      T       +D WS+RMREKYGL++ E  
Sbjct  206  DLEGDYGFRSSTREPLL-----APYSSQASGST----RGDSDIWSSRMREKYGLNSGEAK  256

Query  222  YNPYESN  202
            ++  + N
Sbjct  257  HSLLDQN  263



>ref|XP_009775665.1| PREDICTED: tetraspanin-19 [Nicotiana sylvestris]
Length=222

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%), Gaps = 16/115 (14%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD---Y  409
            W+++ P D TGNFD +  FL++N+ I KWV L  V ++A+  LLA++++A     +   Y
Sbjct  116  WEEDFPEDTTGNFDELKHFLKENFDICKWVGLSVVTVQAVSILLAMILKALGPHPERYHY  175

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            +SDD+YI       R P++ N   +P  V G PV G      S+NDAW+ R+  K
Sbjct  176  ESDDDYIPD-----RVPLLKNYVPSPSYVVGDPVYG------SKNDAWNIRINSK  219



>ref|XP_004495030.1| PREDICTED: tetraspanin-20-like [Cicer arietinum]
Length=251

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 69/119 (58%), Gaps = 6/119 (5%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
            +W++++P D TG  D +  F+EDN  I KWV +  +V++ L  LLA+++RA       D 
Sbjct  132  QWQEDLPVDPTGQLDSLRSFIEDNQNICKWVGIIVLVIQTLSLLLAIILRATVSTRREDF  191

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTL-DXRPSRNDAWSARMREKYGLDTSE  229
            DDE     R + R+P++N     P +G     +  D R + +D WS+RMREKYGL+  +
Sbjct  192  DDEEQDDVRGRSREPLLN-----PHSGQTSGSSKGDIRGNHSDVWSSRMREKYGLNNGD  245



>dbj|BAK01647.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02082.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 12/134 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADY  409
             W +++P DRTG  + +  F+++N  + KW A+  V  +A    LA+ +RA   P  ADY
Sbjct  121  HWIQDLPYDRTGELESLVSFVKNNLDLCKWAAVATVATQAFSLFLAMTLRAMVSPANADY  180

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLD-TS  232
            DS+++++      IR+P++   Q AP     +  T D R ++   WS+ MR+KYGL+ TS
Sbjct  181  DSEEDFV-----VIRRPLL-LAQGAPAY---IPTTADPRGAQPGLWSSSMRQKYGLNSTS  231

Query  231  EFTYNPYESNRYQP  190
            ++TYN  + N  +P
Sbjct  232  DYTYNTLDQNAVRP  245



>ref|XP_008789494.1| PREDICTED: tetraspanin-18 isoform X2 [Phoenix dactylifera]
Length=222

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 16/120 (13%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADY  409
             W++++P D TG    +  F+E+N  I KWVAL  +V++AL  LLA+++RA    R  DY
Sbjct  112  HWEEDLPYDSTGELKSLCAFIEENMDICKWVALTVIVIQALSLLLAVILRATVPARRVDY  171

Query  408  DSDDEYIGGPRQQIRQPIMNNRQ--QAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDT  235
            DSD++ I   R     P++N +     P T V      D +   +D WS++MR+K GL T
Sbjct  172  DSDEDLIVSTR-----PLLNAQGGPSYPTTSV------DGKGFHSDFWSSQMRQK-GLQT  219



>ref|XP_005644373.1| hypothetical protein COCSUDRAFT_44255 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19829.1| hypothetical protein COCSUDRAFT_44255 [Coccomyxa subellipsoidea 
C-169]
Length=244

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 75/152 (49%), Gaps = 21/152 (14%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANR---PADY  409
            W++ +P D TG    I  F++    + +WV L  +V++ L   LA  +  A +       
Sbjct  107  WRRYLPPDETGEVKKIERFVKSKLDVCRWVGLAVLVVQLLSLALAYALSTAQQRLLEVSD  166

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D +DE  G      R+P++++  ++P         ++   +R DAWSARMR+KYGLDTS 
Sbjct  167  DDEDEVWGR-----RRPLLSSEPESP---------MERGDARTDAWSARMRDKYGLDTSR  212

Query  228  FTYNP----YESNRYQPTNVQPAEERGRCTIM  145
            +TYNP      S    P   + A    RC +M
Sbjct  213  YTYNPDDRRASSGSELPAGAETAATSRRCAVM  244



>gb|KDP20951.1| hypothetical protein JCGZ_21422 [Jatropha curcas]
Length=210

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 69/139 (50%), Gaps = 22/139 (16%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA----NRPAD  412
            W+K++P D TG F    EF+E N+ + KW+ L  V+ +    L A+ +RA     N P++
Sbjct  87   WEKDLPEDPTGRFHDFKEFVESNFDVFKWIGLLIVLAQGCCILFAMALRAVRVNYNGPSN  146

Query  411  YDSDDEYIGGPRQQIRQPIMNNRQQAP---VTGVPVAGTLDXRPSRNDAWSARMREKYGL  241
            YDSDDEY        R P++N   Q P   V G P         S+ND+W+ +  + +  
Sbjct  147  YDSDDEYTAA-----RLPLLNKHLQTPSYVVNGDP------HLASKNDSWNTKETDSF--  193

Query  240  DTSEFTYNPYESNRYQPTN  184
               +   + YE N  + TN
Sbjct  194  --VKRIASTYEENNKKATN  210



>ref|XP_011083093.1| PREDICTED: tetraspanin-18 [Sesamum indicum]
Length=263

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 71/135 (53%), Gaps = 18/135 (13%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             WKK++P D TG  D +  F+EDN  I+KWV +  ++++AL  L A ++R+  ++R  D 
Sbjct  145  HWKKDLPFDPTGELDNLMAFIEDNMDILKWVGIAILIIQALSLLFATILRSMVSSRDVDD  204

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D + EY    R+ +  P     + +   G P   +        D WS+RMR+KYGL+T +
Sbjct  205  DIEAEYDYSSREPLLIP-----RPSQACGSPRGDS--------DIWSSRMRQKYGLNTGD  251

Query  228  FTYNPYESNRYQPTN  184
                  ES   +P N
Sbjct  252  SKAQFIES---KPVN  263



>ref|XP_009407845.1| PREDICTED: tetraspanin-18-like [Musa acuminata subsp. malaccensis]
Length=237

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 75/124 (60%), Gaps = 10/124 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--Y  409
             W++++P D TG    + EF+EDN  I KWVA+  + ++AL  LL LV+RA  +P +  Y
Sbjct  113  HWEEDLPYDSTGELKNLREFVEDNMDIFKWVAVSVIAIQALCLLLTLVLRALVQPRNDAY  172

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P+++ +   P  G     ++D +   +D WS+RMR KYGL+ +E
Sbjct  173  DSDEDFV-----VIRRPLLHPQGGGPSYG---TTSIDNKGIHSDTWSSRMRHKYGLNQNE  224

Query  228  FTYN  217
               N
Sbjct  225  LPPN  228



>ref|XP_009592671.1| PREDICTED: tetraspanin-20-like [Nicotiana tomentosiformis]
Length=251

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 12/119 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP----A  415
            +W+K++P D TG    +  F+E N  + KW+ +  ++++A   LLA+V+RA         
Sbjct  128  QWEKDLPRDPTGELHNVRTFIEQNMDVCKWIGIAVIIIQASSLLLAIVLRALVSDHRINH  187

Query  414  DYDSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLD  238
            D++ D + IG    + R+P+++ R  +  +G+  A   D R   +D WS+RMREKY LD
Sbjct  188  DFEGDYDVIG----RTREPLLDPR-LSQTSGLAKA---DARVGHSDIWSSRMREKYHLD  238



>gb|KHG04274.1| hypothetical protein F383_07750 [Gossypium arboreum]
Length=269

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 76/142 (54%), Gaps = 8/142 (6%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
            RW+K+IP D TG  D +  F+EDN  I KWV L  V+++ L  L+A+++RA         
Sbjct  136  RWEKDIPFDPTGELDSLRSFIEDNIDICKWVGLSVVIIQVLALLVAVILRAM-VSVRRRD  194

