BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047N10

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002515854.1|  molybdopterin biosynthesis protein, putative       339   2e-108   Ricinus communis
ref|XP_006446684.1|  hypothetical protein CICLE_v10014503mg             332   1e-107   Citrus clementina [clementine]
gb|KDO47642.1|  hypothetical protein CISIN_1g0059002mg                  331   1e-107   Citrus sinensis [apfelsine]
gb|KDO47640.1|  hypothetical protein CISIN_1g0059002mg                  332   3e-107   Citrus sinensis [apfelsine]
ref|XP_010031620.1|  PREDICTED: molybdopterin biosynthesis protei...    335   6e-107   Eucalyptus grandis [rose gum]
ref|XP_011090256.1|  PREDICTED: molybdopterin biosynthesis protei...    333   2e-106   Sesamum indicum [beniseed]
ref|XP_006446683.1|  hypothetical protein CICLE_v10014503mg             332   8e-106   Citrus clementina [clementine]
ref|XP_006470155.1|  PREDICTED: molybdopterin biosynthesis protei...    332   1e-105   Citrus sinensis [apfelsine]
ref|XP_009765762.1|  PREDICTED: molybdopterin biosynthesis protei...    330   3e-105   Nicotiana sylvestris
dbj|BAF00362.1|  molybdopterin biosynthesis CNX1 protein                318   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006362730.1|  PREDICTED: molybdopterin biosynthesis protei...    330   4e-105   Solanum tuberosum [potatoes]
ref|XP_004228477.1|  PREDICTED: molybdopterin biosynthesis protei...    330   4e-105   Solanum lycopersicum
gb|KDP42916.1|  hypothetical protein JCGZ_23858                         330   5e-105   Jatropha curcas
gb|KJB55513.1|  hypothetical protein B456_009G080100                    329   9e-105   Gossypium raimondii
ref|XP_006362729.1|  PREDICTED: molybdopterin biosynthesis protei...    330   1e-104   
gb|KHG12135.1|  Molybdopterin biosynthesis CNX1 -like protein           328   2e-104   Gossypium arboreum [tree cotton]
ref|XP_009601464.1|  PREDICTED: molybdopterin biosynthesis protei...    328   3e-104   Nicotiana tomentosiformis
ref|XP_008451034.1|  PREDICTED: molybdopterin biosynthesis protei...    326   2e-103   Cucumis melo [Oriental melon]
ref|XP_011043840.1|  PREDICTED: molybdopterin biosynthesis protei...    324   4e-103   Populus euphratica
ref|XP_009376133.1|  PREDICTED: molybdopterin biosynthesis protei...    324   4e-103   
ref|XP_007141599.1|  hypothetical protein PHAVU_008G209600g             324   5e-103   Phaseolus vulgaris [French bean]
ref|XP_011043834.1|  PREDICTED: molybdopterin biosynthesis protei...    324   7e-103   Populus euphratica
ref|XP_007141600.1|  hypothetical protein PHAVU_008G209600g             323   2e-102   Phaseolus vulgaris [French bean]
ref|XP_006379351.1|  hypothetical protein POPTR_0009s15810g             322   3e-102   
ref|XP_002312858.1|  hypothetical protein POPTR_0009s15810g             322   5e-102   
ref|XP_004491158.1|  PREDICTED: molybdopterin biosynthesis protei...    313   7e-102   
ref|NP_001242529.1|  molybdopterin biosynthesis protein CNX1-like       321   1e-101   Glycine max [soybeans]
gb|KHN38452.1|  Molybdopterin biosynthesis protein CNX1                 320   1e-101   Glycine soja [wild soybean]
dbj|BAJ33990.1|  unnamed protein product                                317   2e-101   Eutrema halophilum
ref|XP_004491157.1|  PREDICTED: molybdopterin biosynthesis protei...    314   2e-101   
ref|XP_007015551.1|  Molybdopterin biosynthesis CNX1 protein / mo...    320   3e-101   
gb|AAA97413.1|  molybdenum cofactor biosynthesis enzyme                 320   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291534.1|  PREDICTED: molybdopterin biosynthesis protei...    318   2e-100   Fragaria vesca subsp. vesca
gb|EYU35987.1|  hypothetical protein MIMGU_mgv1a002507mg                317   3e-100   Erythranthe guttata [common monkey flower]
gb|AFW59745.1|  viviparous10                                            307   5e-100   
emb|CDX70956.1|  BnaC03g10400D                                          317   5e-100   
ref|XP_002874027.1|  hypothetical protein ARALYDRAFT_489011             317   5e-100   
ref|XP_009131833.1|  PREDICTED: molybdopterin biosynthesis protei...    317   6e-100   Brassica rapa
ref|XP_006400671.1|  hypothetical protein EUTSA_v10012894mg             317   7e-100   Eutrema salsugineum [saltwater cress]
ref|NP_197599.1|  molybdenum cofactor biosynthesis enzyme CNX1          317   7e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007015553.1|  Molybdopterin biosynthesis CNX1 protein / mo...    315   9e-100   
gb|KGN66381.1|  hypothetical protein Csa_1G600210                       312   1e-99    Cucumis sativus [cucumbers]
ref|XP_010420950.1|  PREDICTED: molybdopterin biosynthesis protei...    315   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_008787719.1|  PREDICTED: molybdopterin biosynthesis protei...    315   2e-99    Phoenix dactylifera
ref|XP_010093278.1|  Molybdopterin biosynthesis protein CNX1            315   3e-99    Morus notabilis
emb|CDP15575.1|  unnamed protein product                                315   3e-99    Coffea canephora [robusta coffee]
gb|KFK26315.1|  hypothetical protein AALP_AA8G231600                    315   3e-99    Arabis alpina [alpine rockcress]
ref|XP_010685502.1|  PREDICTED: molybdopterin biosynthesis protei...    314   5e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003617060.1|  Molybdopterin biosynthesis CNX1 protein            314   6e-99    Medicago truncatula
ref|XP_006286370.1|  hypothetical protein CARUB_v10000376mg             315   7e-99    
emb|CDX88829.1|  BnaA03g08200D                                          313   1e-98    
ref|XP_007204973.1|  hypothetical protein PRUPE_ppa002426mg             313   1e-98    Prunus persica
ref|XP_004159365.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    312   3e-98    
ref|XP_004144145.1|  PREDICTED: molybdopterin biosynthesis protei...    312   3e-98    
ref|XP_010926610.1|  PREDICTED: molybdopterin biosynthesis protei...    312   3e-98    Elaeis guineensis
ref|XP_010493217.1|  PREDICTED: molybdopterin biosynthesis protei...    312   5e-98    Camelina sativa [gold-of-pleasure]
ref|XP_009383824.1|  PREDICTED: molybdopterin biosynthesis protei...    311   6e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010520491.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    311   1e-97    Tarenaya hassleriana [spider flower]
ref|XP_010651619.1|  PREDICTED: molybdopterin biosynthesis protei...    308   2e-97    Vitis vinifera
ref|XP_002447271.1|  hypothetical protein SORBIDRAFT_06g031680          310   2e-97    
ref|XP_010454418.1|  PREDICTED: molybdopterin biosynthesis protei...    310   3e-97    Camelina sativa [gold-of-pleasure]
emb|CAN65528.1|  hypothetical protein VITISV_026358                     306   3e-97    Vitis vinifera
ref|XP_006653844.1|  PREDICTED: molybdopterin biosynthesis protei...    310   3e-97    
ref|XP_009340227.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    306   3e-97    
ref|XP_004517264.1|  PREDICTED: molybdopterin biosynthesis protei...    292   2e-96    
ref|XP_004960170.1|  PREDICTED: molybdopterin biosynthesis protei...    307   2e-96    Setaria italica
emb|CBI24388.3|  unnamed protein product                                307   3e-96    Vitis vinifera
ref|XP_002276536.1|  PREDICTED: molybdopterin biosynthesis protei...    307   3e-96    Vitis vinifera
emb|CAE04830.1|  OSJNBa0084K01.2                                        306   4e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001168286.1|  viviparous10                                       305   2e-95    Zea mays [maize]
gb|ABB30174.1|  molybdenum cofactor biosynthesis protein                305   2e-95    Zea mays [maize]
ref|XP_003580744.1|  PREDICTED: molybdopterin biosynthesis protei...    296   8e-92    Brachypodium distachyon [annual false brome]
dbj|BAJ88077.1|  predicted protein                                      291   3e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02586.1|  predicted protein                                      291   3e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF73075.1|AF268595_1  molybdenum cofactor biosynthesis protei...    291   4e-90    Hordeum vulgare [barley]
pdb|1UUY|A  Chain A, Structure Of A Molybdopterin-Bound Cnx1g Dom...    275   6e-90    Arabidopsis thaliana [mouse-ear cress]
pdb|1O8Q|A  Chain A, The Active Site Of The Molybdenum Cofactor B...    275   6e-90    Arabidopsis thaliana [mouse-ear cress]
pdb|1O8N|A  Chain A, The Active Site Of The Molybdenum Cofactor B...    274   1e-89    Arabidopsis thaliana [mouse-ear cress]
pdb|1O8O|A  Chain A, The Active Site Of The Molybdenum Cofactor B...    273   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770478.1|  predicted protein                                  284   3e-87    
gb|ABR17730.1|  unknown                                                 283   5e-87    Picea sitchensis
pdb|1UUX|A  Chain A, Structure Of A Molybdopterin-Bound Cnx1g Dom...    266   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847466.1|  hypothetical protein AMTR_s00163p00018060          279   2e-85    Amborella trichopoda
ref|XP_008231326.1|  PREDICTED: molybdopterin biosynthesis protei...    268   1e-81    
ref|XP_010926611.1|  PREDICTED: molybdopterin biosynthesis protei...    267   5e-81    
pdb|1EAV|A  Chain A, Crystal Structures Of Human Gephyrin And Pla...    251   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973522.1|  hypothetical protein SELMODRAFT_149120             265   3e-80    
ref|XP_002975554.1|  hypothetical protein SELMODRAFT_150666             264   6e-80    
gb|EMT03164.1|  Molybdopterin biosynthesis protein CNX1                 251   1e-74    
ref|XP_010031621.1|  PREDICTED: molybdopterin biosynthesis protei...    213   1e-60    
ref|XP_008385638.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...    206   2e-59    
gb|KEH28338.1|  molybdenum cofactor biosynthesis protein CNX1           204   6e-58    Medicago truncatula
gb|EPS62424.1|  hypothetical protein M569_12368                         188   8e-57    Genlisea aurea
ref|XP_009350884.1|  PREDICTED: molybdopterin biosynthesis protei...    197   2e-55    
ref|XP_007015554.1|  Molybdopterin biosynthesis CNX1 protein / mo...    197   6e-55    
ref|XP_010240846.1|  PREDICTED: molybdopterin biosynthesis protei...    177   7e-48    Nelumbo nucifera [Indian lotus]
ref|WP_036736197.1|  cytoplasmic protein                                155   4e-43    
ref|WP_013258696.1|  molybdenum cofactor synthesis domain-contain...    150   4e-41    Desulfarculus baarsii
ref|WP_006980928.1|  molybdenum cofactor synthesis domain protein       148   2e-40    Chthoniobacter flavus
gb|ACD50083.1|  molybdopterin biosynthesis enzyme                       148   2e-40    uncultured crenarchaeote MCG
emb|CAI78652.1|  molybdopterin biosynthesis enzymes                     147   4e-40    uncultured delta proteobacterium
ref|WP_009711043.1|  molybdopterin biosynthesis mog protein             146   1e-39    Thermoactinomycetaceae
pdb|1IHC|A  Chain A, X-Ray Structure Of Gephyrin N-Terminal Domain      146   1e-39    Rattus norvegicus [brown rat]
pdb|1JLJ|A  Chain A, 1.6 Angstrom Crystal Structure Of The Human ...    146   1e-39    Homo sapiens [man]
ref|WP_037464714.1|  cytoplasmic protein                                145   2e-39    
ref|WP_027356596.1|  cytoplasmic protein                                145   2e-39    Desulfofundulus thermocisternus
gb|EMS55337.1|  Molybdopterin biosynthesis protein CNX1                 154   3e-39    Triticum urartu
gb|AFM26240.1|  molybdopterin adenylyltransferase                       145   3e-39    Desulfomonile tiedjei DSM 6799
ref|WP_041287293.1|  cytoplasmic protein                                144   4e-39    
ref|WP_013626116.1|  molybdopterin adenylyltransferase                  144   8e-39    Syntrophobotulus glycolicus
ref|WP_027636642.1|  cytoplasmic protein                                143   1e-38    Clostridium butyricum
ref|WP_013707323.1|  molybdenum cofactor synthesis domain-contain...    143   1e-38    Desulfobacca acetoxidans
ref|WP_033119864.1|  cytoplasmic protein                                143   2e-38    Oscillibacter sp. ER4
gb|ABC77449.1|  hypothetical cytosolic protein                          143   2e-38    Syntrophus aciditrophicus SB
ref|WP_041584862.1|  cytoplasmic protein                                143   2e-38    Syntrophus aciditrophicus
ref|XP_008863022.1|  hypothetical protein, variant 3                    151   2e-38    Aphanomyces invadans
gb|KIE17875.1|  cytoplasmic protein                                     142   2e-38    Smithella sp. SC_K08D17
ref|WP_014355808.1|  molybdenum cofactor biosynthesis protein MoaB      142   2e-38    Acetobacterium woodii
ref|XP_008863020.1|  hypothetical protein, variant 1                    151   2e-38    Aphanomyces invadans
ref|WP_037380935.1|  MULTISPECIES: cytoplasmic protein                  142   3e-38    
ref|WP_037388918.1|  cytoplasmic protein                                142   3e-38    
ref|WP_013823924.1|  molybdenum cofactor synthesis domain-contain...    142   4e-38    
ref|WP_003425841.1|  molybdenum cofactor synthesis protein              142   5e-38    Clostridium
ref|XP_008314898.1|  PREDICTED: gephyrin-like isoform X3                151   5e-38    Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_002580709.1|  molybdenum cofactor biosynthesis protein B         141   7e-38    Clostridium butyricum
ref|XP_004881940.1|  PREDICTED: gephyrin-like                           147   8e-38    
ref|XP_008314890.1|  PREDICTED: gephyrin-like isoform X2                150   9e-38    Cynoglossus semilaevis [half-smooth tongue sole]
gb|EAW80925.1|  gephyrin, isoform CRA_c                                 147   1e-37    Homo sapiens [man]
ref|WP_041082573.1|  cytoplasmic protein                                140   1e-37    Thermotoga profunda
ref|WP_039740847.1|  cytoplasmic protein                                140   2e-37    Geobacter pickeringii
ref|WP_034122161.1|  cytoplasmic protein                                140   2e-37    
ref|WP_014117170.1|  molybdenum cofactor biosynthesis protein           140   3e-37    Oscillibacter valericigenes
ref|XP_006800724.1|  PREDICTED: gephyrin-like                           148   3e-37    Neolamprologus brichardi [lyretail cichlid]
ref|WP_040663553.1|  cytoplasmic protein                                140   3e-37    Oscillibacter ruminantium
ref|XP_005461956.1|  PREDICTED: gephyrin-like isoform X4                149   3e-37    
ref|XP_005812094.1|  PREDICTED: gephyrin-like                           149   3e-37    
ref|XP_005090818.1|  PREDICTED: uncharacterized protein LOC101848...    150   3e-37    
ref|XP_007575455.1|  PREDICTED: gephyrin-like isoform X2                149   4e-37    
ref|XP_005461953.1|  PREDICTED: gephyrin-like isoform X1                149   4e-37    
ref|XP_003962333.1|  PREDICTED: gephyrin-like isoform 1                 148   4e-37    
tpg|DAA35544.1|  TPA: hypothetical protein ZEAMMB73_028448              144   4e-37    
ref|XP_004356987.1|  Gephyrin, putative                                 140   5e-37    Acanthamoeba castellanii str. Neff
ref|XP_003707233.1|  PREDICTED: LOW QUALITY PROTEIN: gephyrin-like      147   5e-37    
ref|WP_026370918.1|  cytoplasmic protein                                139   5e-37    bacterium JKG1
ref|XP_005751787.1|  PREDICTED: gephyrin-like isoform X2                148   5e-37    Pundamilia nyererei
ref|XP_007575454.1|  PREDICTED: gephyrin-like isoform X1                148   5e-37    
ref|XP_009820958.1|  hypothetical protein, variant 1                    147   5e-37    Aphanomyces astaci
ref|XP_001627768.1|  predicted protein                                  147   5e-37    Nematostella vectensis
ref|WP_031517960.1|  cytoplasmic protein                                139   6e-37    Desulfohalotomaculum alkaliphilum
ref|NP_001125964.1|  gephyrin                                           146   6e-37    Pongo abelii [orang utan]
ref|XP_003962334.1|  PREDICTED: gephyrin-like isoform 2                 148   7e-37    Takifugu rubripes [tiger puffer]
ref|XP_007545562.1|  PREDICTED: gephyrin isoform X6                     147   8e-37    
ref|WP_015326915.1|  molybdenum cofactor synthesis domain protein       138   8e-37    Halobacteroides halobius
ref|XP_005751786.1|  PREDICTED: gephyrin-like isoform X1                148   8e-37    Pundamilia nyererei
ref|XP_004569994.1|  PREDICTED: gephyrin-like                           147   9e-37    
ref|XP_005942199.1|  PREDICTED: gephyrin-like isoform X2                148   9e-37    Haplochromis burtoni
ref|XP_005942198.1|  PREDICTED: gephyrin-like isoform X1                148   1e-36    Haplochromis burtoni
ref|XP_009820957.1|  hypothetical protein H257_00123                    146   1e-36    Aphanomyces astaci
ref|XP_010743433.1|  PREDICTED: gephyrin-like isoform X2                147   1e-36    
ref|WP_021738416.1|  molybdenum cofactor synthesis domain protein       138   1e-36    Eubacterium ramulus
ref|XP_007545554.1|  PREDICTED: gephyrin isoform X5                     147   2e-36    Poecilia formosa
ref|XP_006207020.1|  PREDICTED: gephyrin isoform X5                     147   2e-36    Vicugna pacos
ref|XP_007545546.1|  PREDICTED: gephyrin isoform X4                     147   2e-36    
ref|XP_007545531.1|  PREDICTED: gephyrin isoform X2                     147   2e-36    Poecilia formosa
ref|WP_022036283.1|  hypothetical protein                               137   2e-36    
ref|XP_010743432.1|  PREDICTED: gephyrin-like isoform X1                147   2e-36    
ref|XP_010960581.1|  PREDICTED: gephyrin isoform X6                     147   2e-36    Camelus bactrianus [camel]
ref|XP_005072876.1|  PREDICTED: gephyrin                                146   2e-36    
ref|XP_010960577.1|  PREDICTED: gephyrin isoform X2                     147   2e-36    Camelus bactrianus [camel]
ref|XP_010960579.1|  PREDICTED: gephyrin isoform X4                     147   2e-36    Camelus bactrianus [camel]
ref|XP_010960582.1|  PREDICTED: gephyrin isoform X7                     147   2e-36    Camelus bactrianus [camel]
ref|XP_007545524.1|  PREDICTED: gephyrin isoform X1                     147   2e-36    Poecilia formosa
ref|XP_010960578.1|  PREDICTED: gephyrin isoform X3                     147   2e-36    Camelus bactrianus [camel]
ref|XP_006207018.1|  PREDICTED: gephyrin isoform X3                     147   2e-36    
ref|NP_001026720.1|  gephyrin                                           146   2e-36    
ref|XP_005803171.1|  PREDICTED: gephyrin-like isoform X5                146   2e-36    
ref|XP_004624968.1|  PREDICTED: gephyrin                                146   2e-36    
ref|XP_005803170.1|  PREDICTED: gephyrin-like isoform X4                147   2e-36    
ref|XP_008301210.1|  PREDICTED: gephyrin-like                           147   2e-36    Stegastes partitus
ref|XP_010960576.1|  PREDICTED: gephyrin isoform X1                     147   2e-36    Camelus bactrianus [camel]
ref|XP_005803169.1|  PREDICTED: gephyrin-like isoform X3                147   2e-36    
ref|NP_074056.2|  gephyrin                                              146   2e-36    Rattus norvegicus [brown rat]
ref|XP_010960580.1|  PREDICTED: gephyrin isoform X5                     147   2e-36    Camelus bactrianus [camel]
ref|XP_008395704.1|  PREDICTED: gephyrin isoform X11                    147   2e-36    
emb|CAC81240.1|  gephyrin                                               146   2e-36    Homo sapiens [man]
ref|XP_009004421.1|  PREDICTED: gephyrin isoform X8                     147   2e-36    Callithrix jacchus [common marmoset]
ref|XP_008137161.1|  PREDICTED: gephyrin isoform X4                     146   2e-36    Eptesicus fuscus
ref|XP_008395700.1|  PREDICTED: gephyrin isoform X7                     147   2e-36    
ref|XP_005149323.1|  PREDICTED: gephyrin isoform X2                     146   2e-36    Melopsittacus undulatus
ref|XP_006207017.1|  PREDICTED: gephyrin isoform X2                     146   2e-36    Vicugna pacos
ref|XP_006113471.1|  PREDICTED: gephyrin isoform X2                     146   2e-36    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006515967.1|  PREDICTED: gephyrin isoform X6                     147   2e-36    Mus musculus [mouse]
ref|XP_008171028.1|  PREDICTED: gephyrin isoform X8                     146   2e-36    
ref|XP_008395699.1|  PREDICTED: gephyrin isoform X6                     147   2e-36    
ref|XP_008395702.1|  PREDICTED: gephyrin isoform X9                     147   2e-36    
ref|NP_001019389.1|  gephyrin isoform 2                                 146   2e-36    Homo sapiens [man]
ref|XP_008395694.1|  PREDICTED: gephyrin isoform X1                     147   2e-36    
ref|XP_005803167.1|  PREDICTED: gephyrin-like isoform X1                147   2e-36    
ref|XP_008395695.1|  PREDICTED: gephyrin isoform X2                     147   2e-36    
ref|XP_005343305.1|  PREDICTED: gephyrin isoform X5                     146   2e-36    
ref|XP_007184373.1|  PREDICTED: gephyrin isoform X5                     146   2e-36    Balaenoptera acutorostrata scammoni
ref|XP_005803168.1|  PREDICTED: gephyrin-like isoform X2                147   2e-36    
ref|XP_004477404.1|  PREDICTED: gephyrin                                146   3e-36    
ref|XP_005561586.1|  PREDICTED: gephyrin isoform X13                    146   3e-36    
ref|XP_010586998.1|  PREDICTED: LOW QUALITY PROTEIN: gephyrin           146   3e-36    
ref|XP_011382505.1|  PREDICTED: gephyrin isoform X3                     146   3e-36    Pteropus vampyrus
ref|XP_008395703.1|  PREDICTED: gephyrin isoform X10                    147   3e-36    
ref|XP_005267311.1|  PREDICTED: gephyrin isoform X5                     146   3e-36    Homo sapiens [man]
ref|XP_008976026.1|  PREDICTED: gephyrin isoform X4                     146   3e-36    Pan paniscus [bonobo]
ref|XP_008395698.1|  PREDICTED: gephyrin isoform X5                     147   3e-36    
ref|NP_766540.2|  gephyrin isoform 2                                    146   3e-36    Mus musculus [mouse]
dbj|BAC38476.1|  unnamed protein product                                146   3e-36    Mus musculus [mouse]
ref|XP_010807867.1|  PREDICTED: gephyrin isoform X9                     146   3e-36    
ref|XP_008395701.1|  PREDICTED: gephyrin isoform X8                     147   3e-36    
ref|XP_008395697.1|  PREDICTED: gephyrin isoform X4                     147   3e-36    
ref|XP_007525883.1|  PREDICTED: gephyrin isoform X3                     146   3e-36    Erinaceus europaeus [common hedgehog]
ref|XP_004584525.1|  PREDICTED: gephyrin isoform X3                     146   3e-36    Ochotona princeps [southern American pika]
ref|NP_001230231.1|  gephyrin                                           146   3e-36    Sus scrofa [pigs]
ref|XP_005306754.1|  PREDICTED: gephyrin isoform X7                     146   3e-36    Chrysemys picta bellii
ref|XP_008850363.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Nannospalax galili
ref|XP_008137160.1|  PREDICTED: gephyrin isoform X3                     146   3e-36    
ref|XP_004397630.1|  PREDICTED: gephyrin isoform 3                      146   3e-36    Odobenus rosmarus divergens
ref|WP_035612536.1|  molybdopterin adenylyltransferase                  137   3e-36    Haloferula sp. BvORR071
ref|XP_008395696.1|  PREDICTED: gephyrin isoform X3                     147   3e-36    
ref|XP_005961617.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Pantholops hodgsonii [Tibetan antelope]
ref|XP_003586638.1|  PREDICTED: gephyrin isoform X8                     146   3e-36    Bos taurus [bovine]
ref|XP_008137159.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Eptesicus fuscus
ref|XP_006973191.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Peromyscus maniculatus bairdii
ref|XP_011382489.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    Pteropus vampyrus
ref|XP_004837433.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Heterocephalus glaber [naked mole rat]
ref|XP_004426312.1|  PREDICTED: gephyrin isoform 1                      146   3e-36    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003435079.1|  PREDICTED: gephyrin isoformX1                      146   3e-36    Canis lupus familiaris [dogs]