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEFT  223
             D+     R + R+P+++ +     T    +   D R S +D W +R+REKYG+++ +  
Sbjct  195  IDDEDDYERGRTREPLLHPQSNHTST----SAKDDGRVSHSDFWGSRIREKYGMNSGD-R  249

Query  222  YNPYESNRYQPTNVQPAEERGR  157
            YN   +++Y   N   +  + +
Sbjct  250  YN--SADKYDLLNQNASSTKSK  269



>ref|XP_010051830.1| PREDICTED: tetraspanin-19 [Eucalyptus grandis]
Length=215

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 59/110 (54%), Gaps = 9/110 (8%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TGN  ++ EF+  N+++ KW+ L  V ++ L  LLA+V++      +YDSD
Sbjct  112  WEEDFPEDLTGNLSLLKEFVRSNFEMCKWIGLSIVSIQGLCILLAMVLKVLGPHQNYDSD  171

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            DE+        R P++ N    P    P A       S++D WS R+ EK
Sbjct  172  DEF-----STDRVPLLKNATVPP----PYAVADPAYGSKSDGWSIRINEK  212



>gb|KCW89519.1| hypothetical protein EUGRSUZ_A01807 [Eucalyptus grandis]
Length=219

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 9/111 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
             W+++ P D TGN  ++ EF+  N+++ KW+ L  V ++ L  LLA+V++      +YDS
Sbjct  111  EWEEDFPEDLTGNLSLLKEFVRSNFEMCKWIGLSIVSIQGLCILLAMVLKVLGPHQNYDS  170

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            DDE+        R P++ N    P    P A       S++D WS R+ EK
Sbjct  171  DDEF-----STDRVPLLKNATVPP----PYAVADPAYGSKSDGWSIRINEK  212



>ref|XP_002263228.1| PREDICTED: tetraspanin-19 [Vitis vinifera]
 emb|CBI28766.3| unnamed protein product [Vitis vinifera]
Length=212

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 60/114 (53%), Gaps = 13/114 (11%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG+F     F+  N++I KW+ L  + ++ L  LLA+V++A      YDSD
Sbjct  109  WEEDFPEDPTGSFHEFKNFVRSNFEICKWIGLSILFVQGLSILLAMVLKALGPHQYYDSD  168

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREKYG  244
            DEY        R P++ N    P  V G P +G      SR DA+  R+ EK G
Sbjct  169  DEY-----APTRAPLLRNAVHPPPYVAGDPFSG------SRTDAYGKRINEKTG  211



>ref|XP_008796410.1| PREDICTED: tetraspanin-18-like isoform X1 [Phoenix dactylifera]
Length=244

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 80/148 (54%), Gaps = 17/148 (11%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W++++P D TG       F+++N  I KWVA+  +V++A   LLA+++RA  A R  DY
Sbjct  112  HWEEDLPYDSTGELKRFCAFIKENMDICKWVAVTVIVIQAFSLLLAMILRAMVAARRVDY  171

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DSD++++      IR+P+++  Q  P       G+   +   +D  S +MR+K     SE
Sbjct  172  DSDEDFV-----VIRRPLLDP-QGGPSYATTSVGS---KGIHSDFLSPQMRQK-----SE  217

Query  228  FTYNPYESNRYQPTNVQPAEERGRCTIM  145
             +YN  +  +   +    ++ R +C+I+
Sbjct  218  LSYNGVD-QKTALSASSNSDNRKQCSIL  244



>ref|XP_008448284.1| PREDICTED: tetraspanin-19 [Cucumis melo]
 ref|XP_008448285.1| PREDICTED: tetraspanin-19 [Cucumis melo]
Length=215

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 57/109 (52%), Gaps = 14/109 (13%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W ++ P D +G FD    F++ N+ I KW+ +  V ++ L  LLA+V++A      Y+SD
Sbjct  114  WAEDFPKDPSGCFDQFKHFIKSNFNICKWIGISTVSIQGLSLLLAMVLKAIGSRRYYESD  173

Query  399  DEYIGGPRQQIRQPIMNNRQQAPVTGV---PVAGTLDXRPSRNDAWSAR  262
            DEY   P    R P + N   +P T V   PV       PS+ND W+ R
Sbjct  174  DEY--APE---RLPFLKNALHSPTTCVIGDPVF------PSKNDTWNKR  211



>ref|XP_007201868.1| hypothetical protein PRUPE_ppa009611mg [Prunus persica]
 gb|EMJ03067.1| hypothetical protein PRUPE_ppa009611mg [Prunus persica]
Length=285

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 73/117 (62%), Gaps = 8/117 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            RW+K++P D TG  D +  F++DN  I KW  L  +VL+AL  LLALV+R   +   ADY
Sbjct  161  RWEKDLPFDPTGELDSLRSFVQDNIDICKWAGLAVIVLQALSLLLALVLRGMVSTHKADY  220

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLD  238
            D +D+Y    R + R+P++NN Q +  +G       D R + +D WS+R+R+KYGL+
Sbjct  221  DVEDDY--DFRGRTREPLLNN-QLSQASGSTKG---DGRGTHSDIWSSRIRDKYGLN  271



>gb|KGN46747.1| hypothetical protein Csa_6G128570 [Cucumis sativus]
Length=215

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 14/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W ++ P D +G FD    F++ N+ I KW+ +  V ++ L  LLA+V++A      Y+SD
Sbjct  114  WAEDFPKDPSGCFDQFKHFIKSNFNICKWIGISTVSIQGLSLLLAMVLKAIGSRRYYESD  173

Query  399  DEYIGGPRQQIRQPIMNNRQQAP---VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEY   P    R P + N   +P   V G PV       PS+ND W+ +  +K
Sbjct  174  DEY--APE---RLPFLKNTLHSPTACVIGDPVF------PSKNDTWNKQTEDK  215



>ref|XP_006350290.1| PREDICTED: tetraspanin-20-like isoform X1 [Solanum tuberosum]
Length=259

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 68/119 (57%), Gaps = 12/119 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR--AANRPADY  409
             W+K++PTD TG    +  F++ N  + KW+ +  VV++A    LA+V+R   ++   +Y
Sbjct  136  HWEKDLPTDPTGELHSLRTFIQQNMDVCKWIGIVVVVIQAFSLFLAVVLRTLVSSPKLNY  195

Query  408  DSDDEY--IGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLD  238
            D + +Y  +G    + R+P+++ R  +  +G+      D R   +D WS+RMREKY LD
Sbjct  196  DMEGDYDVVG----RTREPLLDPR-LSQTSGLAKG---DARGGHSDIWSSRMREKYHLD  246



>gb|KFK40448.1| hypothetical protein AALP_AA3G374400 [Arabis alpina]
Length=219

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 55/95 (58%), Gaps = 8/95 (8%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WKK+ P D +G F    +F+E N+KI KW+ LG V ++ L  LLA++++A      YDSD
Sbjct  114  WKKDFPEDPSGAFHQFSKFIESNFKICKWIGLGIVCVQGLSVLLAMLLKALGPHRHYDSD  173

Query  399  DEYIGGPRQQIRQPIMNNRQQAP---VTGVPVAGT  304
            DEY        R  ++ + +Q+P   V G P+ G+
Sbjct  174  DEY-----DVSRVALLRDARQSPSPYVVGEPMYGS  203



>ref|XP_006357492.1| PREDICTED: tetraspanin-19-like [Solanum tuberosum]
Length=222

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 65/117 (56%), Gaps = 16/117 (14%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD---Y  409
            W+++ P D TGNFD +  F++DN+ I KW+ L  V ++ L  LLA++++A     +   Y
Sbjct  116  WQEDFPKDTTGNFDELKHFVKDNFDICKWIGLSVVTVQGLTILLAMILKALGPHQERCYY  175

Query  408  DSDDEYIGGPRQQIRQPIMNNR--QQAPVTGVPVAGTLDXRPSRNDAWSARMREKYG  244
            +SDD+Y+       R P++ +     + V G P+ G       +NDAW+ R+  K G
Sbjct  176  ESDDDYMPD-----RVPLLKSYVPSSSYVVGDPMYG------PKNDAWNIRINSKVG  221



>ref|XP_004247113.1| PREDICTED: tetraspanin-20 [Solanum lycopersicum]
Length=259

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 67/126 (53%), Gaps = 11/126 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR---AANRPAD  412
             W+K++PTD TG    +  F++ N  + KW+ +  +V++A    LA+V+R   ++ +  D
Sbjct  137  HWEKDLPTDPTGELHSLRIFIQQNMDVCKWIGIVVIVIQAFSLFLAVVLRTLVSSPKLND  196

Query  411  YDSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTS  232
             + D + +G    + R+P+++ R    ++        D R   +D WS+RMREKY LD  
Sbjct  197  MEGDYDVVG----RTREPLLDPR----ISQTSGLAKGDARGGHSDIWSSRMREKYHLDGE  248

Query  231  EFTYNP  214
               + P
Sbjct  249  AIHHIP  254



>gb|KJB22617.1| hypothetical protein B456_004G057900 [Gossypium raimondii]
 gb|KJB22618.1| hypothetical protein B456_004G057900 [Gossypium raimondii]
Length=287

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 71/127 (56%), Gaps = 8/127 (6%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA---ANRPADY  409
            W+K++P D TG  D    F+EDN  I KWV +  V+++AL  L+A+++RA   A R    
Sbjct  166  WEKDLPFDPTGEIDNFRSFVEDNIDICKWVGISVVIIQALAMLVAIILRAMVSARRRDID  225

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D D++     R +  +P++N +     T    +   D R SR+D W +++REK+GL + +
Sbjct  226  DEDEDDYESIRGRTWEPLLNPQSSHSST----SAKGDGRGSRSDVWGSQIREKFGLQSGD  281

Query  228  FTYNPYE  208
              YN  +
Sbjct  282  -KYNSLK  287



>ref|XP_006443683.1| hypothetical protein CICLE_v10021447mg [Citrus clementina]
 ref|XP_006480169.1| PREDICTED: tetraspanin-20-like [Citrus sinensis]
 gb|ESR56923.1| hypothetical protein CICLE_v10021447mg [Citrus clementina]
Length=293

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 80/134 (60%), Gaps = 23/134 (17%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            RW+K++P D TG  D +  F+EDN  I KWV +  V+++AL  LLA+++RA  + R  ++
Sbjct  175  RWEKDLPFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRRTNF  234

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTS-  232
            D +D+Y    R +IR+P+++   Q P+             + +D WS+R+REKYGL+   
Sbjct  235  DEEDDY-ESERVRIREPLIH---QQPI-------------AHSDIWSSRIREKYGLNGGG  277

Query  231  -EFTY--NPYESNR  199
             ++T+  NP  S +
Sbjct  278  EQYTFGNNPSASMK  291



>gb|KDO65807.1| hypothetical protein CISIN_1g022738mg [Citrus sinensis]
Length=293

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 80/134 (60%), Gaps = 23/134 (17%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            RW+K++P D TG  D +  F+EDN  I KWV +  V+++AL  LLA+++RA  + R  ++
Sbjct  175  RWEKDLPFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRRTNF  234

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTS-  232
            D +D+Y    R +IR+P+++   Q P+             + +D WS+R+REKYGL+   
Sbjct  235  DEEDDY-ESERIRIREPLIH---QQPI-------------AHSDIWSSRIREKYGLNGGG  277

Query  231  -EFTY--NPYESNR  199
             ++T+  NP  S +
Sbjct  278  EQYTFGNNPSASMK  291



>ref|XP_004290026.1| PREDICTED: tetraspanin-18-like [Fragaria vesca subsp. vesca]
Length=287

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 69/129 (53%), Gaps = 9/129 (7%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W K++P D TG  +    F+E N  I +WV +  V ++AL  LLA+++R   +   ADY
Sbjct  157  HWDKDLPVDPTGELESFQSFIEKNIDICRWVGIAVVGIQALSLLLAIILRGMISTHKADY  216

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D +DEY    R + ++P++N           V    D R + +D WS+R+R+KYGL + +
Sbjct  217  DVEDEY--DARGRTQEPLLNQHLSQASGSTKV----DGRGTHSDIWSSRIRDKYGLSSGD  270

Query  228  FTYNPYESN  202
              YN    N
Sbjct  271  -KYNSVNQN  278



>ref|XP_007144435.1| hypothetical protein PHAVU_007G155900g [Phaseolus vulgaris]
 ref|XP_007144436.1| hypothetical protein PHAVU_007G155900g [Phaseolus vulgaris]
 gb|ESW16429.1| hypothetical protein PHAVU_007G155900g [Phaseolus vulgaris]
 gb|ESW16430.1| hypothetical protein PHAVU_007G155900g [Phaseolus vulgaris]
Length=243

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 69/116 (59%), Gaps = 10/116 (9%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPADYD  406
            W+K+IP D TG  D +  F+EDN  I  WV +  +V++  +L+  L L    + R AD+D
Sbjct  125  WEKDIPLDPTGKLDELRIFIEDNIDICTWVGITVLVVQALSLLLALILRATVSTREADFD  184

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPV-AGTLDXRPSRNDAWSARMREKYGL  241
             ++E  G  R++  +P++N     P +G P  +G  D R + +D WS+RMREKYGL
Sbjct  185  FENE--GDARRRSWEPLLN-----PQSGQPSGSGKGDNRGNHSDIWSSRMREKYGL  233



>gb|EMS62359.1| hypothetical protein TRIUR3_10377 [Triticum urartu]
Length=241

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 61/115 (53%), Gaps = 15/115 (13%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADY  409
             W +++P DRTG  + +  F+  N  + KW AL  V  +AL   LA+V+RA   P   DY
Sbjct  118  HWIQDLPHDRTGELENLVSFVNANLDLCKWAALATVATQALSLFLAMVLRAMVSPTSGDY  177

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVP--VAGTLDXRPSRNDAWSARMREK  250
            DSD++++      IR+P++  R      G P  +  T D R    + WS+ MR+K
Sbjct  178  DSDEDFV-----VIRRPLLIAR------GAPSYLPTTADPRGGHPNLWSSSMRQK  221



>gb|EMT02071.1| hypothetical protein F775_29035 [Aegilops tauschii]
Length=237

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 63/109 (58%), Gaps = 11/109 (10%)
 Frame = -1

Query  570  EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADYDSDD  397
            ++P DRTG    +  F+ DN  + KW AL  V  +AL  LLA+V+RA   P  +DYDSD+
Sbjct  98   DLPYDRTGELQNLVSFVHDNLDLCKWAALATVATQALSLLLAMVLRAMVSPTSSDYDSDE  157

Query  396  EYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            +++      IR+P++   Q AP + +P   T D R    + WS+ MR+K
Sbjct  158  DFV-----VIRRPLLIA-QGAP-SYLPT--TADPRGVHPNLWSSSMRQK  197



>ref|XP_010540868.1| PREDICTED: tetraspanin-19 [Tarenaya hassleriana]
Length=214

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 11/112 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
             WK++ P D +G F  + EF+E N++I KW+ L  V ++ L  LLA++++A      Y+S
Sbjct  113  EWKEDFPEDPSGAFHQLTEFIESNFEICKWIGLSVVCVQGLTVLLAMLLKALGPHQRYES  172

Query  402  DDEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DDEY G     ++    + R   P V G PV G      ++  AW+ R+ + 
Sbjct  173  DDEYDGSSVALLQ----DGRHPPPYVVGEPVYG------AKAGAWTIRINDH  214