ref|XP_007614396.1|  PREDICTED: uncharacterized protein LOC100762...    144   3e-36    
ref|XP_007184374.1|  PREDICTED: gephyrin isoform X6                     146   3e-36    Balaenoptera acutorostrata scammoni
dbj|BAA92623.1|  KIAA1385 protein                                       146   3e-36    
ref|XP_004837432.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    
ref|XP_005877967.1|  PREDICTED: gephyrin isoform X3                     146   3e-36    Myotis brandtii
ref|XP_005399155.1|  PREDICTED: gephyrin-like isoform X6                146   3e-36    Chinchilla lanigera
ref|XP_011281583.1|  PREDICTED: gephyrin isoform X4                     146   3e-36    Felis catus [cat]
ref|XP_007940487.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Orycteropus afer afer
ref|XP_004612402.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Sorex araneus [Eurasian shrew]
ref|XP_004584524.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Ochotona princeps [southern American pika]
ref|XP_001369816.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    Monodelphis domestica
ref|XP_007449084.1|  PREDICTED: gephyrin isoform X3                     146   3e-36    Lipotes vexillifer [baiji]
ref|XP_004371016.1|  PREDICTED: gephyrin isoform 1                      146   3e-36    Trichechus manatus latirostris
ref|XP_006113470.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_004739021.1|  PREDICTED: gephyrin isoform X5                     146   3e-36    Mustela putorius furo [black ferret]
ref|WP_041720516.1|  cytoplasmic protein                                137   3e-36    
ref|XP_010643623.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    Fukomys damarensis [Damara mole rat]
ref|NP_065857.1|  gephyrin isoform 1                                    146   3e-36    Homo sapiens [man]
ref|XP_007184369.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    Balaenoptera acutorostrata scammoni
ref|XP_006734710.1|  PREDICTED: gephyrin                                146   3e-36    Leptonychotes weddellii
ref|XP_005399151.1|  PREDICTED: gephyrin-like isoform X2                146   3e-36    
dbj|BAI68421.1|  gephyrin1                                              146   3e-36    Danio rerio [leopard danio]
ref|XP_005230781.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    Falco peregrinus [peregrine]
ref|XP_005149322.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    Melopsittacus undulatus
ref|XP_004397629.1|  PREDICTED: gephyrin isoform 2                      146   3e-36    Odobenus rosmarus divergens
ref|XP_007985215.1|  PREDICTED: gephyrin isoform X26                    146   3e-36    Chlorocebus sabaeus
ref|XP_002754063.1|  PREDICTED: gephyrin isoform X9                     146   3e-36    Callithrix jacchus [common marmoset]
ref|XP_005561591.1|  PREDICTED: gephyrin isoform X18                    146   3e-36    
ref|XP_005004834.1|  PREDICTED: LOW QUALITY PROTEIN: gephyrin           146   3e-36    Cavia porcellus [guinea pig]
dbj|BAG37944.1|  unnamed protein product                                146   3e-36    Homo sapiens [man]
ref|XP_005561587.1|  PREDICTED: gephyrin isoform X14                    146   3e-36    Macaca fascicularis [crab eating macaque]
ref|NP_666077.2|  gephyrin isoform 1                                    146   3e-36    Mus musculus [mouse]
ref|XP_005322862.1|  PREDICTED: gephyrin isoform X4                     146   3e-36    
ref|XP_008976023.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    Pan paniscus [bonobo]
ref|XP_009004415.1|  PREDICTED: gephyrin isoform X3                     146   3e-36    Callithrix jacchus [common marmoset]
ref|XP_005267307.1|  PREDICTED: gephyrin isoform X1                     146   3e-36    
ref|XP_007985189.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Chlorocebus sabaeus
ref|XP_005343303.1|  PREDICTED: gephyrin isoform X3                     146   3e-36    Microtus ochrogaster [prairie voles]
ref|XP_005561575.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    
ref|XP_005623589.1|  PREDICTED: gephyrin isoform X5                     146   3e-36    
ref|XP_005306752.1|  PREDICTED: gephyrin isoform X5                     146   3e-36    
ref|XP_005306753.1|  PREDICTED: gephyrin isoform X6                     146   3e-36    Chrysemys picta bellii
ref|XP_004681826.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Condylura cristata
ref|XP_005306750.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    Chrysemys picta bellii
ref|XP_009426249.1|  PREDICTED: gephyrin isoform X11                    146   3e-36    
ref|XP_007473123.1|  PREDICTED: gephyrin isoform X5                     146   3e-36    Monodelphis domestica
ref|XP_004797265.1|  PREDICTED: gephyrin isoform X2                     146   3e-36    
ref|XP_006973190.1|  PREDICTED: gephyrin isoform X1                     146   4e-36    
ref|XP_004699062.1|  PREDICTED: gephyrin                                146   4e-36    
ref|XP_010807863.1|  PREDICTED: gephyrin isoform X4                     146   4e-36    
ref|XP_005306751.1|  PREDICTED: gephyrin isoform X4                     146   4e-36    
ref|XP_005877970.1|  PREDICTED: gephyrin isoform X6                     146   4e-36    
ref|XP_006515962.1|  PREDICTED: gephyrin isoform X1                     146   4e-36    
ref|XP_004739017.1|  PREDICTED: gephyrin isoform X1                     146   4e-36    
ref|XP_006720066.1|  PREDICTED: gephyrin isoform X6                     146   4e-36    
dbj|BAI68423.1|  gephyrin1 isoform                                      146   4e-36    
dbj|BAI68422.1|  gephyrin1 isoform                                      146   4e-36    
ref|XP_007473122.1|  PREDICTED: gephyrin isoform X4                     146   4e-36    
ref|XP_005520407.1|  PREDICTED: gephyrin isoform X1                     146   4e-36    
ref|XP_008171027.1|  PREDICTED: gephyrin isoform X3                     146   4e-36    
ref|XP_007449082.1|  PREDICTED: gephyrin isoform X1                     146   4e-36    
ref|XP_005306749.1|  PREDICTED: gephyrin isoform X1                     146   4e-36    
ref|WP_015758403.1|  molybdenum cofactor synthesis domain-contain...    137   4e-36    
gb|EGT47189.1|  CBN-MOC-2 protein                                       137   4e-36    
ref|XP_008311622.1|  PREDICTED: gephyrin isoform X4                     145   4e-36    
ref|WP_022939555.1|  hypothetical protein                               136   5e-36    
ref|NP_001170915.1|  gephyrin                                           146   5e-36    
gb|EDM03692.1|  rCG61772, isoform CRA_b                                 145   5e-36    
ref|XP_006792666.1|  PREDICTED: gephyrin-like isoform X5                145   5e-36    
ref|WP_035523037.1|  molybdopterin adenylyltransferase                  137   5e-36    
ref|NP_001096372.1|  gephyrin                                           143   5e-36    
ref|XP_008863021.1|  hypothetical protein, variant 2                    144   5e-36    
ref|WP_040620439.1|  cytoplasmic protein                                136   5e-36    
ref|XP_003446335.1|  PREDICTED: gephyrin-like isoformX1                 145   5e-36    
ref|XP_008274970.1|  PREDICTED: gephyrin                                145   5e-36    
ref|XP_004550514.1|  PREDICTED: gephyrin-like isoform X3                145   5e-36    
ref|XP_009563318.1|  PREDICTED: gephyrin                                145   6e-36    
ref|XP_004550515.1|  PREDICTED: gephyrin-like isoform X4                145   6e-36    
ref|XP_003797434.1|  PREDICTED: gephyrin isoform 1                      145   6e-36    
ref|WP_015261698.1|  molybdopterin adenylyltransferase                  136   6e-36    
ref|XP_008311620.1|  PREDICTED: gephyrin isoform X2                     145   6e-36    
ref|XP_004649707.1|  PREDICTED: gephyrin                                145   6e-36    
ref|XP_010895559.1|  PREDICTED: gephyrin-like                           145   6e-36    
ref|XP_003224913.2|  PREDICTED: gephyrin                                146   6e-36    
ref|XP_008311621.1|  PREDICTED: gephyrin isoform X3                     145   6e-36    
ref|XP_008311619.1|  PREDICTED: gephyrin isoform X1                     145   6e-36    
ref|WP_013275110.1|  molybdenum cofactor biosynthesis protein           140   6e-36    
ref|XP_005991535.1|  PREDICTED: gephyrin isoform X6                     145   6e-36    
ref|XP_004550512.1|  PREDICTED: gephyrin-like isoform X1                145   7e-36    
dbj|BAI68425.1|  gephyrin2                                              145   7e-36    
ref|XP_003446336.1|  PREDICTED: gephyrin-like isoformX2                 145   7e-36    
gb|EDM03691.1|  rCG61772, isoform CRA_a                                 145   7e-36    
ref|XP_005921715.1|  PREDICTED: gephyrin-like                           145   7e-36    
ref|XP_006632748.1|  PREDICTED: gephyrin-like                           145   7e-36    
ref|XP_010880835.1|  PREDICTED: gephyrin isoform X6                     145   8e-36    
ref|XP_008863013.1|  hypothetical protein H310_01631                    144   8e-36    
ref|XP_005322859.1|  PREDICTED: gephyrin isoform X1                     145   8e-36    
ref|XP_003971787.1|  PREDICTED: gephyrin-like isoform 1                 145   8e-36    
ref|XP_005991531.1|  PREDICTED: gephyrin isoform X2                     145   8e-36    
ref|NP_001165871.1|  gephyrin b                                         145   8e-36    
ref|WP_008539029.1|  molybdenum cofactor biosynthesis protein B         136   8e-36    
ref|XP_007255546.1|  PREDICTED: gephyrin isoform X7                     145   9e-36    
ref|XP_010736720.1|  PREDICTED: gephyrin                                145   9e-36    
ref|WP_038351311.1|  cytoplasmic protein                                136   9e-36    
ref|WP_036938749.1|  cytoplasmic protein                                135   9e-36    
ref|XP_005991532.1|  PREDICTED: gephyrin isoform X3                     145   9e-36    
ref|XP_007255545.1|  PREDICTED: gephyrin isoform X6                     144   9e-36    
ref|XP_005991533.1|  PREDICTED: gephyrin isoform X4                     145   9e-36    
ref|XP_005991534.1|  PREDICTED: gephyrin isoform X5                     145   9e-36    
ref|WP_007596046.1|  molybdopterin biosynthesis protein                 140   9e-36    
ref|XP_007255544.1|  PREDICTED: gephyrin isoform X5                     145   1e-35    
ref|XP_007255543.1|  PREDICTED: gephyrin isoform X4                     145   1e-35    
ref|XP_003971788.1|  PREDICTED: gephyrin-like isoform 2                 145   1e-35    
ref|XP_005991530.1|  PREDICTED: gephyrin isoform X1                     145   1e-35    
ref|XP_010880834.1|  PREDICTED: gephyrin isoform X5                     145   1e-35    
emb|CCH47337.1|  Molybdenum cofactor synthesis domain protein           138   1e-35    
ref|XP_007255541.1|  PREDICTED: gephyrin isoform X2                     145   1e-35    
ref|XP_007255540.1|  PREDICTED: gephyrin isoform X1                     145   1e-35    
ref|WP_014551937.1|  molybdopterin adenylyltransferase MoaB             135   1e-35    
ref|WP_013560236.1|  molybdopterin biosynthesis protein                 136   1e-35    
ref|XP_010880833.1|  PREDICTED: gephyrin isoform X4                     145   1e-35    
ref|XP_007255542.1|  PREDICTED: gephyrin isoform X3                     145   1e-35    
ref|WP_022854836.1|  molybdenum cofactor biosynthesis protein MoaB      135   1e-35    
ref|WP_026176793.1|  cytoplasmic protein                                135   1e-35    
ref|WP_013380974.1|  molybdopterin adenylyltransferase                  135   1e-35    
ref|XP_010880831.1|  PREDICTED: gephyrin isoform X2                     145   1e-35    
ref|XP_010880832.1|  PREDICTED: gephyrin isoform X3                     145   1e-35    
ref|XP_010880830.1|  PREDICTED: gephyrin isoform X1                     145   1e-35    
ref|WP_026394442.1|  cytoplasmic protein                                135   1e-35    
ref|WP_005945966.1|  MULTISPECIES: molybdenum cofactor biosynthes...    135   2e-35    
ref|WP_022228690.1|  molybdenum cofactor synthesis domain-contain...    135   2e-35    
ref|WP_034107018.1|  cytoplasmic protein                                135   2e-35    
ref|WP_018998610.1|  molybdenum cofactor biosynthesis protein B         135   2e-35    
ref|WP_028119809.1|  hypothetical protein                               135   2e-35    
ref|XP_011276879.1|  putative gephyrin                                  143   2e-35    
ref|WP_013163307.1|  molybdenum cofactor synthesis domain protein       135   2e-35    
ref|WP_034215363.1|  molybdopterin biosynthesis protein                 139   2e-35    
ref|WP_038060338.1|  cytoplasmic protein                                134   3e-35    
ref|WP_012281235.1|  molybdenum cofactor biosynthesis protein           134   3e-35    
ref|WP_028841249.1|  cytoplasmic protein                                134   3e-35    
ref|NP_001085376.1|  MGC83148 protein                                   144   3e-35    
ref|WP_022853116.1|  molybdenum cofactor biosynthesis protein MoaB      134   3e-35    
ref|WP_040199703.1|  cytoplasmic protein                                134   3e-35    
ref|NP_001090459.1|  gephyrin                                           144   4e-35    
ref|WP_023345840.1|  hypothetical protein                               134   4e-35    
ref|WP_013976529.1|  molybdenum cofactor biosynthesis protein B         134   4e-35    
ref|WP_009662908.1|  molybdopterin biosynthesis protein                 138   4e-35    
ref|WP_026962739.1|  hypothetical protein                               134   4e-35    
gb|EFX82014.1|  hypothetical protein DAPPUDRAFT_317081                  142   4e-35    
gb|KDO33385.1|  hypothetical protein SPRG_02192                         141   5e-35    
ref|WP_013908130.1|  molybdenum cofactor synthesis domain-contain...    134   5e-35    
ref|NP_001122752.1|  molybdenum cofactor synthesis protein cinnamon     141   5e-35    
dbj|BAF87429.1|  molybdenum cofactor biosynthesis protein               134   5e-35    
ref|WP_040770258.1|  molybdopterin adenylyltransferase                  134   5e-35    
ref|WP_035803798.1|  cytoplasmic protein                                134   6e-35    
ref|WP_043880127.1|  molybdopterin adenylyltransferase                  134   6e-35    
ref|XP_008615186.1|  hypothetical protein SDRG_10947                    141   6e-35    
ref|WP_034133399.1|  hypothetical protein                               137   6e-35    
ref|XP_009051623.1|  hypothetical protein LOTGIDRAFT_103927             134   6e-35    
ref|WP_021749836.1|  MULTISPECIES: molybdenum cofactor synthesis ...    134   7e-35    
ref|WP_013910221.1|  molybdenum cofactor synthesis domain-contain...    133   8e-35    
ref|WP_041892435.1|  cytoplasmic protein                                133   8e-35    
ref|WP_026789968.1|  molybdopterin adenylyltransferase                  133   1e-34    
ref|WP_006523738.1|  molybdenum cofactor synthesis domain protein       133   1e-34    
ref|WP_011393622.1|  molybdopterin adenylyltransferase                  133   1e-34    
ref|WP_018032021.1|  MULTISPECIES: hypothetical protein                 137   1e-34    
ref|WP_022190813.1|  molybdenum cofactor synthesis domain protein       137   1e-34    
ref|WP_040366140.1|  cytoplasmic protein                                132   1e-34    
ref|WP_013119650.1|  molybdenum cofactor synthesis domain-contain...    133   1e-34    
ref|WP_027365300.1|  cytoplasmic protein                                132   1e-34    
ref|WP_038090503.1|  hypothetical protein                               132   2e-34    
ref|XP_003112359.1|  CRE-MOC-2 protein                                  132   2e-34    
ref|XP_011062644.1|  PREDICTED: gephyrin                                140   2e-34    
ref|WP_027399535.1|  hypothetical protein                               132   2e-34    
gb|AAI11251.1|  Gephyrin                                                137   2e-34    
ref|WP_002849356.1|  molybdopterin adenylyltransferase                  132   2e-34    
ref|WP_026964874.1|  hypothetical protein                               132   2e-34    
tpg|DAA25101.1|  TPA: gephyrin                                          137   2e-34    
emb|CAG03546.1|  unnamed protein product                                141   2e-34    
ref|WP_005884702.1|  molybdenum cofactor biosynthesis protein B         132   2e-34    
emb|CAP36276.2|  Protein CBR-MOC-2                                      132   3e-34    
ref|WP_025773373.1|  cytoplasmic protein                                132   3e-34    
ref|XP_009293282.1|  PREDICTED: gephyrin-like                           136   3e-34    
ref|WP_023385044.1|  molybdopterin adenylyltransferase                  132   3e-34    
ref|WP_007912804.1|  molybdenum cofactor synthesis domain protein       132   3e-34    
ref|XP_011153413.1|  PREDICTED: gephyrin                                139   3e-34    
ref|WP_013484790.1|  molybdenum cofactor biosynthesis protein B         131   4e-34    
gb|KFQ75480.1|  Gephyrin                                                138   5e-34    
ref|WP_029002693.1|  molybdopterin adenylyltransferase                  131   5e-34    
ref|XP_005461955.1|  PREDICTED: gephyrin-like isoform X3                140   5e-34    
ref|WP_014062233.1|  molybdenum cofactor synthesis domain-contain...    131   5e-34    
ref|XP_003697201.1|  PREDICTED: gephyrin-like                           139   5e-34    
ref|WP_040461151.1|  molybdopterin biosynthesis protein                 135   5e-34    
ref|XP_005605587.1|  PREDICTED: gephyrin                                140   5e-34    
gb|EFU77178.1|  molybdenum cofactor synthesis domain protein            135   5e-34    
ref|WP_009220346.1|  molybdopterin biosynthesis protein                 135   6e-34    
ref|WP_027718054.1|  cytoplasmic protein                                131   6e-34    
ref|WP_008907774.1|  Molybdopterin-guanine dinucleotide biosynthe...    131   6e-34    
ref|WP_014448681.1|  cytoplasmic protein                                131   6e-34    
ref|WP_038055453.1|  cytoplasmic protein                                131   6e-34    
gb|EGT58438.1|  hypothetical protein CAEBREN_17073                      131   6e-34    
ref|WP_009052268.1|  MULTISPECIES: molybdenum cofactor synthesis ...    131   6e-34    
ref|XP_009632433.1|  PREDICTED: gephyrin                                140   7e-34    
ref|XP_010285902.1|  PREDICTED: gephyrin                                137   7e-34    
ref|XP_005441200.1|  PREDICTED: gephyrin                                139   7e-34    
ref|XP_002199469.1|  PREDICTED: gephyrin                                140   7e-34    
ref|WP_015049333.1|  molybdopterin biosynthesis enzyme Mog              131   7e-34    
gb|EXX61117.1|  hypothetical protein RirG_174070                        137   8e-34    
ref|WP_007196535.1|  molybdenum cofactor biosynthesis protein           131   9e-34    
ref|XP_010138832.1|  PREDICTED: gephyrin-like                           135   9e-34    
ref|XP_008059267.1|  PREDICTED: gephyrin-like                           132   9e-34    
ref|XP_005047272.1|  PREDICTED: gephyrin                                139   9e-34    
gb|EEU61452.1|  molybdenum cofactor synthesis domain protein            131   9e-34    
ref|WP_012302960.1|  molybdenum cofactor synthesis domain-contain...    130   9e-34    
gb|KFW75041.1|  Gephyrin                                                138   1e-33    
ref|WP_021092391.1|  Molybdopterin biosynthesis Mog protein, moly...    130   1e-33    
ref|WP_022360488.1|  molybdenum cofactor synthesis protein              130   1e-33    
emb|CCU78472.1|  Molybdenum cofactor biosynthesis protein MoaB          131   1e-33    
ref|WP_029473756.1|  cytoplasmic protein                                130   1e-33    
ref|WP_012545311.1|  molybdopterin biosynthesis mog protein             130   1e-33    
ref|WP_034234425.1|  molybdenum cofactor biosynthesis protein           134   1e-33    
gb|EAT16869.1|  molybdopterin-guanine dinucleotide biosynthesis p...    135   1e-33    
ref|WP_025656743.1|  molybdenum cofactor biosynthesis protein B         130   1e-33    
ref|WP_028842045.1|  cytoplasmic protein                                130   1e-33    
ref|WP_035308157.1|  hypothetical protein                               130   1e-33    
gb|ERZ95706.1|  hypothetical protein GLOINDRAFT_309062                  137   1e-33    
gb|KFM10386.1|  Gephyrin                                                138   1e-33    
ref|XP_007640584.1|  PREDICTED: gephyrin isoform X2                     137   1e-33    
ref|WP_039258753.1|  cytoplasmic protein                                130   1e-33    
ref|WP_043904634.1|  cytoplasmic protein                                130   2e-33    
ref|WP_014793239.1|  molybdopterin adenylyltransferase                  130   2e-33    
ref|XP_005502495.1|  PREDICTED: gephyrin                                139   2e-33    
gb|KFR07161.1|  Gephyrin                                                138   2e-33    
ref|XP_010006035.1|  PREDICTED: gephyrin                                138   2e-33    
ref|WP_027340687.1|  cytoplasmic protein                                130   2e-33    
ref|WP_026841991.1|  cytoplasmic protein                                130   2e-33    
gb|ERE72902.1|  gephyrin-like protein                                   139   2e-33    
ref|XP_004208356.1|  PREDICTED: gephyrin-like                           138   2e-33    
gb|KFO24184.1|  Gephyrin                                                139   2e-33    
ref|XP_008637951.1|  PREDICTED: gephyrin                                138   2e-33    
ref|XP_008926005.1|  PREDICTED: gephyrin                                137   2e-33    
gb|EMC83799.1|  Gephyrin                                                138   2e-33    
gb|EOB08497.1|  Gephyrin                                                138   2e-33    
ref|XP_007985214.1|  PREDICTED: gephyrin isoform X25                    137   2e-33    
emb|CDS14290.1|  hypothetical protein LRAMOSA06460                      137   2e-33    
ref|WP_019192615.1|  hypothetical protein                               129   2e-33    
gb|EDL02616.1|  gephyrin                                                138   2e-33    
gb|ELK09870.1|  Gephyrin                                                138   2e-33    
ref|XP_009930116.1|  PREDICTED: gephyrin                                138   2e-33    
ref|XP_009881803.1|  PREDICTED: gephyrin                                138   2e-33    
gb|ELR59365.1|  Gephyrin                                                138   3e-33    
ref|XP_007113962.1|  PREDICTED: gephyrin-like                           134   3e-33    
ref|XP_008902164.1|  hypothetical protein, variant 1                    136   3e-33    
ref|XP_006623825.1|  PREDICTED: gephyrin-like isoform X3                135   3e-33    
ref|WP_041595796.1|  cytoplasmic protein                                129   3e-33    
ref|WP_040477036.1|  cytoplasmic protein                                129   3e-33    
ref|XP_008902162.1|  hypothetical protein, variant 3                    135   3e-33    
gb|ETI51953.1|  hypothetical protein, variant 1                         136   3e-33    
ref|XP_005417698.1|  PREDICTED: gephyrin                                138   3e-33    
gb|ETK91818.1|  hypothetical protein, variant 3                         135   3e-33    
ref|WP_019849816.1|  molybdenum cofactor biosynthesis protein MoaB      129   3e-33    
gb|ADQ14534.1|  molybdenum cofactor synthesis domain protein            129   3e-33    
gb|ETM51547.1|  hypothetical protein, variant 1                         136   3e-33    
gb|ETP21736.1|  hypothetical protein, variant 3                         135   3e-33    
ref|WP_039680403.1|  molybdenum cofactor biosynthesis protein B         129   3e-33    
ref|XP_009472118.1|  PREDICTED: gephyrin                                138   3e-33    
gb|ETP21734.1|  hypothetical protein, variant 1                         136   3e-33    
gb|ETI51955.1|  hypothetical protein, variant 3                         135   3e-33    