>ref|XP_006408938.1| hypothetical protein EUTSA_v10002082mg [Eutrema salsugineum]
 gb|ESQ50391.1| hypothetical protein EUTSA_v10002082mg [Eutrema salsugineum]
Length=250

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 67/124 (54%), Gaps = 12/124 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
             W+K++P D TG  + +  F+E+N  I KWV +  V ++ L  LLA+V+RA   P   + 
Sbjct  136  HWEKDLPYDPTGELNSLRVFIEENIDICKWVGIAVVAVQLLSLLLAMVLRAMVSPGRPEL  195

Query  402  DDEY-IGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
            DDE     PR +   P++ ++      G          PS+ + WS+R+REKYGL+ S+ 
Sbjct  196  DDEEDYENPRSRAWDPLLGSQGNQASAG----------PSKIENWSSRIREKYGLNQSQ-  244

Query  225  TYNP  214
              NP
Sbjct  245  AVNP  248



>ref|XP_001762323.1| predicted protein [Physcomitrella patens]
 gb|EDQ72790.1| predicted protein, partial [Physcomitrella patens]
Length=134

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 10/84 (12%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA----ANRPA  415
             W++++P D TG  D + +F+  N  I KWVALG +++EAL    A+ +RA    A RP 
Sbjct  57   HWRQDLPDDPTGQLDKVEDFVGKNLTICKWVALGVLIIEALGLFFAMTLRAISADARRPG  116

Query  414  DYDSDDEYIGGPRQQIRQPIMNNR  343
             YDSDDE    P    RQP++N R
Sbjct  117  -YDSDDEL--APT---RQPLLNTR  134



>ref|XP_004243344.1| PREDICTED: tetraspanin-19 [Solanum lycopersicum]
Length=222

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 63/115 (55%), Gaps = 16/115 (14%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD---Y  409
            W+++ P D TGNFD +  F++DN+ I KW+ L  V ++ L  L A++++A     +   Y
Sbjct  116  WQEDFPEDTTGNFDELKHFVKDNFDICKWIGLSVVTVQGLTILFAMILKALGPHQERCYY  175

Query  408  DSDDEYIGGPRQQIRQPIMNNR--QQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            +SDD+YI       R P++ +     + V G P+ G       +NDAW+ R+  K
Sbjct  176  ESDDDYIPD-----RVPLLKSYVPSSSYVVGDPMYG------PKNDAWNIRINSK  219



>ref|XP_009765194.1| PREDICTED: tetraspanin-20-like [Nicotiana sylvestris]
Length=251

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 70/119 (59%), Gaps = 12/119 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            +W+K++P D TG    +  F+  N  + KW+ +  ++++A   LLA+V+RA  ++   ++
Sbjct  128  QWEKDLPRDPTGELHSLRTFIVQNMDVCKWIGIAVIIIQASSLLLAIVLRALLSDHSINH  187

Query  408  DSDDEY--IGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLD  238
            D + +Y  IG    + R+P+++ R  +  +G+  A   D +   +D WS+RM+EKY LD
Sbjct  188  DMERDYDVIG----RTREPLLDPR-LSQTSGLAKA---DAKVGHSDIWSSRMKEKYHLD  238



>ref|XP_002519044.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43255.1| conserved hypothetical protein [Ricinus communis]
Length=229

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 59/109 (54%), Gaps = 11/109 (10%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            W+K++P D TG F    EF++ N+ + KW+ L  V+ +    LLA+ +RA   N   +YD
Sbjct  122  WEKDLPEDPTGRFHDFKEFVKSNFDVFKWIGLLIVLAQGSSILLAMALRATGLNYEPNYD  181

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARM  259
            SDDEY  G     R P++N+  Q    GV   G      S+NDAW  R+
Sbjct  182  SDDEYPPG-----RLPLINHHLQPSPYGVGDPGL----ASKNDAWKVRI  221



>ref|XP_008381481.1| PREDICTED: tetraspanin-19-like [Malus domestica]
Length=203

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 13/109 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG FD   EF+  N  I KW+ L    ++ L  LLA++++A      YD D
Sbjct  104  WEEDFPVDPTGRFDQFKEFVRSNLDICKWIGLSIACVQGLSLLLAMILKALGPHPYYDGD  163

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARM  259
            DEY+  P    R P++ +    P  V G PV G      S++D+W+ R+
Sbjct  164  DEYV--PE---RVPLLKSAVLPPPYVVGDPVYG------SKSDSWNIRI  201



>ref|XP_008381480.1| PREDICTED: tetraspanin-19-like [Malus domestica]
Length=203

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 13/109 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG FD   EF+  N  I KW+ L    ++ L  LLA++++A      YD D
Sbjct  104  WEEDFPVDPTGRFDQFKEFVRSNLDICKWIGLSIACVQGLSLLLAMILKALGPHPYYDGD  163

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARM  259
            DEY+  P    R P++ +    P  V G PV G      S++D+W+ R+
Sbjct  164  DEYV--PE---RVPLLKSAVLPPPYVVGDPVYG------SKSDSWNIRI  201



>ref|XP_010239204.1| PREDICTED: tetraspanin-18-like isoform X2 [Brachypodium distachyon]
Length=227

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 64/113 (57%), Gaps = 11/113 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
            +W +++P DRTG  + +  F+++N  + KW A+  +  +AL   LA+V+RA  +    DY
Sbjct  117  QWIQDLPYDRTGELNNLVSFVQNNLDVCKWAAIATLATQALSLFLAMVLRAMVSTTNVDY  176

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            DSD++++      IR+P++   Q AP     +  T D      D WS+RMR+K
Sbjct  177  DSDEDFV-----VIRRPLL-LAQGAPAY---LPTTTDATGVHPDLWSSRMRQK  220



>gb|EMT30864.1| hypothetical protein F775_03218 [Aegilops tauschii]
Length=149

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 14/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            W+++ P D +G FD    F+  N+ I +WVAL  V  +AL  +LA+V+RA   +   +YD
Sbjct  24   WEEDFPDDPSGKFDEFKHFVRSNFDICEWVALSVVAAQALSIILAMVLRALGPDNEIEYD  83

Query  405  SDDEYIGGPRQQIRQPIMNNR-QQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDD+ +       R P++ N+ Q  P  G P        P R D+W  R+ +K
Sbjct  84   SDDDAVPA-----RLPLLRNKPQHGPNYGEP------NSPRRIDSWHVRILDK  125



>gb|KDO48162.1| hypothetical protein CISIN_1g032113mg [Citrus sinensis]
Length=131

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 11/113 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
             W+++ P D +G+F    +F+  N++  KW+ L  V ++ L F+LA++++       YDS
Sbjct  25   EWEEDFPEDPSGSFTQFKDFIRSNFQFCKWIGLSIVFVQGLSFILAVILKTLGPQRYYDS  84

Query  402  DDEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DD+   G     R P++ +    P  V G PV G       RNDAW  R+ EK
Sbjct  85   DDDCDPGTD---RVPLLRDVVHPPTYVVGDPVYG------PRNDAWPIRVDEK  128



>gb|EMS53896.1| hypothetical protein TRIUR3_15619 [Triticum urartu]
Length=182

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 14/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN--RPADYD  406
            W+++ P D +G FD    F+  N+ I +WVAL  V  +AL  +LA+V+RA       +YD
Sbjct  77   WEEDFPDDPSGKFDEFKHFVRSNFDICEWVALSVVAAQALSIILAMVLRALGPENEIEYD  136

Query  405  SDDEYIGGPRQQIRQPIMNNR-QQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDD+ +       R P++ N+ Q  P  G P        P R D+W  R+ +K
Sbjct  137  SDDDAVPA-----RLPLLRNKPQHGPSYGEP------NSPRRIDSWHVRILDK  178



>gb|KDO48163.1| hypothetical protein CISIN_1g032113mg [Citrus sinensis]
 gb|KDO48164.1| hypothetical protein CISIN_1g032113mg [Citrus sinensis]
Length=147

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (53%), Gaps = 11/112 (10%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D +G+F    +F+  N++  KW+ L  V ++ L F+LA++++       YDSD
Sbjct  42   WEEDFPEDPSGSFTQFKDFIRSNFQFCKWIGLSIVFVQGLSFILAVILKTLGPQRYYDSD  101

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            D+   G     R P++ +    P  V G PV G       RNDAW  R+ EK
Sbjct  102  DDCDPGTD---RVPLLRDVVHPPTYVVGDPVYG------PRNDAWPIRVDEK  144



>emb|CDY31986.1| BnaA07g00090D [Brassica napus]
Length=267

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
            +W+K++P D TG  + +  F+EDN  I KWV    VV++ L  LLA+V+RA   P   + 
Sbjct  153  QWEKDLPYDPTGELNSLRAFIEDNIDICKWVGAAVVVVQLLSLLLAMVLRAMVSPKRPEL  212

Query  402  DDEY-IGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
            DDE     PR +   P++ ++      G          PS+++ WS+R+REKYGL+ S+ 
Sbjct  213  DDEEDFENPRSRAWDPLLGSQANQASAG----------PSKSENWSSRIREKYGLNQSQ-  261

Query  225  TYNP  214
              NP
Sbjct  262  AVNP  265



>gb|ADE77737.1| unknown [Picea sitchensis]
Length=236

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 7/108 (6%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG FD +  FL +N+ I KWV L  ++L+ L  LLA+++RA       D D
Sbjct  135  WEEDFPDDPTGQFDQVKNFLRENFDICKWVGLTVLILQVLSVLLAMILRAVGPFTGNDDD  194

Query  399  DEYIGGP-RQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARM  259
             +    P R  +RQP +  +   P T  P     + RPS+ND WS R+
Sbjct  195  SDDDYVPSRLDLRQPFL--KSSIPQTTAPP----ESRPSQNDGWSRRL  236



>gb|KDO36449.1| hypothetical protein CISIN_1g035193mg [Citrus sinensis]
Length=70

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 8/56 (14%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA--------LMFLLALVV  436
            +K EIP DRTG+F+MIY+FL +NW IVKWVALG V+L+         L F  ALVV
Sbjct  13   FKHEIPADRTGDFNMIYDFLRENWNIVKWVALGVVILQNRFRMGRVDLTFRFALVV  68



>gb|KDP24147.1| hypothetical protein JCGZ_25804 [Jatropha curcas]
Length=220

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 66/112 (59%), Gaps = 13/112 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D TG+F+   +F+  N+++ KW+ L  V ++ L FLLAL+++A      YDSD
Sbjct  114  WEQDFPKDPTGSFNQFKDFIRSNFEMCKWIGLSIVSVQGLSFLLALLLKALGPHQYYDSD  173

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEY   P    R P++NN    P  V G PV G      S++D+WS R+ EK
Sbjct  174  DEY--APD---RVPLLNNAVIPPPYVVGNPVVG------SKSDSWSVRINEK  214



>ref|XP_010488999.1| PREDICTED: tetraspanin-19-like [Camelina sativa]
Length=219

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 13/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN-RPA-DYD  406
            WK++ P D TG F    EF+E N+KI KW+ L  V ++ L  LLA++++A    P   YD
Sbjct  114  WKQDFPEDPTGAFHHFSEFIESNFKICKWIGLAIVCVQGLSVLLAMLLKALGPHPHRHYD  173

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDDEY           + + RQ  P V G P+ G       +  AW+ R+ E+
Sbjct  174  SDDEY----NVSTVALLQDARQPPPYVVGEPMYG------PKPGAWTVRINER  216



>ref|XP_006298516.1| hypothetical protein CARUB_v10014594mg [Capsella rubella]
 gb|EOA31414.1| hypothetical protein CARUB_v10014594mg [Capsella rubella]
Length=219

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 13/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN-RPA-DYD  406
            WK++ P D +G F    +F+E N+KI KW+ L  V ++AL  LLA++++A    P   YD
Sbjct  114  WKEDFPEDPSGAFHHFSKFIESNFKICKWIGLAIVCIQALSVLLAMLLKALGPHPHRHYD  173

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDDEY           + + RQ  P V G P+ G      ++  AW+ R+ E+
Sbjct  174  SDDEY----NVSTVALLQDARQPPPYVVGEPMYG------AKPGAWTVRINER  216



>ref|XP_011085968.1| PREDICTED: tetraspanin-19 [Sesamum indicum]
Length=214

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 15/114 (13%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--YD  406
            W+++ P D TG FD +  F++DN+ I KW+ LG V L+ +  LLA++++A     +  Y+
Sbjct  109  WQEDFPDDPTGYFDQLKNFIKDNFDICKWIGLGVVALQGISMLLAMILKALGPHPERYYE  168

Query  405  SDDEYIGGPRQQIRQPIMNNRQ--QAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDD+Y+       R P++ N    Q  V   P  G       ++DAW+ R+  K
Sbjct  169  SDDDYLPD-----RVPLLKNYVPPQPYVVSDPAYGV------KSDAWNIRINSK  211



>ref|XP_008796411.1| PREDICTED: tetraspanin-18-like isoform X2 [Phoenix dactylifera]
Length=217

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 11/113 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W++++P D TG       F+++N  I KWVA+  +V++A   LLA+++RA  A R  DY
Sbjct  112  HWEEDLPYDSTGELKRFCAFIKENMDICKWVAVTVIVIQAFSLLLAMILRAMVAARRVDY  171

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            DSD++++      IR+P+++  Q  P       G+   +   +D  S +MR+K
Sbjct  172  DSDEDFV-----VIRRPLLDP-QGGPSYATTSVGS---KGIHSDFLSPQMRQK  215



>ref|XP_002884219.1| hypothetical protein ARALYDRAFT_480909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60478.1| hypothetical protein ARALYDRAFT_480909 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 13/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN-RPA-DYD  406
            WKK+ P D +G F    +F+E N+KI KW+ L  V ++ L  LLA++++A    P   YD
Sbjct  114  WKKDFPEDPSGAFHQFSKFIESNFKICKWIGLSIVCVQGLSVLLAMLLKALGPHPYRHYD  173

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDDEY           + + RQ  P V G P+ G      ++  AW+ R+ E+
Sbjct  174  SDDEY----NVSTVALLQDGRQLPPYVVGEPMYG------AKPGAWTVRINER  216



>ref|XP_009101995.1| PREDICTED: tetraspanin-19 [Brassica rapa]
 emb|CDY31941.1| BnaA07g00540D [Brassica napus]
Length=214

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 11/111 (10%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK++ P D TG F    +F+E N+KI +W+ L  V ++    LLA++++A      YDSD
Sbjct  111  WKQDFPEDPTGAFYRFSKFVESNYKICRWIGLSIVSVQGASVLLAMLLKALGPHRHYDSD  170

Query  399  DEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEY       +R    + RQ  P V G P+ G       + D+W+ R+ E+
Sbjct  171  DEYDVSTVALLR----DARQPHPYVVGEPIYG------PKPDSWTVRINER  211



>gb|EYU26161.1| hypothetical protein MIMGU_mgv1a013675mg [Erythranthe guttata]
Length=213

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 63/112 (56%), Gaps = 12/112 (11%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--YD  406
            W+++ P D +GN D + +F++DN+ I KW+ L  + L+AL  LLA++++A     +  Y+
Sbjct  109  WQEDFPADPSGNLDHLKDFIKDNFDICKWIGLMVLALQALSMLLAMILKALGPHPERYYE  168

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDDEY+       R P++ N    P T V    T      +NDAW+ R+  K
Sbjct  169  SDDEYLPD-----RVPLLKN-YVPPQTYV----TEPAYAVKNDAWNIRINSK  210