>ref|XP_002515854.1| molybdopterin biosynthesis protein, putative [Ricinus communis]
 gb|EEF46523.1| molybdopterin biosynthesis protein, putative [Ricinus communis]
Length=668

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSE+LGGARVV+TAVVPDD+ KI+D+L R 
Sbjct  470  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSEKLGGARVVSTAVVPDDVSKIKDVLQRW  529

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID MDL+LTLGGTG +PRDVTPEATK ++QKETPGLL+ MMQESLK+TPFAMLSR AA
Sbjct  530  SDIDGMDLILTLGGTGFTPRDVTPEATKEVIQKETPGLLYAMMQESLKVTPFAMLSRSAA  589

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNA AECME LLPALKHALKQI+GDKREK+PRH+PHA A   DTWE
Sbjct  590  GIRGSTLIINMPGNPNAAAECMEALLPALKHALKQIKGDKREKHPRHIPHAQAATVDTWE  649

Query  199  RSHKLAS-IGEEPTCSCSH  146
            RS+KLAS +  EP+CSCSH
Sbjct  650  RSYKLASRVSPEPSCSCSH  668



>ref|XP_006446684.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
 gb|ESR59924.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
Length=489

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L R  
Sbjct  292  VAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVLRRWS  351

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR AAG
Sbjct  352  DIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSRSAAG  411

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWER  197
            IRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP DTWE 
Sbjct  412  IRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVDTWEH  471

Query  196  SHKLAS-IGEEPTCSCSH  146
            S+K++S  G EP+CSCSH
Sbjct  472  SYKMSSGGGTEPSCSCSH  489



>gb|KDO47642.1| hypothetical protein CISIN_1g0059002mg [Citrus sinensis]
 gb|KDO47643.1| hypothetical protein CISIN_1g0059002mg [Citrus sinensis]
Length=489

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L R  
Sbjct  292  VAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVLRRWS  351

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR AAG
Sbjct  352  DIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSRSAAG  411

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWER  197
            IRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP DTWE 
Sbjct  412  IRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVDTWEH  471

Query  196  SHKLAS-IGEEPTCSCSH  146
            S+K++S  G EP+CSCSH
Sbjct  472  SYKMSSGGGTEPSCSCSH  489



>gb|KDO47640.1| hypothetical protein CISIN_1g0059002mg, partial [Citrus sinensis]
 gb|KDO47641.1| hypothetical protein CISIN_1g0059002mg, partial [Citrus sinensis]
Length=519

 Score =   332 bits (850),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L R  
Sbjct  322  VAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVLRRWS  381

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR AAG
Sbjct  382  DIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSRSAAG  441

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWER  197
            IRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP DTWE 
Sbjct  442  IRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVDTWEH  501

Query  196  SHKLAS-IGEEPTCSCSH  146
            S+K++S  G EP+CSCSH
Sbjct  502  SYKMSSGGGTEPSCSCSH  519



>ref|XP_010031620.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Eucalyptus grandis]
 gb|KCW50985.1| hypothetical protein EUGRSUZ_J00614 [Eucalyptus grandis]
Length=669

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA+GAGPDRSGPRAV+VVNSSSERLGGARV  TAVVPD++ KI+DIL R 
Sbjct  471  RVAILTVSDTVASGAGPDRSGPRAVTVVNSSSERLGGARVAATAVVPDEVAKIKDILQRW  530

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  531  ADVDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  590

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGS+LIINMPGNPNAVAECM+ LLPALKHALKQI+GDKREK+PRHVPHA AVPADTWE
Sbjct  591  GIRGSSLIINMPGNPNAVAECMDALLPALKHALKQIKGDKREKHPRHVPHAQAVPADTWE  650

Query  199  RSHKLASIGE-EPTCSCSH  146
             S+K AS GE E  CSCSH
Sbjct  651  HSYKSASGGETERGCSCSH  669



>ref|XP_011090256.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Sesamum indicum]
Length=660

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGARV  TAVVPD+I KI++ L R 
Sbjct  462  KVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGARVAATAVVPDEIPKIKEALERW  521

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  522  SDVDKMDLILTLGGTGCTPRDVTPEATKEVIQKETPGLLYVMMQESLKVTPFAMLSRSAA  581

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PHA A P DTWE
Sbjct  582  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHIPHAQAAPTDTWE  641

Query  199  RSHKLAS-IGEEPTCSCSH  146
            RS+KLAS   +E  CSCSH
Sbjct  642  RSYKLASGAAQETGCSCSH  660



>ref|XP_006446683.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
 gb|ESR59923.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
Length=671