>ref|XP_006409011.1| hypothetical protein EUTSA_v10002095mg [Eutrema salsugineum]
 gb|ESQ50464.1| hypothetical protein EUTSA_v10002095mg [Eutrema salsugineum]
Length=217

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 11/111 (10%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            WK++ P D +G F    +F+E N+KI +W+ L  V ++ +  LLA++++A      YDSD
Sbjct  114  WKEDFPEDPSGAFHQFSKFIESNFKICRWIGLSIVCVQGVSVLLAMLLKALGPHRHYDSD  173

Query  399  DEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMREK  250
            DEY       +R    + RQ  P V G P+ G      ++ ++W  R+ E+
Sbjct  174  DEYNESTVALLR----DARQPPPYVVGEPIYG------AKPESWRVRINER  214



>ref|XP_006447344.1| hypothetical protein CICLE_v10018057mg, partial [Citrus clementina]
 gb|ESR60584.1| hypothetical protein CICLE_v10018057mg, partial [Citrus clementina]
Length=169

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (53%), Gaps = 11/112 (10%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSD  400
            W+++ P D +G+F    +F+  N++  KW+ L  V ++ L F+LA++++       YDSD
Sbjct  67   WEEDFPEDPSGSFTQFKDFIRSNFQFCKWIGLSIVFVQGLSFILAVILKTLGPQRYYDSD  126

Query  399  DEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            D+   G     R P++ +    P  V G PV G       RNDAW  R+ EK
Sbjct  127  DDCDPGTD---RVPLLRDVVHPPTYVVGDPVYG------PRNDAWPIRVDEK  169



>ref|XP_001775784.1| predicted protein [Physcomitrella patens]
 gb|EDQ59323.1| predicted protein, partial [Physcomitrella patens]
Length=179

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 50/80 (63%), Gaps = 8/80 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN---RPAD  412
             W++++P D TG  D + EF+E+N  I KWVALG +++EAL  L A  +RA +   R + 
Sbjct  105  HWRQDLPDDPTGQLDKVEEFVEENLSICKWVALGVLIIEALGLLFASTLRAISADPRRSG  164

Query  411  YDSDDEYIGGPRQQIRQPIM  352
            YDSD+E    P    RQP++
Sbjct  165  YDSDEEL--APT---RQPLL  179



>emb|CDY65849.1| BnaCnng48870D [Brassica napus]
Length=269

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYD-  406
            +W+K++P D TG  + +  F+EDN  I KWV    +V++ L  LLA+V+RA   P   + 
Sbjct  155  QWEKDLPYDPTGELNSLRAFIEDNIDICKWVGAAVLVVQLLSLLLAMVLRAMVSPKRPEL  214

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
             D+E    PR +   P++ ++      G          PS+++ WS+R+REKYGL+ S+ 
Sbjct  215  GDEEDFENPRSRAWDPLLGSQANQASAG----------PSKSENWSSRIREKYGLNQSQ-  263

Query  225  TYNP  214
              NP
Sbjct  264  AVNP  267



>ref|NP_001144543.1| uncharacterized protein LOC100277543 [Zea mays]
 gb|ACG41295.1| hypothetical protein [Zea mays]
Length=202

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  409
             W +E+P DRTG    +  F+ +N  + KWVAL    ++AL  LLA+ +RA  + R  DY
Sbjct  122  HWIQELPEDRTGELHNLLSFIHNNLDLCKWVALAIFAMQALSLLLAMTLRAMLSARTMDY  181

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAP  331
            DSD++++      IR+P++  +  AP
Sbjct  182  DSDEDFV-----VIRRPLLVAQPPAP  202



>gb|KDO48165.1| hypothetical protein CISIN_1g032113mg [Citrus sinensis]
 gb|KDO48166.1| hypothetical protein CISIN_1g032113mg [Citrus sinensis]
Length=116

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 11/111 (10%)
 Frame = -1

Query  576  KKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDD  397
             ++ P D +G+F    +F+  N++  KW+ L  V ++ L F+LA++++       YDSDD
Sbjct  12   HQDFPEDPSGSFTQFKDFIRSNFQFCKWIGLSIVFVQGLSFILAVILKTLGPQRYYDSDD  71

Query  396  EYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            +   G     R P++ +    P  V G PV G       RNDAW  R+ EK
Sbjct  72   DCDPG---TDRVPLLRDVVHPPTYVVGDPVYG------PRNDAWPIRVDEK  113



>gb|KDO48167.1| hypothetical protein CISIN_1g032113mg [Citrus sinensis]
Length=132

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 11/111 (10%)
 Frame = -1

Query  576  KKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDD  397
             ++ P D +G+F    +F+  N++  KW+ L  V ++ L F+LA++++       YDSDD
Sbjct  12   HQDFPEDPSGSFTQFKDFIRSNFQFCKWIGLSIVFVQGLSFILAVILKTLGPQRYYDSDD  71

Query  396  EYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMREK  250
            +   G     R P++ +    P  V G PV G       RNDAW  R+ EK
Sbjct  72   DCDPG---TDRVPLLRDVVHPPTYVVGDPVYG------PRNDAWPIRVDEK  113



>gb|AAD20921.1| hypothetical protein [Arabidopsis thaliana]
Length=123

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 13/110 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN-RPA-DYD  406
            WKK+ P D +G F    +F+E N+KI KW+ L  V ++ L  L+A++++A    P   YD
Sbjct  16   WKKDFPEDPSGAFHQFSKFIESNFKICKWIGLSIVCVQGLSVLIAMLLKALGPHPHRHYD  75

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARM  259
            SDDEY           + + RQ  P V G P+ G      ++  AW+ R+
Sbjct  76   SDDEY----NVSTVALLQDARQPPPYVVGEPMYG------AKPGAWTVRL  115



>ref|XP_010935654.1| PREDICTED: tetraspanin-19-like [Elaeis guineensis]
Length=212

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 14/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            W+++ P D TG FD + +F+  N+++ KW+ L  V  +AL   LA+V+RA   +  + YD
Sbjct  108  WEEDFPEDTTGKFDELKDFVRSNFEMCKWIGLLVVAAQALSIFLAIVLRALGPDHGSYYD  167

Query  405  SDDEYIGGPRQQIRQPIMNNR-QQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDD+ +       R P++ N+    P T  P   T      + D+W+ R+ EK
Sbjct  168  SDDDIVPA-----RLPLLRNQVHHTPYTAEPNLST------KKDSWNVRIPEK  209



>gb|KHG12596.1| Diacylglycerol kinase eta [Gossypium arboreum]
Length=288

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 68/125 (54%), Gaps = 8/125 (6%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA---ANRPADY  409
            W+K++P D TG  D    F+EDN  I KWV +  V+++AL  L+A+++RA   A R    
Sbjct  164  WEKDLPFDPTGEIDSFRSFVEDNVDICKWVGISVVIIQALAMLVAIILRAMVSARRRDID  223

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK-YGLDTS  232
            D D++     R +  +P++N +     T    +   D R +R+D W +++REK  GLD +
Sbjct  224  DEDEDDYESIRGRTWEPLLNPQSSHSST----SAKGDGRGTRSDVWGSQIREKVIGLDFA  279

Query  231  EFTYN  217
                N
Sbjct  280  VLLCN  284



>ref|NP_973494.1| tetraspanin family protein [Arabidopsis thaliana]
 gb|AEC07063.1| tetraspanin family protein [Arabidopsis thaliana]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 59/112 (53%), Gaps = 13/112 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN-RPA-DYD  406
            WKK+ P D +G F    +F+E N+KI KW+ L  V ++ L  L+A++++A    P   YD
Sbjct  24   WKKDFPEDPSGAFHQFSKFIESNFKICKWIGLSIVCVQGLSVLIAMLLKALGPHPHRHYD  83

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMRE  253
            SDDEY           + + RQ  P V G P+ G      ++  AW+ R+ +
Sbjct  84   SDDEY----NVSTVALLQDARQPPPYVVGEPMYG------AKPGAWTVRLMK  125