 Score =   332 bits (852),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L R  
Sbjct  474  VAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVLRRWS  533

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR AAG
Sbjct  534  DIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSRSAAG  593

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWER  197
            IRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP DTWE 
Sbjct  594  IRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVDTWEH  653

Query  196  SHKLAS-IGEEPTCSCSH  146
            S+K++S  G EP+CSCSH
Sbjct  654  SYKMSSGGGTEPSCSCSH  671



>ref|XP_006470155.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Citrus 
sinensis]
Length=671

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VVPDD+ KI+++L R  
Sbjct  474  VAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATDVVPDDVGKIKEVLRRWS  533

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            DID MDL+LTLGGTG +PRDVTPEATK L+++ETPGLL+VMMQESLK+TPFAMLSR AAG
Sbjct  534  DIDKMDLILTLGGTGFTPRDVTPEATKELIERETPGLLYVMMQESLKVTPFAMLSRSAAG  593

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWER  197
            IRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH+ AVP DTWE 
Sbjct  594  IRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHSQAVPVDTWEH  653

Query  196  SHKLAS-IGEEPTCSCSH  146
            S+K++S  G EP+CSCSH
Sbjct  654  SYKMSSGGGTEPSCSCSH  671



>ref|XP_009765762.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nicotiana 
sylvestris]
Length=667

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVAAG GPDRSGPRAVSVVNSSSERLGG  VV TAVVPDD QKI+++L   
Sbjct  469  RVAILTVSDTVAAGLGPDRSGPRAVSVVNSSSERLGGTSVVATAVVPDDEQKIKNMLQMW  528

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR AA
Sbjct  529  SDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSRAAA  588

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQ+RGDKREK+PRHVPHA A P DTWE
Sbjct  589  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQVRGDKREKHPRHVPHAQAAPTDTWE  648

Query  199  RSHKLASIG-EEPTCSCSH  146
            RS+KLAS G EE  CSCSH
Sbjct  649  RSYKLASSGVEEHGCSCSH  667



>dbj|BAF00362.1| molybdopterin biosynthesis CNX1 protein [Arabidopsis thaliana]
Length=297

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 181/203 (89%), Gaps = 5/203 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  95   KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  154

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  155  SDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  214

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A +P DTW
Sbjct  215  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATLPTDTW  274

Query  202  ERSHKLA----SIGEEPTCSCSH  146
            ++S+K A       EE  CSC+H
Sbjct  275  DQSYKSAYETGEKKEEAGCSCTH  297



>ref|XP_006362730.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X2 [Solanum tuberosum]
Length=670

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA G GPDRSGPRAVSVVN+SSERLGG  +V TAVVPDD+QKI+D+L + 
Sbjct  472  KVAILTVSDTVATGLGPDRSGPRAVSVVNASSERLGGTSIVATAVVPDDVQKIKDMLQKW  531

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR AA
Sbjct  532  SDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSRAAA  591

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLP+LKHALKQ+RGDKREK+PRH+PHA A P DTWE
Sbjct  592  GIRGSTLIINMPGNPNAVAECMEALLPSLKHALKQVRGDKREKHPRHIPHAQAAPTDTWE  651

Query  199  RSHKLASI-GEEPTCSCSH  146
            RS+KL+S  GEE  CSCSH
Sbjct  652  RSYKLSSSGGEEHGCSCSH  670



>ref|XP_004228477.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Solanum lycopersicum]
Length=670

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA G GPDRSGPRAVSVVN+SSERLGG  +V TAVVPDD+QKI+D+L + 
Sbjct  472  KVAILTVSDTVATGLGPDRSGPRAVSVVNASSERLGGTSIVATAVVPDDVQKIKDMLQKW  531

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR AA
Sbjct  532  SDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSRAAA  591

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLP+LKHALKQ+RGDKREK+PRH+PHA A P DTWE
Sbjct  592  GIRGSTLIINMPGNPNAVAECMEALLPSLKHALKQVRGDKREKHPRHIPHAQAAPTDTWE  651

Query  199  RSHKLAS-IGEEPTCSCSH  146
            RS+KLAS  GEE  CSCSH
Sbjct  652  RSYKLASGGGEEHGCSCSH  670



>gb|KDP42916.1| hypothetical protein JCGZ_23858 [Jatropha curcas]
Length=674

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA+LTVSDTVA+GAGPDRSGPRAVSVVNS+SE+LGGARVV+TAVVPDD+ KI+++L R 
Sbjct  476  RVAVLTVSDTVASGAGPDRSGPRAVSVVNSASEKLGGARVVSTAVVPDDVSKIKELLQRW  535

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID MDL+LTLGGTG +PRDVTPEATK +++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  536  SDIDGMDLILTLGGTGFTPRDVTPEATKEVIEKETPGLLYVMMQESLKVTPFAMLSRSAA  595

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECM+ LLPALKHALKQI+GDKREK+PRH+PHA A P DTWE
Sbjct  596  GIRGSTLIINMPGNPNAVAECMDALLPALKHALKQIKGDKREKHPRHIPHARAAPMDTWE  655

Query  199  RSHKLASIG-EEPTCSCSH  146
             S+KLAS G  E +CSCSH
Sbjct  656  LSYKLASGGVSERSCSCSH  674



>gb|KJB55513.1| hypothetical protein B456_009G080100 [Gossypium raimondii]
Length=657

 Score =   329 bits (844),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VA+LTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VV DD+ KI+++L R 
Sbjct  459  KVAVLTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATGVVSDDVGKIKEVLQRW  518

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID +DL+LTLGGTG +PRDVTPEATK +++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  519  SDIDKLDLILTLGGTGFTPRDVTPEATKEVIEKETPGLLYVMMQESLKVTPFAMLSRSAA  578

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQ++GDKREK+PRH+PH  A P DTWE
Sbjct  579  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQVKGDKREKHPRHIPHEHATPVDTWE  638

Query  199  RSHKLASIGE-EPTCSCSH  146
            RSHKLAS G  EP+C CSH
Sbjct  639  RSHKLASAGSVEPSCPCSH  657



>ref|XP_006362729.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X1 [Solanum tuberosum]
Length=685

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA G GPDRSGPRAVSVVN+SSERLGG  +V TAVVPDD+QKI+D+L + 
Sbjct  487  KVAILTVSDTVATGLGPDRSGPRAVSVVNASSERLGGTSIVATAVVPDDVQKIKDMLQKW  546

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR AA
Sbjct  547  SDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSRAAA  606

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLP+LKHALKQ+RGDKREK+PRH+PHA A P DTWE
Sbjct  607  GIRGSTLIINMPGNPNAVAECMEALLPSLKHALKQVRGDKREKHPRHIPHAQAAPTDTWE  666

Query  199  RSHKLASI-GEEPTCSCSH  146
            RS+KL+S  GEE  CSCSH
Sbjct  667  RSYKLSSSGGEEHGCSCSH  685



>gb|KHG12135.1| Molybdopterin biosynthesis CNX1 -like protein [Gossypium arboreum]
Length=657

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VA+LTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA+VV T VV DD+ KI+++L R 
Sbjct  459  KVAVLTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGAKVVATGVVSDDVGKIKEVLQRW  518

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID +DL+LTLGGTG +PRDVTPEATK +++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  519  SDIDKLDLILTLGGTGFTPRDVTPEATKEVIEKETPGLLYVMMQESLKVTPFAMLSRSAA  578

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQ++GDKREK+PRH+PH  A P DTWE
Sbjct  579  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQVKGDKREKHPRHIPHEHATPVDTWE  638

Query  199  RSHKLASIGE-EPTCSCSH  146
            RSHKLAS G  +P+C CSH
Sbjct  639  RSHKLASAGSVKPSCPCSH  657



>ref|XP_009601464.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nicotiana 
tomentosiformis]
Length=667

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVAAG GPDRSGPRAVSVVNS SERLGG  +V TAVVPDD QKI+D+L + 
Sbjct  469  RVAILTVSDTVAAGLGPDRSGPRAVSVVNSLSERLGGTSIVATAVVPDDEQKIKDMLQKW  528

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTGC+PRDVTPEATK ++QKETPGLL+VMM+ESLK+TP AMLSR AA
Sbjct  529  SDVDKVDLILTLGGTGCTPRDVTPEATKSMIQKETPGLLYVMMRESLKVTPSAMLSRAAA  588

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLP+LKHALKQ+RGDKREK+PRHVPHA A P DTWE
Sbjct  589  GIRGSTLIINMPGNPNAVAECMEALLPSLKHALKQVRGDKREKHPRHVPHAQAAPTDTWE  648

Query  199  RSHKLASIG-EEPTCSCSH  146
            RS+KLAS G +E  CSCSH
Sbjct  649  RSYKLASSGVQEHGCSCSH  667



>ref|XP_008451034.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Cucumis melo]
Length=661

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            S+VAILTVSDTVA+GAGPDRSGPRAVS+V +SSE+LGG  +V TAVV DD+ KI+D+L++
Sbjct  462  SKVAILTVSDTVASGAGPDRSGPRAVSIVQASSEKLGGVNIVATAVVSDDVSKIQDVLVK  521

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CDID +DL+LTLGGTG SPRDVTPEATKPLL KETPGLL+VMMQESLK+TPFA+LSR A
Sbjct  522  WCDIDEVDLILTLGGTGFSPRDVTPEATKPLLHKETPGLLYVMMQESLKVTPFAVLSRSA  581

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  203
            AGIRGSTLIINMPGNPNA AECME LLP+LKHALKQI+GDKREK+PRHVPHA+A PA+ W
Sbjct  582  AGIRGSTLIINMPGNPNAAAECMEALLPSLKHALKQIQGDKREKHPRHVPHAEATPANIW  641

Query  202  ERSHKLASIG-EEPTCSCSH  146
            ++S+KLAS G  E  CSCSH
Sbjct  642  DQSYKLASEGISETGCSCSH  661



>ref|XP_011043840.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Populus euphratica]
Length=641

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+GAGPDRSGPRAVSV+NSSSE+LG ARVV+TAVVPDD+ KI+ ++ + 
Sbjct  444  KVAILTVSDTVASGAGPDRSGPRAVSVINSSSEKLG-ARVVSTAVVPDDVSKIKAVVQKW  502

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D MDL+LTLGGTG SPRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  503  SDTDRMDLILTLGGTGFSPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRSAA  562

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH+PHA+A P DTWE
Sbjct  563  GIRGSTLIINMPGNPNAVAECVEALLPALKHALKQIKGDKREKHPRHIPHAEAEPVDTWE  622

Query  199  RSHKLASIGE-EPTCSCSH  146
            RSHKLAS    EP CSCSH
Sbjct  623  RSHKLASGNHAEPGCSCSH  641



>ref|XP_009376133.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Pyrus 
x bretschneideri]
Length=647

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 175/197 (89%), Gaps = 1/197 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA+GAGPDRSGPRAVSVVNS SERLGGARVV+TAVVPDD+ KI+D+L R 
Sbjct  449  RVAILTVSDTVASGAGPDRSGPRAVSVVNSCSERLGGARVVSTAVVPDDVSKIKDVLHRW  508

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DI+ MDL+LTLGGTG +PRDVTPEATK L++KETPGLLHVMMQESLK+TP AMLSR AA
Sbjct  509  SDIEQMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLHVMMQESLKVTPTAMLSRSAA  568

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGS+LIINMPGNPNAVAECME LLPALKH LKQIRGDKREK+PRHVPHA     D WE
Sbjct  569  GIRGSSLIINMPGNPNAVAECMEALLPALKHGLKQIRGDKREKHPRHVPHAQGATTDVWE  628

Query  199  RSHKLASI-GEEPTCSC  152
            +S+KLAS  G EP CSC
Sbjct  629  QSYKLASASGTEPGCSC  645



>ref|XP_007141599.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
 gb|ESW13593.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
Length=650

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV +AVVPD++ KI+DIL R 
Sbjct  454  RVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVASAVVPDNVAKIQDILRRW  513

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DI+ MDL++TLGGTG + RD+TPEATKPL++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  514  SDIEQMDLIITLGGTGFTSRDLTPEATKPLIEKETPGLLYVMMQESLKVTPFAMLSRSAA  573

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECM  LLPALKH LKQIRGDK+EK+PRHVPH +AVPAD WE
Sbjct  574  GIRGSTLIINMPGNPNAVAECMGALLPALKHGLKQIRGDKKEKHPRHVPHVEAVPADVWE  633

Query  199  RSHKLASIGEEPTCSC  152
            +S++LA+ G++ +CSC
Sbjct  634  QSYRLAT-GDDVSCSC  648



>ref|XP_011043834.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Populus euphratica]
Length=653

 Score =   324 bits (830),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+GAGPDRSGPRAVSV+NSSSE+LG ARVV+TAVVPDD+ KI+ ++ + 
Sbjct  456  KVAILTVSDTVASGAGPDRSGPRAVSVINSSSEKLG-ARVVSTAVVPDDVSKIKAVVQKW  514

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D MDL+LTLGGTG SPRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  515  SDTDRMDLILTLGGTGFSPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRSAA  574

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH+PHA+A P DTWE
Sbjct  575  GIRGSTLIINMPGNPNAVAECVEALLPALKHALKQIKGDKREKHPRHIPHAEAEPVDTWE  634

Query  199  RSHKLASIGE-EPTCSCSH  146
            RSHKLAS    EP CSCSH
Sbjct  635  RSHKLASGNHAEPGCSCSH  653



>ref|XP_007141600.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
 gb|ESW13594.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
Length=669

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 179/196 (91%), Gaps = 1/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV +AVVPD++ KI+DIL R 
Sbjct  454  RVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVASAVVPDNVAKIQDILRRW  513

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DI+ MDL++TLGGTG + RD+TPEATKPL++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  514  SDIEQMDLIITLGGTGFTSRDLTPEATKPLIEKETPGLLYVMMQESLKVTPFAMLSRSAA  573

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECM  LLPALKH LKQIRGDK+EK+PRHVPH +AVPAD WE
Sbjct  574  GIRGSTLIINMPGNPNAVAECMGALLPALKHGLKQIRGDKKEKHPRHVPHVEAVPADVWE  633

Query  199  RSHKLASIGEEPTCSC  152
            +S++LA+ G++ +CSC
Sbjct  634  QSYRLAT-GDDVSCSC  648



>ref|XP_006379351.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
 gb|ERP57148.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
Length=641

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LG ARVV+TAVVPDD+ KI+ ++ + 
Sbjct  444  KVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLG-ARVVSTAVVPDDVSKIKAVVQKW  502

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D MDL+LTLGGTG SPRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  503  SDTDRMDLILTLGGTGFSPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRSAA  562

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH+ HA+A P DTWE
Sbjct  563  GIRGSTLIINMPGNPNAVAECVEALLPALKHALKQIKGDKREKHPRHITHAEAEPVDTWE  622

Query  199  RSHKLASIGE-EPTCSCSH  146
            RSHKLAS    EP CSCSH
Sbjct  623  RSHKLASGNHTEPGCSCSH  641



>ref|XP_002312858.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
 gb|EEE86813.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
Length=653

 Score =   322 bits (825),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LG ARVV+TAVVPDD+ KI+ ++ + 
Sbjct  456  KVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLG-ARVVSTAVVPDDVSKIKAVVQKW  514

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D MDL+LTLGGTG SPRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  515  SDTDRMDLILTLGGTGFSPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRSAA  574

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH+ HA+A P DTWE
Sbjct  575  GIRGSTLIINMPGNPNAVAECVEALLPALKHALKQIKGDKREKHPRHITHAEAEPVDTWE  634

Query  199  RSHKLASIGE-EPTCSCSH  146
            RSHKLAS    EP CSCSH
Sbjct  635  RSHKLASGNHTEPGCSCSH  653



>ref|XP_004491158.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X2 [Cicer arietinum]
Length=396

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV T+VVPD++ KI+DIL R 
Sbjct  200  RVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVATSVVPDNVTKIQDILRRW  259

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D + MDL++TLGGTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR AA
Sbjct  260  SDNEQMDLIITLGGTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSRSAA  319

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQ+RGDKREK+PRH PHA+AVP D WE
Sbjct  320  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQLRGDKREKHPRHTPHAEAVPTDVWE  379

Query  199  RSHKLASIGEEPTCSC  152
            +S+ +++ G E +CSC
Sbjct  380  QSY-MSATGGEVSCSC  394



>ref|NP_001242529.1| molybdopterin biosynthesis protein CNX1-like [Glycine max]
 gb|AEO14873.1| rfls1 protein [Glycine max]
Length=652

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV TAVVPDD+ KI+DIL R 
Sbjct  454  KVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVATAVVPDDVAKIQDILRRW  513

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DI+ MDL++TLGGTG + RD+TPEATKPL++KETPGLLHVMMQESLK+T  AMLSR AA
Sbjct  514  SDIEQMDLIITLGGTGFTSRDLTPEATKPLIEKETPGLLHVMMQESLKVTKSAMLSRSAA  573

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQ+RGDK+EK+PRHVPHA+AVPAD WE
Sbjct  574  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQLRGDKKEKHPRHVPHAEAVPADVWE  633

Query  199  RSHKLAS-IGEEPTCSC  152
            +S+ LA+  G + +CSC
Sbjct  634  QSYMLATGAGSDVSCSC  650



>gb|KHN38452.1| Molybdopterin biosynthesis protein CNX1 [Glycine soja]
Length=652

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV TAVVPDD+ KI+DIL R 
Sbjct  454  KVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVATAVVPDDVAKIQDILRRW  513

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DI+ MDL++TLGGTG + RD+TPEATKPL++KETPGLLHVMMQESLK+T  AMLSR AA
Sbjct  514  SDIEQMDLIITLGGTGFTSRDLTPEATKPLIEKETPGLLHVMMQESLKVTKSAMLSRSAA  573

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQ+RGDK+EK+PRHVPHA+AVPAD WE
Sbjct  574  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQLRGDKKEKHPRHVPHAEAVPADVWE  633

Query  199  RSHKLAS-IGEEPTCSC  152
            +S+ LA+  G + +CSC
Sbjct  634  QSYMLATGAGSDVSCSC  650



>dbj|BAJ33990.1| unnamed protein product [Thellungiella halophila]
Length=531

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 180/202 (89%), Gaps = 4/202 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV  AVVPD++++I+DIL + 
Sbjct  330  KVAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVAIAVVPDEVERIKDILQKW  389

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  390  SDVDEIDLILTLGGTGFTPRDVTPEATKEVIERETPGLLFVMMQESLKITPFAMLSRSAA  449

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  P DTW
Sbjct  450  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATAPTDTW  509

Query  202  ERSHKLASIGE---EPTCSCSH  146
            +RS+K A  GE   E  CSC+H
Sbjct  510  DRSYKSAYEGEETREAGCSCTH  531



>ref|XP_004491157.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X1 [Cicer arietinum]
Length=444

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA GAGPDRSGPRAVSV+NSSSERLGGARVV T+VVPD++ KI+DIL R 
Sbjct  248  RVAILTVSDTVAMGAGPDRSGPRAVSVINSSSERLGGARVVATSVVPDNVTKIQDILRRW  307

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D + MDL++TLGGTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR AA
Sbjct  308  SDNEQMDLIITLGGTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSRSAA  367

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQ+RGDKREK+PRH PHA+AVP D WE
Sbjct  368  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQLRGDKREKHPRHTPHAEAVPTDVWE  427

Query  199  RSHKLASIGEEPTCSC  152
            +S+ +++ G E +CSC
Sbjct  428  QSY-MSATGGEVSCSC  442



>ref|XP_007015551.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 ref|XP_007015552.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 gb|EOY33170.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 gb|EOY33171.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
Length=676

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VA+LTVSDTVA+G GPDRSGPRAVSVVNSSSE+LGGA+VV  AVV DD+ KI+D+L R 
Sbjct  478  KVAVLTVSDTVASGVGPDRSGPRAVSVVNSSSEKLGGAKVVAAAVVSDDVGKIKDVLQRW  537

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  538  SDIDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRSAA  597

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH  A P DTWE
Sbjct  598  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHEQATPVDTWE  657

Query  199  RSHKLASIGE-EPTCSCSH  146
            RSHKLAS G  EP CSCSH
Sbjct  658  RSHKLASAGGIEPPCSCSH  676



>gb|AAA97413.1| molybdenum cofactor biosynthesis enzyme [Arabidopsis thaliana]
 emb|CAB38312.1| molybdenum cofactor biosynthesis enzyme [Arabidopsis thaliana]
Length=670

 Score =   320 bits (820),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 182/203 (90%), Gaps = 5/203 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  468  KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  527

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  528  SDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  587

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A +P DTW
Sbjct  588  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATLPTDTW  647

Query  202  ERSHKLA----SIGEEPTCSCSH  146
            ++S+KLA       EE  CSC+H
Sbjct  648  DQSYKLAYETGEKKEEAGCSCTH  670



>ref|XP_004291534.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Fragaria 
vesca subsp. vesca]
Length=666

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 178/200 (89%), Gaps = 2/200 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA+LTVSDTVA+GAGPDRSGPRAVSVV S SERLGGA+VV+TAVVPDD+ KI+D+L R 
Sbjct  467  RVAVLTVSDTVASGAGPDRSGPRAVSVVTSCSERLGGAKVVSTAVVPDDVSKIKDVLQRW  526

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D ++MDL+LTLGGTG +PRDVTPEATK L++KETPGLL VMMQESLK+TPFAMLSR AA
Sbjct  527  SDSENMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLFVMMQESLKVTPFAMLSRAAA  586

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQI+GDKREK+PRHVPHA A   DTWE
Sbjct  587  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQIKGDKREKHPRHVPHAQAASMDTWE  646

Query  199  RSHKLAS-IGEEPT-CSCSH  146
            +S+KLAS  G++ + CSC H
Sbjct  647  QSYKLASGSGKDSSGCSCCH  666



>gb|EYU35987.1| hypothetical protein MIMGU_mgv1a002507mg [Erythranthe guttata]
Length=665

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 180/203 (89%), Gaps = 4/203 (2%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            SRVAILTVSDTVA+GAGPDRSGPRAVSVVNSSSE+LGGA V+ TAVVPD+I KI+++L +
Sbjct  463  SRVAILTVSDTVASGAGPDRSGPRAVSVVNSSSEKLGGATVIATAVVPDEIPKIKELLEK  522

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
              D+D MDL++TLGGTG +PRDVTPEATK ++ KETPGLL+VMM+ESLK+TPFAMLSR A
Sbjct  523  WSDVDKMDLIITLGGTGFTPRDVTPEATKQVIHKETPGLLYVMMRESLKVTPFAMLSRSA  582

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV---PA  212
            AGIRGSTLIINMPGNPNAVAECME LLPALKHALKQ++GDKREK+P HVPHA AV     
Sbjct  583  AGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQVKGDKREKHPNHVPHAQAVGPTGT  642

Query  211  DTWERSHKLAS-IGEEPTCSCSH  146
            DTWERS+KLA+ + +E  CSCSH
Sbjct  643  DTWERSYKLAADVAQETGCSCSH  665



>gb|AFW59745.1| viviparous10 [Zea mays]
Length=339

 Score =   307 bits (786),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI+ IL++ 
Sbjct  143  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGATVVATAVVPDEVDKIKGILVQW  202

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DIDH++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLKITPFAMLSR  A
Sbjct  203  SDIDHVNLILTLGGTGFTPRDVTPEATKMVIQKEAPGLTFVMLQESLKITPFAMLSRATA  262

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH PHA A P D WE
Sbjct  263  GIRGSTLIINMPGNPNAVAECLEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVDQWE  322

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  323  RSFRAASSGSG-GCSC  337



>emb|CDX70956.1| BnaC03g10400D [Brassica napus]
Length=672

 Score =   317 bits (813),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 182/205 (89%), Gaps = 7/205 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  468  KVAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  527

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTG +PRD+TPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  528  SDVDEIDLILTLGGTGFTPRDITPEATKQVIERETPGLLFVMMQESLKITPFAMLSRSAA  587

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVP---AD  209
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+HVPHA+A P   AD
Sbjct  588  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHVPHAEASPAPAAD  647

Query  208  TWERSHKLASIGEEPT----CSCSH  146
            TW++S+K A  G E T    CSC+H
Sbjct  648  TWDKSYKAAYEGAEETKDAGCSCTH  672



>ref|XP_002874027.1| hypothetical protein ARALYDRAFT_489011 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50286.1| hypothetical protein ARALYDRAFT_489011 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 181/203 (89%), Gaps = 5/203 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  469  KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  528

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL V+MQESLKITPFAMLSR AA
Sbjct  529  SDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVVMQESLKITPFAMLSRSAA  588

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  P DTW
Sbjct  589  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATRPTDTW  648

Query  202  ERSHKLASI----GEEPTCSCSH  146
            ++S+KLA       EE  CSC+H
Sbjct  649  DQSYKLAYATGEKKEEAGCSCTH  671



>ref|XP_009131833.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Brassica 
rapa]
Length=672

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 182/205 (89%), Gaps = 7/205 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  468  KVAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  527

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTG +PRD+TPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  528  SDVDEIDLILTLGGTGFTPRDITPEATKQVIERETPGLLFVMMQESLKITPFAMLSRSAA  587

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVP---AD  209
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A P   AD
Sbjct  588  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEASPAPAAD  647

Query  208  TWERSHKLASIGEEPT----CSCSH  146
            TW++S+K A  G E T    CSC+H
Sbjct  648  TWDKSYKAAYEGAEETKDAGCSCTH  672



>ref|XP_006400671.1| hypothetical protein EUTSA_v10012894mg [Eutrema salsugineum]
 gb|ESQ42124.1| hypothetical protein EUTSA_v10012894mg [Eutrema salsugineum]
Length=669

 Score =   317 bits (811),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 180/202 (89%), Gaps = 4/202 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV  AVVPD++++I+DIL + 
Sbjct  468  KVAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVAIAVVPDEVERIKDILQKW  527

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  528  SDVDEIDLILTLGGTGFTPRDVTPEATKEVIERETPGLLFVMMQESLKITPFAMLSRSAA  587

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  P DTW
Sbjct  588  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATAPTDTW  647

Query  202  ERSHKLASIGE---EPTCSCSH  146
            +RS+K A  GE   E  CSC+H
Sbjct  648  DRSYKSAYEGEETREAGCSCTH  669



>ref|NP_197599.1| molybdenum cofactor biosynthesis enzyme CNX1 [Arabidopsis thaliana]
 sp|Q39054.2|CNX1_ARATH RecName: Full=Molybdopterin biosynthesis protein CNX1; AltName: 
Full=Molybdenum cofactor biosynthesis enzyme CNX1; Includes: 
RecName: Full=Molybdopterin molybdenumtransferase; Short=MPT 
Mo-transferase; AltName: Full=Domain E; Includes: RecName: 
Full=Molybdopterin adenylyltransferase; Short=MPT adenylyltransferase; 
AltName: Full=Domain G [Arabidopsis thaliana]
 gb|AED92917.1| molybdenum cofactor biosynthesis enzyme CNX1 [Arabidopsis thaliana]
Length=670

 Score =   317 bits (811),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 181/203 (89%), Gaps = 5/203 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  468  KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  527

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  528  SDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  587

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A +P DTW
Sbjct  588  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATLPTDTW  647

Query  202  ERSHKLA----SIGEEPTCSCSH  146
            ++S+K A       EE  CSC+H
Sbjct  648  DQSYKSAYETGEKKEEAGCSCTH  670



>ref|XP_007015553.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 3 [Theobroma cacao]
 gb|EOY33172.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 3 [Theobroma cacao]
Length=630

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 178/200 (89%), Gaps = 2/200 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VA+LTVSDTVA+G GPDRSGPRAVSVVNSSSE+LGGA+VV  AVV DD+ KI+D+L R 
Sbjct  431  KVAVLTVSDTVASGVGPDRSGPRAVSVVNSSSEKLGGAKVVAAAVVSDDVGKIKDVLQRW  490

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLK-ITPFAMLSRPA  383
             DID MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK +TPFAMLSR A
Sbjct  491  SDIDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVVTPFAMLSRSA  550

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  203
            AGIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPH  A P DTW
Sbjct  551  AGIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHEQATPVDTW  610

Query  202  ERSHKLASIGE-EPTCSCSH  146
            ERSHKLAS G  EP CSCSH
Sbjct  611  ERSHKLASAGGIEPPCSCSH  630



>gb|KGN66381.1| hypothetical protein Csa_1G600210 [Cucumis sativus]
Length=524

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            S+VAILTVSDTVA+GAGPDRSGPRAVS+V +SSE+LGG  VV TAVV DD+ KI+D+L++
Sbjct  325  SKVAILTVSDTVASGAGPDRSGPRAVSIVQASSEKLGGVSVVATAVVSDDVSKIQDVLVK  384

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CDID +DL+LTLGGTG SPRDVTPEATKPLL KETPGLL+VMMQESLK+TPFA+LSR A
Sbjct  385  WCDIDKVDLILTLGGTGFSPRDVTPEATKPLLHKETPGLLYVMMQESLKVTPFAVLSRSA  444

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  203
            AGIRGSTLIINMPGNPNA AECME LLP+LKHALKQ++GDKREK+PRHVPHA+A P + W
Sbjct  445  AGIRGSTLIINMPGNPNAAAECMEALLPSLKHALKQMKGDKREKHPRHVPHAEATPTNIW  504

Query  202  ERSHKLASIG-EEPTCSCSH  146
            ++S+KLAS G  E  CSCSH
Sbjct  505  DQSYKLASEGISETGCSCSH  524



>ref|XP_010420950.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Camelina 
sativa]
Length=670

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 180/203 (89%), Gaps = 5/203 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  468  KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  527

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D MDL+LTLGGTG SPRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  528  SDDDGMDLILTLGGTGFSPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  587

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  PADTW
Sbjct  588  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATTPADTW  647

Query  202  ERSHKLASIGEEPT----CSCSH  146
            ++S+K A   EE      CSC+H
Sbjct  648  DQSYKSAYATEEKKEDAGCSCTH  670



>ref|XP_008787719.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Phoenix dactylifera]
Length=671

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+G GPDRSGPRA+SVVNSSSE LGGA VV TAVVPD++ KI+D+L + 
Sbjct  476  KVAILTVSDTVASGGGPDRSGPRAISVVNSSSESLGGAHVVATAVVPDEVDKIKDVLQKW  535

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID +DL+LTLGGTG SPRDVTPEATK  ++KE+PGL+ VM+QE LK+TPFAMLSR AA
Sbjct  536  SDIDKVDLILTLGGTGFSPRDVTPEATKASIEKESPGLVLVMLQEGLKVTPFAMLSRAAA  595

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PHA+A P D WE
Sbjct  596  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHIPHAEAQPVDQWE  655

Query  199  RSHKLASIGEEPTCSCSH  146
            RS K A+ G E  CSCSH
Sbjct  656  RSFKAATAGSE--CSCSH  671



>ref|XP_010093278.1| Molybdopterin biosynthesis protein CNX1 [Morus notabilis]
 gb|EXB53803.1| Molybdopterin biosynthesis protein CNX1 [Morus notabilis]
Length=674

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            ++AILTVSDTVA+GAGPDRSGPRAVSVVNSS+ RLGGARVV TA VPD++ KI+D+LL+ 
Sbjct  476  KLAILTVSDTVASGAGPDRSGPRAVSVVNSSAGRLGGARVVLTAAVPDEVSKIKDVLLKW  535

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CDID +DL+LTLGGTG SPRDVTPEATK +++KET GLL+VMMQESLK+TPFAMLSR AA
Sbjct  536  CDIDRVDLILTLGGTGFSPRDVTPEATKEVIEKETSGLLYVMMQESLKVTPFAMLSRSAA  595

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAV ECME LLPALKHALKQI+GDKREK+PRHVPHA+A P D WE
Sbjct  596  GIRGSTLIINMPGNPNAVGECMEALLPALKHALKQIKGDKREKHPRHVPHAEAAPQDEWE  655

Query  199  RSHKLA--SIGEEPTCSC  152
            RS+K A  S      CSC
Sbjct  656  RSYKSASGSGSRRGACSC  673



>emb|CDP15575.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA+G GPDRSGPRA+SVVNS+SE+LGGARV  TAVV DD+ +I+D LL  
Sbjct  466  RVAILTVSDTVASGKGPDRSGPRAISVVNSASEKLGGARVAATAVVSDDVLQIKDTLLSW  525

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D++ MDL+LTLGGTG +PRDVTPEATK +++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  526  SDVEKMDLILTLGGTGFTPRDVTPEATKVVIEKETPGLLYVMMQESLKVTPFAMLSRSAA  585

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRG+TLIINMPGNPNAVAECME LLP LKHALKQ+RGDKREK+P HVPHA+A P+DTWE
Sbjct  586  GIRGTTLIINMPGNPNAVAECMEALLPVLKHALKQVRGDKREKHPLHVPHAEAAPSDTWE  645

Query  199  RSHKLASIG-EEPTCSCSH  146
            RS K AS   +   CSCSH
Sbjct  646  RSFKSASNNVQHSGCSCSH  664



>gb|KFK26315.1| hypothetical protein AALP_AA8G231600 [Arabis alpina]
Length=670

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRA+SVV SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  469  KVAILTVSDTVSAGAGPDRSGPRAISVVESSSEKLGGAKVVATAVVPDEVERIKDILKKW  528

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTGC+PRDVTPEATK +++K TPGLL VMMQESLKITPFAMLSR AA
Sbjct  529  SDVDEIDLILTLGGTGCTPRDVTPEATKEVIEKTTPGLLFVMMQESLKITPFAMLSRSAA  588

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  P DTW
Sbjct  589  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATAPTDTW  648

Query  202  ERSHKLASIG---EEPTCSCSH  146
            +RS+K A  G   +E   SC+H
Sbjct  649  DRSYKSAYEGGERKEAGYSCTH  670



>ref|XP_010685502.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Beta vulgaris 
subsp. vulgaris]
Length=649

 Score =   314 bits (804),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 175/200 (88%), Gaps = 2/200 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILT+SDTVA GAGPDRSGPRA+SV+NSSSERLGGA+VV+TAVVPDD+Q I+D+L R 
Sbjct  450  KVAILTISDTVATGAGPDRSGPRAISVINSSSERLGGAKVVSTAVVPDDVQSIKDVLWRW  509

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL++TLGGTG SPRDVTPEATK +++KETPGLL+VMMQESLK+T  AMLSR AA
Sbjct  510  SDVDKVDLIITLGGTGFSPRDVTPEATKEVIEKETPGLLYVMMQESLKVTQTAMLSRSAA  569

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQI+GDKREK+PRHV HA A   DTWE
Sbjct  570  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQIKGDKREKHPRHVSHAQAATVDTWE  629

Query  199  RSHKLAS--IGEEPTCSCSH  146
            +S+K A+    +E  CSCSH
Sbjct  630  QSYKKATTNTAKELGCSCSH  649



>ref|XP_003617060.1| Molybdopterin biosynthesis CNX1 protein [Medicago truncatula]
 gb|AET00019.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=653

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVAAGAGPDRSGPRAVSV+NSSSERLGGA+VV T+VVPD++ KI+DIL R 
Sbjct  454  RVAILTVSDTVAAGAGPDRSGPRAVSVINSSSERLGGAKVVATSVVPDNVAKIQDILRRW  513

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D + MDL++TLGGTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR AA
Sbjct  514  SDNEQMDLIITLGGTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSRSAA  573

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC E LLPALKH LKQ+RGDKREK+PRH+PHA+AVP D WE
Sbjct  574  GIRGSTLIINMPGNPNAVAECTEALLPALKHGLKQLRGDKREKHPRHIPHAEAVPTDVWE  633

Query  199  RSHKLAS--IGEEPTCSC  152
            RS+  A+   G E +CSC
Sbjct  634  RSYMSATGAGGSEVSCSC  651



>ref|XP_006286370.1| hypothetical protein CARUB_v10000376mg, partial [Capsella rubella]
 gb|EOA19268.1| hypothetical protein CARUB_v10000376mg, partial [Capsella rubella]
Length=684