>ref|XP_006377340.1| hypothetical protein POPTR_0011s05050g [Populus trichocarpa]
 gb|ERP55137.1| hypothetical protein POPTR_0011s05050g [Populus trichocarpa]
Length=231

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (52%), Gaps = 15/112 (13%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            W+K++P D TG F    EF+E N+   KW+A+  ++++    LLA+ +RA   N  ++YD
Sbjct  114  WEKDLPEDPTGRFHDFREFVESNFDFFKWIAMFIILVQGFSILLAMTLRALGPNNGSNYD  173

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSARMR  256
             D+EY          P++N   Q P  V G P          +NDAW+ R+ 
Sbjct  174  IDEEYTSA-----TLPLINPHSQTPPYVVGEP------RFSIKNDAWNVRIH  214



>ref|NP_973493.1| tetraspanin family protein [Arabidopsis thaliana]
 gb|AEC07064.1| tetraspanin family protein [Arabidopsis thaliana]
Length=180

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 59/112 (53%), Gaps = 13/112 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN-RPA-DYD  406
            WKK+ P D +G F    +F+E N+KI KW+ L  V ++ L  L+A++++A    P   YD
Sbjct  73   WKKDFPEDPSGAFHQFSKFIESNFKICKWIGLSIVCVQGLSVLIAMLLKALGPHPHRHYD  132

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMRE  253
            SDDEY           + + RQ  P V G P+ G      ++  AW+ R+ +
Sbjct  133  SDDEY----NVSTVALLQDARQPPPYVVGEPMYG------AKPGAWTVRLMK  174



>ref|XP_008802328.1| PREDICTED: tetraspanin-19-like [Phoenix dactylifera]
Length=212

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 63/114 (55%), Gaps = 14/114 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            W+++ P D TG F  + +F+  N+++ KW+ L  V  +AL   LA+V+RA   +  + YD
Sbjct  108  WEEDFPEDPTGKFGELKDFVRSNFEMCKWIGLLVVAAQALSIFLAIVLRALGPDHGSYYD  167

Query  405  SDDEYIGGPRQQIRQPIMNNR-QQAPVTGVPVAGTLDXRPSRNDAWSARMREKY  247
            SDD+ +       R P++ N+  + P T  P   T      +ND+W+ R+ E++
Sbjct  168  SDDDTVPA-----RLPLLRNQAHRTPYTAEPNLST------KNDSWNVRIHERF  210



>ref|XP_006594069.1| PREDICTED: tetraspanin-18-like isoform X2 [Glycine max]
Length=227

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 12/127 (9%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPADYD  406
            W+K+IP D TG  D +  F+EDN  I  WV +  +V++  +L+  L L    + R AD+D
Sbjct  108  WEKDIPLDPTGQLDELRAFIEDNIDICTWVGIAVLVVQALSLLLALILRATVSARRADFD  167

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTL-DXRPSRNDAWSARMREKYGLDTS-  232
             +D Y    R +  +P++N     P  G P   +  D   + +D WS+RMR+KYGL+   
Sbjct  168  YEDGY--DVRGRSWEPLLN-----PQPGQPSGSSKGDNSGNHSDFWSSRMRQKYGLNHGG  220

Query  231  -EFTYNP  214
             +++Y P
Sbjct  221  DKYSYQP  227



>ref|XP_010495917.1| PREDICTED: tetraspanin-18-like [Camelina sativa]
Length=270

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (51%), Gaps = 11/124 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA-ANRPADYD  406
             W+K++P D TG    +  F+E+N  I KWV +  V ++ L  LLA+V+RA  + P    
Sbjct  155  HWEKDLPYDPTGELSTLRAFIEENIDICKWVGIAVVAVQLLSLLLAMVLRAMVSTPKPEL  214

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
             ++E    PR +   P++           P         S+ + WS+R+REKYGL+ S+ 
Sbjct  215  DEEEGYENPRVRAYDPLLG----------PQGNQASGGSSKIENWSSRIREKYGLNQSQA  264

Query  225  TYNP  214
              NP
Sbjct  265  AVNP  268



>ref|XP_006350291.1| PREDICTED: tetraspanin-20-like isoform X2 [Solanum tuberosum]
Length=244

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 66/116 (57%), Gaps = 12/116 (10%)
 Frame = -1

Query  573  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR--AANRPADYDSD  400
            +++PTD TG    +  F++ N  + KW+ +  VV++A    LA+V+R   ++   +YD +
Sbjct  124  EDLPTDPTGELHSLRTFIQQNMDVCKWIGIVVVVIQAFSLFLAVVLRTLVSSPKLNYDME  183

Query  399  DEY--IGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLD  238
             +Y  +G    + R+P+++ R  +  +G+      D R   +D WS+RMREKY LD
Sbjct  184  GDYDVVG----RTREPLLDPR-LSQTSGLAKG---DARGGHSDIWSSRMREKYHLD  231



>ref|XP_010240620.1| PREDICTED: tetraspanin-19 [Brachypodium distachyon]
Length=215

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 14/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN--RPADYD  406
            W+++ P D +G FD    FL  N++I +WV L  V  +AL  +LA+V+RA    R  DYD
Sbjct  111  WEEDFPNDPSGKFDEFKNFLRSNFEICEWVGLLVVAAQALSIILAMVLRALGPEREIDYD  170

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSR-NDAWSARMREK  250
            SDD+ +       R P++ N+ Q        A  ++   SR +D+WS R+ +K
Sbjct  171  SDDDAVPA-----RLPLLRNQAQHG------ANYVEPNLSRSSDSWSVRILDK  212



>ref|XP_010489078.1| PREDICTED: tetraspanin-18-like [Camelina sativa]
Length=270

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (51%), Gaps = 11/124 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA-ANRPADYD  406
             W+K++P D TG    +  F+E+N  I KWV +  V ++ L  LLA+V+RA  + P    
Sbjct  155  HWEKDLPYDPTGELSSLRAFIEENIDICKWVGIAVVAVQLLSLLLAMVLRAMVSTPKPEL  214

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
             ++E    PR +   P++           P         S+ + WS+R+REKYGL+ S+ 
Sbjct  215  DEEEGYENPRVRAYDPLLG----------PQGNQASGGSSKIENWSSRIREKYGLNQSQA  264

Query  225  TYNP  214
              NP
Sbjct  265  AVNP  268



>ref|XP_006412912.1| hypothetical protein EUTSA_v10025947mg [Eutrema salsugineum]
 gb|ESQ54365.1| hypothetical protein EUTSA_v10025947mg [Eutrema salsugineum]
Length=278

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 13/115 (11%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADY  409
             W+K++P D TG    +  F+E N  I KWV +  V ++ L  L+A+V+RA   P  +++
Sbjct  164  HWEKDLPYDPTGELTSLRAFIEANIDICKWVGIVVVAVQLLSLLMAMVLRAMVSPRQSEF  223

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYG  244
            D +D+Y   P  + R+ ++           P A       S  D W +R+REKYG
Sbjct  224  DDEDDY-ENPMSRARENLLG----------PQANQTSSGSSNIDNWRSRIREKYG  267



>ref|XP_008352453.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=198

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  457
            W+ EIPTD +G+F+MIY FL+ +W IV+WVALGAVV E ++
Sbjct  138  WEDEIPTDSSGDFEMIYAFLKAHWTIVRWVALGAVVFEVIL  178



>ref|XP_010467772.1| PREDICTED: tetraspanin-19-like [Camelina sativa]
Length=129

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 13/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            WK++ P D +G F    +F+E N+KI KW+ L  V ++ L  LLA++++A   +    Y+
Sbjct  24   WKEDFPEDPSGAFHHFSKFIESNFKICKWIGLAIVCVQGLSVLLAMLLKALGPHPHLHYE  83