 Score =   315 bits (806),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 179/203 (88%), Gaps = 5/203 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD+++KI+DIL + 
Sbjct  482  KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVEKIKDILQKW  541

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  542  SDDDGMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  601

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A  PADTW
Sbjct  602  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATTPADTW  661

Query  202  ERSHKLASIGEEPT----CSCSH  146
            + S+K A   EE      CSC+H
Sbjct  662  DESYKSAYATEEKKEEAGCSCTH  684



>emb|CDX88829.1| BnaA03g08200D [Brassica napus]
Length=670

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 179/202 (89%), Gaps = 5/202 (2%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            VAILTVSDTV+AGAGPDRSGPRAVSV++SSSE+LGGA+VV +AVVPD++++I+DIL +  
Sbjct  469  VAILTVSDTVSAGAGPDRSGPRAVSVIDSSSEKLGGAKVVASAVVPDEVERIKDILQKWS  528

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            D+D +DL+LTLGGTG +PRDVTPEATK ++Q+ETPGLL VMMQESLKITPFAMLSR AAG
Sbjct  529  DVDEIDLILTLGGTGFTPRDVTPEATKQVIQRETPGLLFVMMQESLKITPFAMLSRSAAG  588

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV-PADTWE  200
            IRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P H+PHA+A  PADTW+
Sbjct  589  IRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPNHIPHAEATAPADTWD  648

Query  199  RSHKLASIGEEPT----CSCSH  146
            +S+K A  G   T    CSC+H
Sbjct  649  KSYKSAYEGAGETKDAGCSCTH  670



>ref|XP_007204973.1| hypothetical protein PRUPE_ppa002426mg [Prunus persica]
 gb|EMJ06172.1| hypothetical protein PRUPE_ppa002426mg [Prunus persica]
Length=674

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 171/197 (87%), Gaps = 1/197 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA+GAGPDRSGPR VSVVNS SERLGGARVV+TAVVPDD+ +I+D L R 
Sbjct  476  RVAILTVSDTVASGAGPDRSGPRGVSVVNSCSERLGGARVVSTAVVPDDVSQIKDALSRW  535

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK L++KETPGL+HVMMQ SLK+TP AMLSR AA
Sbjct  536  SDVDKMDLILTLGGTGFTPRDVTPEATKQLIEKETPGLVHVMMQASLKVTPTAMLSRSAA  595

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKH LKQI+G KREK+PRHVPHA +   D WE
Sbjct  596  GIRGSTLIINMPGNPNAVAECMEALLPALKHGLKQIKGGKREKHPRHVPHAQSASMDVWE  655

Query  199  RSHKLAS-IGEEPTCSC  152
            +SH+LAS  G E  CSC
Sbjct  656  QSHRLASATGREHGCSC  672



>ref|XP_004159365.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1-like [Cucumis sativus]
Length=662

 Score =   312 bits (800),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            S+VAILTVSDTVA+GAGPDRSGPRAVS+V +SSE+LGG  VV TAVV DD+ KI+D+L++
Sbjct  463  SKVAILTVSDTVASGAGPDRSGPRAVSIVQASSEKLGGVSVVATAVVSDDVSKIQDVLVK  522

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CDID +DL+LTLGGTG SPRDVTPEATKPLL KETPGLL+VMMQESLK+TPFA+LSR A
Sbjct  523  WCDIDKVDLILTLGGTGFSPRDVTPEATKPLLHKETPGLLYVMMQESLKVTPFAVLSRSA  582

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  203
            AGIRGSTLIINMPGNPNA AECME LLP+LKHALKQ++GDKREK+PRHVPHA+A P + W
Sbjct  583  AGIRGSTLIINMPGNPNAAAECMEALLPSLKHALKQMKGDKREKHPRHVPHAEATPTNIW  642

Query  202  ERSHKLASIG-EEPTCSCSH  146
            ++S+KLAS G  E  CSCSH
Sbjct  643  DQSYKLASEGISETGCSCSH  662



>ref|XP_004144145.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Cucumis 
sativus]
Length=662

 Score =   312 bits (800),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            S+VAILTVSDTVA+GAGPDRSGPRAVS+V +SSE+LGG  VV TAVV DD+ KI+D+L++
Sbjct  463  SKVAILTVSDTVASGAGPDRSGPRAVSIVQASSEKLGGVSVVATAVVSDDVSKIQDVLVK  522

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CDID +DL+LTLGGTG SPRDVTPEATKPLL KETPGLL+VMMQESLK+TPFA+LSR A
Sbjct  523  WCDIDKVDLILTLGGTGFSPRDVTPEATKPLLHKETPGLLYVMMQESLKVTPFAVLSRSA  582

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTW  203
            AGIRGSTLIINMPGNPNA AECME LLP+LKHALKQ++GDKREK+PRHVPHA+A P + W
Sbjct  583  AGIRGSTLIINMPGNPNAAAECMEALLPSLKHALKQMKGDKREKHPRHVPHAEATPTNIW  642

Query  202  ERSHKLASIG-EEPTCSCSH  146
            ++S+KLAS G  E  CSCSH
Sbjct  643  DQSYKLASEGISETGCSCSH  662



>ref|XP_010926610.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Elaeis guineensis]
Length=671

 Score =   312 bits (800),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+GAGPDRSGPRA+SVVNSSSE LGGA VV TAVVPD++ KI+D+L + 
Sbjct  476  KVAILTVSDTVASGAGPDRSGPRAISVVNSSSESLGGAHVVATAVVPDEVDKIQDVLQKW  535

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTG SPRDVTPEATK  ++KETPGL+ VM+QESLK+TPFAMLSR AA
Sbjct  536  SDVDKVDLILTLGGTGFSPRDVTPEATKASIEKETPGLVLVMLQESLKVTPFAMLSRAAA  595

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME L+PALKHALKQI+GDKREK+PRHVPHA+A   D WE
Sbjct  596  GIRGSTLIINMPGNPNAVAECMEALMPALKHALKQIKGDKREKHPRHVPHAEAQSVDQWE  655

Query  199  RSHKLASIGEEPTCSCSH  146
            RS K A+ G    CSCSH
Sbjct  656  RSFKAATAGS--GCSCSH  671



>ref|XP_010493217.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Camelina 
sativa]
Length=671

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 179/204 (88%), Gaps = 6/204 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSERLGGA+VV TAVVPD++++I+DIL + 
Sbjct  468  KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSERLGGAKVVATAVVPDEVERIKDILEKW  527

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  528  SDDDGMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  587

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV--PADT  206
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+H+PHA+A    ADT
Sbjct  588  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKHIPHAEATTPAADT  647

Query  205  WERSHKLASIGEEPT----CSCSH  146
            W++S+K A   EE      CSC+H
Sbjct  648  WDQSYKSAYATEEKKEEAGCSCTH  671



>ref|XP_009383824.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   311 bits (797),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++G+GPDRSGPRAVSVVNS SE+LGGA VV TAVVPD++ KI++ LL+ 
Sbjct  461  KVAILTVSDTVSSGSGPDRSGPRAVSVVNSLSEKLGGAHVVATAVVPDEVDKIKNTLLKW  520

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID +DL+LTLGGTGC+PRDVTPEATK ++QKETPGL  VM+QESLK+TPFAMLSR AA
Sbjct  521  SDIDKVDLILTLGGTGCTPRDVTPEATKAVIQKETPGLSFVMLQESLKVTPFAMLSRAAA  580

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME L+P LKH LKQI+GDKREK+PRH PHA+A P D WE
Sbjct  581  GIRGSTLIINMPGNPNAVAECMEALVPGLKHGLKQIKGDKREKHPRHAPHAEAPPTDQWE  640

Query  199  RSHKLASIGEEPTCSCSH  146
            RS+K AS   +  CSCSH
Sbjct  641  RSYKAASATAQ--CSCSH  656



>ref|XP_010520491.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1 [Tarenaya hassleriana]
Length=672

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 174/203 (86%), Gaps = 5/203 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            R AILTVSDTV++GAGPDRSGPR VSVVNSSSE+LGGA+VV TAVVPD++++I+DIL R 
Sbjct  470  RAAILTVSDTVSSGAGPDRSGPRGVSVVNSSSEKLGGAQVVATAVVPDEVERIKDILKRW  529

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTG +PRDVTPEATK +++KETPGLL VMMQESLK+T FAMLSR AA
Sbjct  530  SDVDRVDLILTLGGTGFTPRDVTPEATKEVIEKETPGLLFVMMQESLKVTQFAMLSRAAA  589

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME +LPALKHALKQI+GDKREK+PRHVPHA+    DTW+
Sbjct  590  GIRGSTLIINMPGNPNAVAECMEAILPALKHALKQIKGDKREKHPRHVPHAETATTDTWD  649

Query  199  RSHKLASIGEEPT-----CSCSH  146
            RS + A  G EP      C C+H
Sbjct  650  RSFRSAYGGGEPETKERGCGCTH  672



>ref|XP_010651619.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Vitis vinifera]
Length=568

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA+LTVSDTVA+GAGPDRSGPRA+SVVNSSSERLGGARVV TAVV DD+ KI++IL + 
Sbjct  370  RVAVLTVSDTVASGAGPDRSGPRAISVVNSSSERLGGARVVATAVVADDVSKIKEILQKW  429

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D++ MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  430  SDVNRMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  489

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PH+ A   DTWE
Sbjct  490  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHLPHSQAAAVDTWE  549

Query  199  RSHKLAS-IGEEPTCSCSH  146
            RS+K+AS    EPTCSCSH
Sbjct  550  RSYKMASGNASEPTCSCSH  568



>ref|XP_002447271.1| hypothetical protein SORBIDRAFT_06g031680 [Sorghum bicolor]
 gb|EES11599.1| hypothetical protein SORBIDRAFT_06g031680 [Sorghum bicolor]
Length=660

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVS+VNSSSE+LGGA VV T+VVPD++ KI+ IL++ 
Sbjct  463  KVAILTVSDTVSSGAGPDRSGPRAVSIVNSSSEKLGGATVVATSVVPDEVDKIKGILIQW  522

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DIDH++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLKITPFAMLSR  A
Sbjct  523  SDIDHVNLILTLGGTGFTPRDVTPEATKSVIQKEAPGLTFVMLQESLKITPFAMLSRATA  582

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH PHA A P D WE
Sbjct  583  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVDQWE  642

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  643  RSFRAASAGSGRGCSC  658



>ref|XP_010454418.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Camelina 
sativa]
Length=666

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 178/203 (88%), Gaps = 5/203 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  464  KVAILTVSDTVSAGAGPDRSGPRAVSVVESSSEKLGGAKVVATAVVPDEVERIKDILQKW  523

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  524  SDDDGMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  583

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADA-VPADTW  203
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+P+ +PHA+A  PADTW
Sbjct  584  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPKLIPHAEATTPADTW  643

Query  202  ERSHKLASI----GEEPTCSCSH  146
            ++S+K A       EE  CSC+H
Sbjct  644  DQSYKSAYATEDKKEEAGCSCTH  666



>emb|CAN65528.1| hypothetical protein VITISV_026358 [Vitis vinifera]
Length=518

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA+LTVSDTVA+GAGPDRSGPRA+SVVNSSSERLGGARVV TAVV DD+ KI++IL + 
Sbjct  320  RVAVLTVSDTVASGAGPDRSGPRAISVVNSSSERLGGARVVATAVVADDVSKIKEILQKW  379

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D++ MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  380  SDVNRMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  439

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTL INMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PH+ A   DTWE
Sbjct  440  GIRGSTLXINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHLPHSQAEAVDTWE  499

Query  199  RSHKLAS-IGEEPTCSCSH  146
            RSHK+AS    EPTCSCSH
Sbjct  500  RSHKMASGNASEPTCSCSH  518



>ref|XP_006653844.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Oryza 
brachyantha]
Length=671

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 174/196 (89%), Gaps = 2/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRA+SVVNSSSE+LGGA VV TAVVPDD++KI++IL++ 
Sbjct  476  KVAILTVSDTVSSGAGPDRSGPRAISVVNSSSEKLGGATVVATAVVPDDVEKIKNILVKW  535

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DIDH++L+LTLGGTG +PRDVTPEATK +++KE PGL ++M+QESLK+TPFAMLSR  A
Sbjct  536  SDIDHINLILTLGGTGFTPRDVTPEATKSVIEKEAPGLTYIMLQESLKVTPFAMLSRATA  595

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGS LIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPHA+A P D W+
Sbjct  596  GIRGSALIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHAEAAPVDQWD  655

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  656  RSFRAASTGM--GCSC  669



>ref|XP_009340227.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1 [Pyrus x bretschneideri]
Length=543

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 169/197 (86%), Gaps = 1/197 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA+GAGPDRSGPRAVSVVNS SERLGGARVV+TAVVPDD+ KI+ +L R 
Sbjct  345  RVAILTVSDTVASGAGPDRSGPRAVSVVNSCSERLGGARVVSTAVVPDDVSKIKGVLHRW  404

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID MDL+LTLGGTG +PR VTPEATK L++KETPGLLHVMM+ESLK+TP AMLSR AA
Sbjct  405  SDIDQMDLILTLGGTGFTPRGVTPEATKELIEKETPGLLHVMMRESLKVTPTAMLSRSAA  464

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGS+LIINM GNPNAVAECM  LLPALKH LKQIRGD+RE +P HVPH     AD WE
Sbjct  465  GIRGSSLIINMHGNPNAVAECMGALLPALKHGLKQIRGDERENHPXHVPHTQGATADVWE  524

Query  199  RSHKLASI-GEEPTCSC  152
            +S+KLAS  G EP CSC
Sbjct  525  QSYKLASASGSEPGCSC  541



>ref|XP_004517264.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Cicer 
arietinum]
Length=185

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 1/183 (1%)
 Frame = -3

Query  700  GAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCCDIDHMDLVLTLG  521
            GAGPDRSGPRAVSV+NSSSERLGGARVV T+VVPD++ KI+DIL R  D + MDL++TLG
Sbjct  2    GAGPDRSGPRAVSVINSSSERLGGARVVATSVVPDNVTKIQDILRRWSDNEQMDLIITLG  61

Query  520  GTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAGIRGSTLIINMPG  341
            GTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR AAGIRGSTLIINMPG
Sbjct  62   GTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSRSAAGIRGSTLIINMPG  121

Query  340  NPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWERSHKLASIGEEPT  161
            NPNAVAECME LLPALKH LKQ+RGDKREK+PRH PHA+AVP D WE+S+ +++ G E +
Sbjct  122  NPNAVAECMEALLPALKHGLKQLRGDKREKHPRHTPHAEAVPTDVWEQSY-MSATGGEVS  180

Query  160  CSC  152
            CSC
Sbjct  181  CSC  183



>ref|XP_004960170.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Setaria 
italica]
Length=661

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI+ IL++ 
Sbjct  464  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGATVVATAVVPDEVDKIKGILVQW  523

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL+ VM+QESLKITPFAMLSR  A
Sbjct  524  SDIDCVNLILTLGGTGFTPRDVTPEATKSIIEKEAPGLIFVMLQESLKITPFAMLSRAMA  583

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH PHA A P D WE
Sbjct  584  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVDQWE  643

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  644  RSFRAASAGSGGGCSC  659



>emb|CBI24388.3| unnamed protein product [Vitis vinifera]
Length=652

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA+LTVSDTVA+GAGPDRSGPRA+SVVNSSSERLGGARVV TAVV DD+ KI++IL + 
Sbjct  454  RVAVLTVSDTVASGAGPDRSGPRAISVVNSSSERLGGARVVATAVVADDVSKIKEILQKW  513

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D++ MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  514  SDVNRMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  573

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PH+ A   DTWE
Sbjct  574  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHLPHSQAAAVDTWE  633

Query  199  RSHKLAS-IGEEPTCSCSH  146
            RS+K+AS    EPTCSCSH
Sbjct  634  RSYKMASGNASEPTCSCSH  652



>ref|XP_002276536.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Vitis vinifera]
 ref|XP_010651618.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Vitis vinifera]
Length=658

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA+LTVSDTVA+GAGPDRSGPRA+SVVNSSSERLGGARVV TAVV DD+ KI++IL + 
Sbjct  460  RVAVLTVSDTVASGAGPDRSGPRAISVVNSSSERLGGARVVATAVVADDVSKIKEILQKW  519

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D++ MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  520  SDVNRMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  579

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRH+PH+ A   DTWE
Sbjct  580  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHLPHSQAAAVDTWE  639

Query  199  RSHKLAS-IGEEPTCSCSH  146
            RS+K+AS    EPTCSCSH
Sbjct  640  RSYKMASGNASEPTCSCSH  658



>emb|CAE04830.1| OSJNBa0084K01.2 [Oryza sativa Japonica Group]
 emb|CAE54543.1| OSJNBa0015K02.22 [Oryza sativa Japonica Group]
 emb|CAH67068.1| H0112G12.13 [Oryza sativa Indica Group]
 gb|EEC78184.1| hypothetical protein OsI_17781 [Oryza sativa Indica Group]
Length=661

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 172/196 (88%), Gaps = 2/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+ GAGPDRSGPRA+SVVNSSSE+LGGA VV TAVVPDD++KI++IL++ 
Sbjct  466  KVAILTVSDTVSLGAGPDRSGPRAISVVNSSSEKLGGATVVATAVVPDDVEKIKNILVKW  525

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID + L+LTLGGTG +PRDVTPEATK +++KE PGL +VM+QESLK+TPFAMLSR  A
Sbjct  526  SDIDRVSLILTLGGTGFTPRDVTPEATKSVIEKEAPGLTYVMLQESLKVTPFAMLSRATA  585

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKREK+PRHVPHA+A P D W+
Sbjct  586  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKREKHPRHVPHAEAAPVDQWD  645

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  646  RSFRAASSGR--GCSC  659



>ref|NP_001168286.1| viviparous10 [Zea mays]
 gb|ACN27697.1| unknown [Zea mays]
 gb|AFW59744.1| viviparous10 [Zea mays]
Length=657

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI+ IL++ 
Sbjct  461  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGATVVATAVVPDEVDKIKGILVQW  520

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DIDH++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLKITPFAMLSR  A
Sbjct  521  SDIDHVNLILTLGGTGFTPRDVTPEATKMVIQKEAPGLTFVMLQESLKITPFAMLSRATA  580

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH PHA A P D WE
Sbjct  581  GIRGSTLIINMPGNPNAVAECLEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVDQWE  640

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  641  RSFRAASSGSG-GCSC  655



>gb|ABB30174.1| molybdenum cofactor biosynthesis protein [Zea mays]
Length=657

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI+ IL++ 
Sbjct  461  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGATVVATAVVPDEVDKIKGILVQW  520

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DIDH++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLKITPFAMLSR  A
Sbjct  521  SDIDHVNLILTLGGTGFTPRDVTPEATKMVIQKEAPGLTFVMLQESLKITPFAMLSRATA  580

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH PHA A P D WE
Sbjct  581  GIRGSTLIINMPGNPNAVAECLEALLPALKHALKQIKGDKREKHPRHTPHAAAAPVDQWE  640

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  641  RSFRAASSGSG-GCSC  655



>ref|XP_003580744.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Brachypodium 
distachyon]
Length=664

 Score =   296 bits (757),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 173/196 (88%), Gaps = 2/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ +I+D+L++ 
Sbjct  469  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDQIKDVLVKW  528

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QESLK+TPFAMLSR A+
Sbjct  529  SDVDRVNLILTLGGTGFTPRDVTPEATKCVIEKEAPGLAFVMIQESLKVTPFAMLSRAAS  588

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHA+KQ++GDKREKNPRHVPHADA P D WE
Sbjct  589  GIRGSTLIINMPGNPNAVAECMEALLPALKHAIKQLKGDKREKNPRHVPHADAAPVDQWE  648

Query  199  RSHKLASIGEEPTCSC  152
            RS K AS G    CSC
Sbjct  649  RSFKAASSGG--GCSC  662



>dbj|BAJ88077.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=657

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 172/196 (88%), Gaps = 2/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL++ 
Sbjct  462  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDKIKEILVKW  521

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QESLK+TPFAMLSR A 
Sbjct  522  SDIDRVNLILTLGGTGFTPRDVTPEATKCVIEKEAPGLAFVMIQESLKVTPFAMLSRAAC  581

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHA+KQ++GDKREKNPRHVPHA+A P D WE
Sbjct  582  GIRGSTLIINMPGNPNAVAECMEALLPALKHAMKQLKGDKREKNPRHVPHAEAAPVDQWE  641

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  642  RSFRAASSGG--GCSC  655



>dbj|BAK02586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=659

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 172/196 (88%), Gaps = 2/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL++ 
Sbjct  464  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDKIKEILVKW  523

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QESLK+TPFAMLSR A 
Sbjct  524  SDIDRVNLILTLGGTGFTPRDVTPEATKCVIEKEAPGLAFVMIQESLKVTPFAMLSRAAC  583

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHA+KQ++GDKREKNPRHVPHA+A P D WE
Sbjct  584  GIRGSTLIINMPGNPNAVAECMEALLPALKHAMKQLKGDKREKNPRHVPHAEAAPVDQWE  643

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  644  RSFRAASSGG--GCSC  657



>gb|AAF73075.1|AF268595_1 molybdenum cofactor biosynthesis protein Cnx1 [Hordeum vulgare]
Length=659

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 172/196 (88%), Gaps = 2/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL++ 
Sbjct  464  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDKIKEILVKW  523

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QESLK+TPFAMLSR A 
Sbjct  524  SDIDRVNLILTLGGTGFTPRDVTPEATKCVIEKEAPGLAFVMIQESLKVTPFAMLSRAAC  583

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAECME LLPALKHA+KQ++GDKREKNPRHVPHA+A P D WE
Sbjct  584  GIRGSTLIINMPGNPNAVAECMEALLPALKHAMKQLKGDKREKNPRHVPHAEAAPVDQWE  643

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS G    CSC
Sbjct  644  RSFRAASSGG--GCSC  657



>pdb|1UUY|A Chain A, Structure Of A Molybdopterin-Bound Cnx1g Domain Links 
Molybdenum And Copper Metabolism
Length=167

 Score =   275 bits (703),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  7    KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  66

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAML+R AA
Sbjct  67   SDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLARSAA  126

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKR  257
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKR
Sbjct  127  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKR  167



>pdb|1O8Q|A Chain A, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|B Chain B, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|C Chain C, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|D Chain D, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|E Chain E, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|F Chain F, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|G Chain G, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
 pdb|1O8Q|H Chain H, The Active Site Of The Molybdenum Cofactor Biosenthetic 
Protein Domain Cnx1g
Length=167

 Score =   275 bits (703),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  7    KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  66

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQE+LKITPFAMLSR AA
Sbjct  67   SDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQEALKITPFAMLSRSAA  126

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKR  257
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKR
Sbjct  127  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKR  167



>pdb|1O8N|A Chain A, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
 pdb|1O8N|B Chain B, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
 pdb|1O8N|C Chain C, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
Length=167

 Score =   274 bits (701),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  7    KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  66

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGG G +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  67   SDVDEMDLILTLGGAGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  126

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKR  257
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKR
Sbjct  127  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKR  167



>pdb|1O8O|A Chain A, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
 pdb|1O8O|B Chain B, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
 pdb|1O8O|C Chain C, The Active Site Of The Molybdenum Cofactor Biosynthetic 
Protein Domain Cnx1g
Length=167

 Score =   273 bits (699),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  7    KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  66

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGG G +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  67   SDVDEMDLILTLGGDGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  126

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKR  257
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI+GDKR
Sbjct  127  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQIKGDKR  167



>ref|XP_001770478.1| predicted protein [Physcomitrella patens]
 gb|EDQ64647.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 169/207 (82%), Gaps = 11/207 (5%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA GAGPDRSGPRAV V+ S SERLGGA VV ++VVPDD++ I+++L R 
Sbjct  469  RVAILTVSDTVATGAGPDRSGPRAVEVITSVSERLGGASVVASSVVPDDVEAIQEVLKRW  528

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID ++L+LT GGTG +PRDVTPEAT+PL+Q+ETPGL  VM+ ESLK+TP AMLSR AA
Sbjct  529  SDIDKVNLILTTGGTGFTPRDVTPEATRPLIQRETPGLTQVMLLESLKVTPTAMLSRAAA  588

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPA--DT  206
            GIRGSTLIINMPGNPNAVAEC+E L+PAL HALKQ+RGDKREK+P HVPHA A PA  D 
Sbjct  589  GIRGSTLIINMPGNPNAVAECIEALMPALPHALKQLRGDKREKHPNHVPHAAARPANSDV  648

Query  205  WERSHKLASIGEEPT--------CSCS  149
            W +S+ LASI  +PT        C+CS
Sbjct  649  WTKSY-LASIETQPTEGPLVDKPCNCS  674



>gb|ABR17730.1| unknown [Picea sitchensis]
Length=677

 Score =   283 bits (725),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+GAGPDRSGPRAVSV+NS SE+LGGARVV T VV D +  IR  L R 
Sbjct  481  KVAILTVSDTVASGAGPDRSGPRAVSVINSMSEKLGGARVVATEVVHDTVDHIRGALQRW  540

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D +DL+LT GGTG +PRDV PEATKPLL KE PGL+  M+QESLK+T  A+LSR AA
Sbjct  541  SDHDKVDLILTTGGTGFAPRDVNPEATKPLLDKEAPGLVQFMLQESLKVTKTAVLSRAAA  600

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC+E L+PAL HAL+Q+RGDK+EK+PRHVPH D+ PAD WE
Sbjct  601  GIRGSTLIINMPGNPNAVAECLEALMPALPHALRQLRGDKKEKHPRHVPHGDSKPADVWE  660

Query  199  RSHKLASIGEEPTCSCSH  146
             S+ +AS  E   CSC+H
Sbjct  661  ASYMMAS-KESRDCSCTH  677



>pdb|1UUX|A Chain A, Structure Of A Molybdopterin-Bound Cnx1g Domain Links 
Molybdenum And Copper Metabolism
Length=163

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  7    KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  66

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK ++++ETPGLL VMMQESLKITPFAMLSR AA
Sbjct  67   SDVDEMDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVMMQESLKITPFAMLSRSAA  126

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQI  272
            GIRGSTLIINMPGNPNAVAECME LLPALKHALKQI
Sbjct  127  GIRGSTLIINMPGNPNAVAECMEALLPALKHALKQI  162



>ref|XP_006847466.1| hypothetical protein AMTR_s00163p00018060 [Amborella trichopoda]
 gb|ERN09047.1| hypothetical protein AMTR_s00163p00018060 [Amborella trichopoda]
Length=675

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 164/196 (84%), Gaps = 1/196 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +V ILTVSDTVAAGAGPD SGPRAVSV+NS SE+LGGA+VV TAV PD++ +I+++L   
Sbjct  479  KVGILTVSDTVAAGAGPDGSGPRAVSVINSLSEKLGGAKVVATAVAPDEVNEIQNVLKNW  538

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+  ++L+LT GGTG SPRD+TPEATK L+++E PGLL VM+QESLK+TPFAMLSR  A
Sbjct  539  SDVKKVNLILTTGGTGFSPRDITPEATKSLIEREAPGLLQVMLQESLKVTPFAMLSRAMA  598

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
            GIRGSTLIINMPGNPNAVAEC++ L+PAL HAL+Q++GDKREK+P HVPH+ A P+DTWE
Sbjct  599  GIRGSTLIINMPGNPNAVAECIDALMPALPHALRQLKGDKREKHPLHVPHSQAEPSDTWE  658

Query  199  RSHKLASIGEEPTCSC  152
            RS + AS   +  C C
Sbjct  659  RSFRSASTASK-QCDC  673



>ref|XP_008231326.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Prunus mume]
Length=640

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 153/197 (78%), Gaps = 20/197 (10%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            ++AILTVSDTVA+GAGPDRSGPR VSVVNS SERLGGA VV+TAVVPDD+ +I+D L R 
Sbjct  461  KIAILTVSDTVASGAGPDRSGPRGVSVVNSCSERLGGATVVSTAVVPDDVSQIKDALSRW  520

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID MDL+LTLGGTG +PRDVTPEATK L++KETPGL+HVMMQ SLK            
Sbjct  521  SDIDKMDLILTLGGTGFTPRDVTPEATKQLIEKETPGLVHVMMQASLK------------  568

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
                   IINMPGNPNAVAECME LLPALKH LKQI+G KREK+PRHVPHA +   D WE
Sbjct  569  -------IINMPGNPNAVAECMEALLPALKHGLKQIKGGKREKHPRHVPHAQSASMDVWE  621

Query  199  RSHKLAS-IGEEPTCSC  152
            +SH+LAS  G E  CSC
Sbjct  622  QSHRLASATGREHGCSC  638



>ref|XP_010926611.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Elaeis guineensis]
Length=652

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 155/198 (78%), Gaps = 21/198 (11%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTVA+GAGPDRSGPRA+SVVNSSSE LGGA VV TAVVPD++ KI+D+L + 
Sbjct  476  KVAILTVSDTVASGAGPDRSGPRAISVVNSSSESLGGAHVVATAVVPDEVDKIQDVLQKW  535

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D +DL+LTLGGTG SPRDVTPEATK  ++KETPGL+ VM+QESLK            
Sbjct  536  SDVDKVDLILTLGGTGFSPRDVTPEATKASIEKETPGLVLVMLQESLK------------  583

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAVPADTWE  200
                   IINMPGNPNAVAECME L+PALKHALKQI+GDKREK+PRHVPHA+A   D WE
Sbjct  584  -------IINMPGNPNAVAECMEALMPALKHALKQIKGDKREKHPRHVPHAEAQSVDQWE  636

Query  199  RSHKLASIGEEPTCSCSH  146
            RS K A+ G    CSCSH
Sbjct  637  RSFKAATAGS--GCSCSH  652



>pdb|1EAV|A Chain A, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|B Chain B, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|C Chain C, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|D Chain D, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|E Chain E, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|F Chain F, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|G Chain G, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
 pdb|1EAV|H Chain H, Crystal Structures Of Human Gephyrin And Plant Cnx1 
G Domains - Comparative Analysis And Functional Implications
Length=162

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV+AGAGPDRSGPRAVSVV+SSSE+LGGA+VV TAVVPD++++I+DIL + 
Sbjct  7    KVAILTVSDTVSAGAGPDRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVERIKDILQKW  66

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D  DL+LTLGGTG +PRDVTPEATK ++++ETPGLL V  QESLKITPFA LSR AA
Sbjct  67   SDVDEXDLILTLGGTGFTPRDVTPEATKKVIERETPGLLFVXXQESLKITPFAXLSRSAA  126

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQI  272
            GIRGSTLIIN PGNPNAVAEC E LLPALKHALKQI
Sbjct  127  GIRGSTLIINXPGNPNAVAECXEALLPALKHALKQI  162



>ref|XP_002973522.1| hypothetical protein SELMODRAFT_149120 [Selaginella moellendorffii]
 gb|EFJ25182.1| hypothetical protein SELMODRAFT_149120 [Selaginella moellendorffii]
Length=641

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 158/201 (79%), Gaps = 4/201 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++G GPDRSGPRAV V++S S+ LGGA+VV TA+VPD I +I+ +L   
Sbjct  442  KVAILTVSDTVSSGNGPDRSGPRAVQVIDSLSKSLGGAKVVATAIVPDSIPRIQQVLEDW  501

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D   +DL+LT GGTGC+P+DVTPEAT+ +LQKE PGL  VM+ ESLK+TP AMLSR  A
Sbjct  502  SDNQRIDLILTTGGTGCTPKDVTPEATRAVLQKEAPGLATVMLLESLKVTPTAMLSRGVA  561

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV---PAD  209
            GIRGSTLIINMPGNPNAVAECM+ LLPAL HAL+Q+RGDKREK+PRH PH       P D
Sbjct  562  GIRGSTLIINMPGNPNAVAECMQALLPALPHALRQVRGDKREKHPRHSPHHQDTALDPKD  621

Query  208  TWERSHKLASIGEEPTCSCSH  146
             W RS  +A+ G E  CSCSH
Sbjct  622  VWTRSF-VAAQGGEMGCSCSH  641



>ref|XP_002975554.1| hypothetical protein SELMODRAFT_150666 [Selaginella moellendorffii]
 gb|EFJ23183.1| hypothetical protein SELMODRAFT_150666 [Selaginella moellendorffii]
Length=641

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 158/201 (79%), Gaps = 4/201 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++G GPDRSGPRAV V++S S+ LGGA+VV TA+VPD I +I+ +L   
Sbjct  442  KVAILTVSDTVSSGNGPDRSGPRAVQVIDSLSKSLGGAKVVATAIVPDSIPRIQQVLEDW  501

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D   +DL+LT GGTGC+P+DVTPEAT+ +LQKE PGL  VM+ ESLK+TP AMLSR  A
Sbjct  502  SDNQRIDLILTTGGTGCTPKDVTPEATRAVLQKEAPGLATVMLLESLKVTPTAMLSRGVA  561

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHADAV---PAD  209
            GIRGSTLIINMPGNPNAVAECM+ LLPAL HAL+Q+RGDKREK+PRH PH       P D
Sbjct  562  GIRGSTLIINMPGNPNAVAECMQALLPALPHALRQVRGDKREKHPRHSPHHHDTALDPKD  621

Query  208  TWERSHKLASIGEEPTCSCSH  146
             W RS  +A+ G E  CSCSH
Sbjct  622  VWTRSF-VAAQGGEMGCSCSH  641



>gb|EMT03164.1| Molybdopterin biosynthesis protein CNX1 [Aegilops tauschii]
Length=696

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 162/232 (70%), Gaps = 38/232 (16%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++G GPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL++ 
Sbjct  465  KVAILTVSDTVSSGGGPDRSGPRAVSVVNSSSEKLGGAFVVATAVVPDEVDKIKEILVKW  524

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQES---LKITPFAMLSR  389
             DID ++L+LTLGGTG +PRDVTPEATK +++KE PGL  VM+QES   LK+    +L  
Sbjct  525  SDIDRVNLILTLGGTGFTPRDVTPEATKSVIEKEVPGLAFVMIQESLKCLKLDRIQILLF  584

Query  388  PAAGI------RGSTL---------------------------IINMPGNPNAVAECMEP  308
               G+       G T+                           IINMPGNPNAVAECME 
Sbjct  585  CTDGVCTFLFGTGDTICDAIPSGVWDKRIDTCFETLTRVLFFQIINMPGNPNAVAECMEA  644

Query  307  LLPALKHALKQIRGDKREKNPRHVPHADAVPADTWERSHKLASIGEEPTCSC  152
            LLPALKHA+KQ++GDKREKNPRH+PHA+A P D WERS + AS G    CSC
Sbjct  645  LLPALKHAMKQLKGDKREKNPRHIPHAEAAPVDQWERSFRAASSGG--GCSC  694



>ref|XP_010031621.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Eucalyptus grandis]
Length=610

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA+GAGPDRSGPRAV+VVNSSSERLGGARV  TAVVPD++ KI+DIL R 
Sbjct  471  RVAILTVSDTVASGAGPDRSGPRAVTVVNSSSERLGGARVAATAVVPDEVAKIKDILQRW  530

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D+D MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  531  ADVDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRAAA  590

Query  379  GIRGSTL  359
            GIRGS+L
Sbjct  591  GIRGSSL  597



>ref|XP_008385638.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1 [Malus domestica]
Length=484

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA+GAGPDRSGPRAVSVVNS SE LGGARVV+TAVV DD+ KI+D+L R 
Sbjct  333  RVAILTVSDTVASGAGPDRSGPRAVSVVNSCSETLGGARVVSTAVVADDVSKIKDVLHRW  392

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DI+ MDL+LTLGGTG +PRDVTPEATK L++KETPGLLHVMMQESLK+TP AMLSR AA
Sbjct  393  SDIEQMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLHVMMQESLKVTPTAMLSRSAA  452