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP-VTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDDEY           + + RQ  P V G P+ G       +  AW+ R+ E+
Sbjct  84   SDDEY----NVSTVALLQDARQPPPYVVGEPMYG------PKPGAWTVRINER  126



>ref|XP_010684825.1| PREDICTED: tetraspanin-20 [Beta vulgaris subsp. vulgaris]
Length=323

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 18/136 (13%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
             W K++P D TG  + +  F+E+N  I KW+ L  + ++AL  LL+LV+RA       DS
Sbjct  196  HWDKDLPYDPTGELEKLRSFVEENVDICKWLGLTLLTVQALSLLLSLVLRAMISSQRKDS  255

Query  402  DDE---YIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTS  232
            D E    + G R  IR+P++N++    VT        + R + +D W+ R+R+KYGL+  
Sbjct  256  DAEDNDVVAGDR--IREPLLNSQSNQSVTTKS-----EGRGTFSDIWTTRIRQKYGLNN-  307

Query  231  EFTYNPYESNRYQPTN  184
                   ES+R Q  N
Sbjct  308  -------ESSRNQSLN  316



>ref|XP_010416099.1| PREDICTED: tetraspanin-18 [Camelina sativa]
Length=271

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (51%), Gaps = 11/124 (9%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA-ANRPADYD  406
             W+K++P D TG    +  F+E+N  I KWV +  V ++ L  LLA+V+RA  + P    
Sbjct  156  HWEKDLPYDPTGEISSLRAFIEENIDICKWVGIAVVAVQLLSLLLAMVLRAMVSTPKPEL  215

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSEF  226
             ++E    PR +   P++           P         S+ + WS+R+REKYGL+ S+ 
Sbjct  216  DEEEGYENPRVRAYDPLLG----------PQGNQASGGSSKIENWSSRIREKYGLNQSQA  265

Query  225  TYNP  214
              NP
Sbjct  266  AVNP  269



>gb|KHN05904.1| hypothetical protein glysoja_026492 [Glycine soja]
Length=244

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 70/133 (53%), Gaps = 17/133 (13%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPADYD  406
            W+K+IP D TG  D +  F+EDN     WV +  +V++  +L+  L L    ++R AD+D
Sbjct  126  WEKDIPFDPTGQLDELRAFIEDNIDTCTWVGIAVLVIQALSLLLALILRATVSSRRADFD  185

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTL-DXRPSRNDAWSARMREKYGLDTSE  229
             +D Y    R +  +P++N     P  G P   +  D   + +D WSARMREKYGL    
Sbjct  186  YEDGY--DVRGRSWEPLLN-----PQPGQPSGSSKGDNSGNHSDFWSARMREKYGL----  234

Query  228  FTYNPYESNRYQP  190
               N  + + YQP
Sbjct  235  ---NHGDKSSYQP  244



>emb|CDY06872.1| BnaC01g09710D [Brassica napus]
Length=273

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 57/118 (48%), Gaps = 9/118 (8%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  403
             W+K++P D TG    +  F+E N  I KWV +G V ++ L  LLA+V+RA   P   D 
Sbjct  159  HWEKDLPYDPTGELTSLRAFIEANIDICKWVGVGVVAIQLLSLLLAMVLRAMVSPRQSDL  218

Query  402  DDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            DDE           PI   R+       P A       S  D W +R+REKYGL+  +
Sbjct  219  DDE------DDYENPINRARENLL---APQANQTSSGSSNIDNWRSRIREKYGLNNGQ  267



>dbj|BAK03197.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=130

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 60/113 (53%), Gaps = 14/113 (12%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            W+++ P D +G FD    F+  N+ + +WVAL  V  + L  +LA+V+RA   +   +YD
Sbjct  25   WEEDFPDDPSGKFDEFKHFVRSNFDVCEWVALSVVAAQVLSIILAMVLRALGPDSEIEYD  84

Query  405  SDDEYIGGPRQQIRQPIM-NNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDD+ +       R P++ ++ Q +P  G P        P R D+W  R+ +K
Sbjct  85   SDDDAVPA-----RLPLLRSHAQNSPNYGQP------NSPRRIDSWHVRILDK  126



>emb|CDY35218.1| BnaA01g08130D [Brassica napus]
Length=273

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 13/120 (11%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADY  409
             W+K++P D TG    +  F+E N  I KWV +G V ++ L  LLA+V+RA   P  +D 
Sbjct  159  HWEKDLPYDPTGELTSLRAFIEANIDICKWVGVGVVAVQLLSLLLAMVLRAMVSPRQSDL  218

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D +D+Y   P  + R+ ++           P A       S  D W +R+REKYGL+  +
Sbjct  219  DDEDDY-ENPINRARENLL----------APQANQTSSGSSNIDNWRSRIREKYGLNNGQ  267



>ref|XP_009129299.1| PREDICTED: tetraspanin-20 [Brassica rapa]
Length=273

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 13/120 (11%)
 Frame = -1

Query  582  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADY  409
             W+K++P D TG    +  F+E N  I KWV +G V ++ L  LLA+V+RA   P  +D 
Sbjct  159  HWEKDLPYDPTGELTSLRAFIEANIDICKWVGVGVVAVQLLSLLLAMVLRAMVSPRQSDL  218

Query  408  DSDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREKYGLDTSE  229
            D +D+Y   P  + R+ ++           P A       S  D W +R+REKYGL+  +
Sbjct  219  DDEDDY-ENPINRARENLL----------APQANQTSSGSSNIDNWRSRIREKYGLNNGQ  267



>ref|XP_003542449.1| PREDICTED: tetraspanin-18-like isoform X1 [Glycine max]
Length=245

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 12/127 (9%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPADYD  406
            W+K+IP D TG  D +  F+EDN  I  WV +  +V++  +L+  L L    + R AD+D
Sbjct  126  WEKDIPLDPTGQLDELRAFIEDNIDICTWVGIAVLVVQALSLLLALILRATVSARRADFD  185

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTL-DXRPSRNDAWSARMREKYGLDTS-  232
             +D Y    R +  +P++N     P  G P   +  D   + +D WS+RMR+KYGL+   
Sbjct  186  YEDGY--DVRGRSWEPLLN-----PQPGQPSGSSKGDNSGNHSDFWSSRMRQKYGLNHGG  238

Query  231  -EFTYNP  214
             +++Y P
Sbjct  239  DKYSYQP  245



>ref|XP_006377339.1| hypothetical protein POPTR_0011s05050g [Populus trichocarpa]
 gb|ERP55136.1| hypothetical protein POPTR_0011s05050g [Populus trichocarpa]
Length=213

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 15/109 (14%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            W+K++P D TG F    EF+E N+   KW+A+  ++++    LLA+ +RA   N  ++YD
Sbjct  114  WEKDLPEDPTGRFHDFREFVESNFDFFKWIAMFIILVQGFSILLAMTLRALGPNNGSNYD  173

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAP--VTGVPVAGTLDXRPSRNDAWSA  265
             D+EY          P++N   Q P  V G P          +NDAW+A
Sbjct  174  IDEEYTSA-----TLPLINPHSQTPPYVVGEPRFSI------KNDAWNA  211



>ref|XP_006653035.1| PREDICTED: tetraspanin-19-like [Oryza brachyantha]
Length=217

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 11/112 (10%)
 Frame = -1

Query  579  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYD  406
            W+++ P D +G F+   +F+  N ++ +W+ L  V  + L  +L +V+RA   +R  DYD
Sbjct  112  WEEDFPDDPSGKFEEFKDFVRSNSEMCEWIGLSVVAAQVLSIILGMVLRALGPDRECDYD  171

Query  405  SDDEYIGGPRQQIRQPIMNNRQQAPVTGVPVAGTLDXRPSRNDAWSARMREK  250
            SDD+    P    R P++ N+ Q    G+  A  +   P  +D+WS R+ +K
Sbjct  172  SDDD----PSVPARLPLLRNQSQ---HGINYAEHI--LPQSSDSWSVRILDK  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455