Query  379  GIRGSTLI  356
            GIRGS+L+
Sbjct  453  GIRGSSLV  460



>gb|KEH28338.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=582

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVAAGAGPDRSGPRAVSV+NSSSERLGGA+VV T+VVPD++ KI+DIL R 
Sbjct  454  RVAILTVSDTVAAGAGPDRSGPRAVSVINSSSERLGGAKVVATSVVPDNVAKIQDILRRW  513

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D + MDL++TLGGTG + RDVTPEATK L++KETPGLL+VMMQESLK+TP AMLSR AA
Sbjct  514  SDNEQMDLIITLGGTGFTSRDVTPEATKELIEKETPGLLYVMMQESLKVTPSAMLSRSAA  573

Query  379  GIRGSTL  359
            GIRGSTL
Sbjct  574  GIRGSTL  580



>gb|EPS62424.1| hypothetical protein M569_12368, partial [Genlisea aurea]
Length=114

 Score =   188 bits (478),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            D+D +DL+LTLGGTG +PRDVTPEATK +++KETPGLLH+MM+ESLK+TPFA+LSR AAG
Sbjct  1    DVDKVDLILTLGGTGFAPRDVTPEATKEVIRKETPGLLHIMMRESLKVTPFAVLSRAAAG  60

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHVPHA  227
            IRG+TLI+NMPGNPNAVAEC+E L+P LKHAL+QI+GDKREK+PRHVPHA
Sbjct  61   IRGTTLIVNMPGNPNAVAECVEALVPCLKHALRQIKGDKREKHPRHVPHA  110



>ref|XP_009350884.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like, partial 
[Pyrus x bretschneideri]
Length=588

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSDTVA+GAGPDRSGPRAVSVVNS SERLGGARVV+TAVVPDD+ KI+D+L R 
Sbjct  470  RVAILTVSDTVASGAGPDRSGPRAVSVVNSCSERLGGARVVSTAVVPDDVSKIKDVLHRW  529

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             DI+ MDL+LTLGGTG +PRDVTPEATK L++KETPGLLHVMMQESLK+TP AMLSR A
Sbjct  530  SDIEQMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLHVMMQESLKVTPTAMLSRSA  588



>ref|XP_007015554.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 4, partial [Theobroma 
cacao]
 gb|EOY33173.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 4, partial [Theobroma 
cacao]
Length=607

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VA+LTVSDTVA+G GPDRSGPRAVSVVNSSSE+LGGA+VV  AVV DD+ KI+D+L R 
Sbjct  473  KVAVLTVSDTVASGVGPDRSGPRAVSVVNSSSEKLGGAKVVAAAVVSDDVGKIKDVLQRW  532

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DID MDL+LTLGGTG +PRDVTPEATK L++KETPGLL+VMMQESLK+TPFAMLSR AA
Sbjct  533  SDIDKMDLILTLGGTGFTPRDVTPEATKELIEKETPGLLYVMMQESLKVTPFAMLSRSAA  592

Query  379  GIRGSTLII  353
            GIRGSTL+I
Sbjct  593  GIRGSTLVI  601



>ref|XP_010240846.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nelumbo nucifera]
Length=587

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA+LTVSDTVA+GAGPDRSGPRAVSVVNSSSERLGGARVV TAVVPD++ KI+D+L + 
Sbjct  479  RVAVLTVSDTVASGAGPDRSGPRAVSVVNSSSERLGGARVVATAVVPDEVGKIKDVLQKW  538

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKI  413
             DID +DL+LTLGGTG +PRDVTPEATK +++KETPGLL VMMQESLK+
Sbjct  539  SDIDKIDLILTLGGTGFTPRDVTPEATKSVIEKETPGLLFVMMQESLKV  587



>ref|WP_036736197.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFD40901.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI34771.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI34987.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI37292.1| cytoplasmic protein [Peptococcaceae bacterium SCADC1_2_3]
Length=163

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            V ILT SD  + G   D+SG   + ++NS      G +VVT  VV DD  +I++ L   C
Sbjct  4    VGILTASDKASGGKRQDQSGMVIIEIINSL-----GWKVVTYLVVADDTDQIKNALFSMC  58

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            D   ++LVLT GGTG  PRD TPEATK ++++E PG+  +M  ES+K TP AMLSR  AG
Sbjct  59   DTQRLNLVLTSGGTGFGPRDNTPEATKAVIEREVPGIPEIMRWESMKKTPRAMLSRAVAG  118

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            IR  TLIIN+PG+P AV EC+E +LPAL H L+ + G   E
Sbjct  119  IRNQTLIINLPGSPKAVRECLEVILPALTHGLEILNGQTGE  159



>ref|WP_013258696.1| molybdenum cofactor synthesis domain-containing protein [Desulfarculus 
baarsii]
 gb|ADK85255.1| molybdenum cofactor synthesis domain protein [Desulfarculus baarsii 
DSM 2075]
Length=163

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 104/159 (65%), Gaps = 5/159 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            + AILTVSD  A G   D SGPR V ++  +     G +V+ TAVVPD++ KI   L   
Sbjct  4    KAAILTVSDGAAEGRREDVSGPRLVQMLEEA-----GVQVIETAVVPDEMDKISAQLRLY  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D   + LVLT GGTG S RDVTPEAT+ +L++  PGL   M  E LKITP A+LSR   
Sbjct  59   ADYLKVSLVLTTGGTGLSRRDVTPEATRRVLERTVPGLAEAMRAEGLKITPHAVLSRGVC  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  263
            GIRG+TLIIN+PG PNA  E ++ +LPAL H L ++RGD
Sbjct  119  GIRGATLIINLPGGPNAAVEGLKIILPALPHGLNKLRGD  157



>ref|WP_006980928.1| molybdenum cofactor synthesis domain protein [Chthoniobacter 
flavus]
 gb|EDY18945.1| molybdenum cofactor synthesis domain protein [Chthoniobacter 
flavus Ellin428]
Length=157

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VA +T+SD  +AG   DRSGP    ++N S    G        V+PD+  +I + L R 
Sbjct  2    KVARITLSDRASAGVYEDRSGPEIERILNES---FGSGIEWQRVVIPDERVQIEEALRRM  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD++H DLV+T GGTG +PRDVTPEAT+ +L++E PG   VM  +S    P A+LSR  A
Sbjct  59   CDVEHCDLVVTTGGTGPAPRDVTPEATRAVLEREMPGFGEVMRMQSFARVPTAILSRSTA  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  263
            G RG TLIIN+PGNP A+ EC+  L+PA++  ++ + G+
Sbjct  119  GTRGQTLIINLPGNPKAIGECLPMLIPAIRECIRHLHGE  157



>gb|ACD50083.1| molybdopterin biosynthesis enzyme [uncultured crenarchaeote MCG]
Length=169

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 104/159 (65%), Gaps = 5/159 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSD    G   D SGP   + + +      G RV  T +VPD+ ++IR  LL  
Sbjct  4    RVAILTVSDRSFLGERVDESGPALAACLAAE-----GWRVTGTQLVPDEQEQIRAALLAW  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
               +  D++LT GGTG +PRDVTPEAT+ L++K+ PGL  VM    L+I+P AMLSR  A
Sbjct  59   ITKNAADVILTTGGTGFAPRDVTPEATQSLIEKDAPGLAEVMRASGLRISPHAMLSRARA  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  263
            GIRG TLI+N+PG+P    E ++ +LPAL HA++ +RGD
Sbjct  119  GIRGRTLIVNLPGSPTGAVESLQAILPALGHAVQLLRGD  157



>emb|CAI78652.1| molybdopterin biosynthesis enzymes [uncultured delta proteobacterium]
Length=165

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 107/162 (66%), Gaps = 5/162 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            R  I+TVSD  + G   D SGP    ++ + S       +  T +VPD+ Q I+  ++  
Sbjct  4    RAGIITVSDRSSQGLRQDASGPALAKMLAAES-----IEICQTTIVPDEKQDIKKAIINL  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D +++DL+LT GGTG SPRDVTP+AT  +++K+ PG+  VM +ES +ITP AM+SR   
Sbjct  59   ADKENIDLILTTGGTGVSPRDVTPDATMEVIEKQIPGMAEVMRRESSRITPHAMISRAIT  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            GIRGS+LIIN+PG+P    E +  ++PALKHA+++I+GD  E
Sbjct  119  GIRGSSLIINLPGSPKGATENLAAIMPALKHAIEKIKGDTSE  160



>ref|WP_009711043.1| molybdopterin biosynthesis mog protein [Desmospora sp. 8437]
 gb|EGK09125.1| molybdopterin biosynthesis mog protein [Desmospora sp. 8437]
Length=170

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 5/159 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV I+T SD  A G   DRSG     ++           V    VVPD+  +I+++L+R 
Sbjct  3    RVGIVTASDKGARGEREDRSGEEIRRLLREPD-----FEVSAWEVVPDEQGRIKEVLIRM  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D + +DLVLT GGTG +PRDVTPEAT+ ++ +E PG+   M   SL+ TPF MLSR  A
Sbjct  58   ADTERLDLVLTTGGTGLAPRDVTPEATRDVIGREVPGIPEAMRLASLRKTPFGMLSRGVA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  263
            G+RG TLIIN+PG+P AV EC+E +LP L HAL+ + G+
Sbjct  118  GLRGKTLIINLPGSPKAVRECLEAVLPVLPHALETMTGE  156



>pdb|1IHC|A Chain A, X-Ray Structure Of Gephyrin N-Terminal Domain
Length=188

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>pdb|1JLJ|A Chain A, 1.6 Angstrom Crystal Structure Of The Human Neuroreceptor 
Anchoring And Molybdenum Cofactor Biosynthesis Protein 
Gephyrin
 pdb|1JLJ|B Chain B, 1.6 Angstrom Crystal Structure Of The Human Neuroreceptor 
Anchoring And Molybdenum Cofactor Biosynthesis Protein 
Gephyrin
 pdb|1JLJ|C Chain C, 1.6 Angstrom Crystal Structure Of The Human Neuroreceptor 
Anchoring And Molybdenum Cofactor Biosynthesis Protein 
Gephyrin
Length=189

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_037464714.1| cytoplasmic protein [Smithella sp. F21]
 gb|KFN38953.1| cytoplasmic protein [Smithella sp. F21]
Length=163

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 111/161 (69%), Gaps = 9/161 (6%)
 Frame = -3

Query  730  ILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGA--RVVTTAVVPDDIQKIRDILLRCC  557
            I+TVSD  + G   D SGP    V+   +E L GA  ++  T ++PD+I +I++ +++  
Sbjct  5    IITVSDKGSQGKREDLSGP----VI---AEMLAGAAIQIKQTLIIPDEIDRIKEAIIQFA  57

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            D++ +DL+LT GGTG SPRD+TP+AT  +L KE PG+   M   S+KITP AM+SR  AG
Sbjct  58   DVEKLDLILTTGGTGVSPRDLTPDATLKVLDKEVPGMAEAMRIASMKITPHAMISRAVAG  117

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            IRG +LIIN+PG+P    E +  +LPAL+HA+++++GD R+
Sbjct  118  IRGRSLIINLPGSPKGAKENLSAVLPALQHAIEKMKGDDRD  158



>ref|WP_027356596.1| cytoplasmic protein [Desulfotomaculum thermocisternum]
Length=163

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV ILT SD  + G   DRS      V+      +GG  VV+  +VPDD+  +++ L++ 
Sbjct  3    RVGILTASDKGSRGEREDRS----AGVIREMVAGIGG-EVVSYYIVPDDLDVLKETLIKM  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D + +DL+LT GGTG +PRD TPEAT+ ++Q+E PG+  VM  ESLK TP AMLSR AA
Sbjct  58   VDQEKLDLILTTGGTGFAPRDNTPEATRAVIQREVPGIPEVMRLESLKKTPRAMLSRAAA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            GIR  TLIIN+PG+  AV EC+E +LPAL H L+ + G
Sbjct  118  GIRHQTLIINLPGSARAVRECLEVILPALSHGLEILTG  155



>gb|EMS55337.1| Molybdopterin biosynthesis protein CNX1 [Triticum urartu]
Length=661

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VAILTVSDTV++GAGPDRSGPRAVSVVNSSSE+LGGA VV TAVVPD++ KI++IL++ 
Sbjct  378  KVAILTVSDTVSSGAGPDRSGPRAVSVVNSSSEKLGGAVVVATAVVPDEVDKIKEILVKW  437

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKI  413
             DID ++L+LTLGGTG +PRDVTPEATK ++QKE PGL  VM+QESLK+
Sbjct  438  SDIDRVNLILTLGGTGFTPRDVTPEATKSVIQKEAPGLAFVMIQESLKL  486



>gb|AFM26240.1| molybdopterin adenylyltransferase [Desulfomonile tiedjei DSM 
6799]
Length=171

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            R  ILTVSD  + G   D SGP    ++ S      G +   TAVVPD+ + I+++L+  
Sbjct  11   RAGILTVSDRSSQGLREDTSGPELEQILRSR-----GFQTEWTAVVPDEEKSIQEMLVTW  65

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D    DL+LT GGTG SPRDVTPEAT  +  +  PG+   M  ESLK TP AM+SR  A
Sbjct  66   ADQYQADLILTTGGTGLSPRDVTPEATSAICHRLVPGMAEAMRAESLKKTPHAMISRAVA  125

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            G+RG TLIIN+PG+P    E +E +LPAL+HA+ +++GD  E
Sbjct  126  GVRGRTLIINLPGSPRGARENLEVVLPALEHAISKLQGDPSE  167



>ref|WP_041287293.1| cytoplasmic protein [Desulfomonile tiedjei]
Length=162

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            R  ILTVSD  + G   D SGP    ++ S      G +   TAVVPD+ + I+++L+  
Sbjct  2    RAGILTVSDRSSQGLREDTSGPELEQILRSR-----GFQTEWTAVVPDEEKSIQEMLVTW  56

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D    DL+LT GGTG SPRDVTPEAT  +  +  PG+   M  ESLK TP AM+SR  A
Sbjct  57   ADQYQADLILTTGGTGLSPRDVTPEATSAICHRLVPGMAEAMRAESLKKTPHAMISRAVA  116

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            G+RG TLIIN+PG+P    E +E +LPAL+HA+ +++GD  E
Sbjct  117  GVRGRTLIINLPGSPRGARENLEVVLPALEHAISKLQGDPSE  158



>ref|WP_013626116.1| molybdopterin adenylyltransferase [Syntrophobotulus glycolicus]
 gb|ADY57344.1| molybdopterin adenylyltransferase [Syntrophobotulus glycolicus 
DSM 8271]
Length=166

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 108/159 (68%), Gaps = 5/159 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV ILTVSD  A+G   D+SGP    ++ +      G      +++PD+ +KI   L+  
Sbjct  3    RVGILTVSDRGASGEREDQSGPLIKEIMQNR-----GWETAACSIIPDERKKIAQKLIEY  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D  ++D+V T GGTG +PRDVTPEAT  ++++  PGL+  ++ ESLKITP AMLSR  +
Sbjct  58   ADDLNIDVVFTTGGTGFAPRDVTPEATLDVVERLAPGLVQAILFESLKITPRAMLSRAVS  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  263
            GIRG T+I+N+PG+P AV EC++ +LPAL+H ++ +RG+
Sbjct  118  GIRGGTIIVNLPGSPKAVRECLDVVLPALEHGVQILRGE  156



>ref|WP_027636642.1| cytoplasmic protein [Clostridium butyricum]
Length=163

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA++T SD+   G   D+SGP    +V        G  VV T ++PD+ + + + ++R 
Sbjct  3    RVAVITSSDSGYEGKREDKSGPEIERIVKEY-----GYEVVHTIILPDERKILANEMMRI  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D  DL+LT GGTG SPRD TPEATK ++++E PG+   M   SL+IT  AMLSR AA
Sbjct  58   ADNDIADLILTTGGTGFSPRDWTPEATKDIVEREVPGIPESMRAYSLQITKRAMLSRAAA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            GIR  TLIINMPG+P AV EC++ ++  L H LK ++G
Sbjct  118  GIRKETLIINMPGSPKAVDECLQYIISELDHGLKILKG  155



>ref|WP_013707323.1| molybdenum cofactor synthesis domain-containing protein [Desulfobacca 
acetoxidans]
 gb|AEB10214.1| molybdenum cofactor synthesis domain protein [Desulfobacca acetoxidans 
DSM 11109]
Length=163

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV ILT SD  A G   D S   A  ++  +       RV   A+VPD  + I D+L+  
Sbjct  3    RVGILTCSDKGARGEREDLSAQEARKLLPVNV-----FRVENYAIVPDTREAITDLLVAW  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD D +DL+LT GGTG SPRDVTPEAT+ ++++E PG+   M   SL  TP AMLSR  A
Sbjct  58   CDQDRLDLILTTGGTGLSPRDVTPEATRGVIEREVPGMAEAMRAASLLKTPHAMLSRGVA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            GIRG TLI+N+PG+P  V E +E +LPAL HAL++I+G   E
Sbjct  118  GIRGQTLIVNLPGSPKGVRENLEVVLPALPHALEKIKGSPAE  159



>ref|WP_033119864.1| cytoplasmic protein [Oscillibacter sp. ER4]
Length=159

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 104/158 (66%), Gaps = 5/158 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            + A++TVSD  +AG   D+SGP   +++  +     G  VV T++VPD+ +KI + L+ C
Sbjct  4    QAAVITVSDRASAGVYEDKSGPAVAAMLKEA-----GYEVVYTSIVPDEQEKISEELISC  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D  H  LV+T GGTG SPRDVTPEAT+ +L++E P +   M+  SL+ITP AMLSR  A
Sbjct  59   VDEKHCGLVITSGGTGLSPRDVTPEATRAVLEREIPAIPQAMIYYSLQITPRAMLSRAVA  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            G R ++LI+N+PG+  A  E +  +L AL HALK I G
Sbjct  119  GTRRNSLILNLPGSEKAARENLSAVLGALDHALKMIAG  156



>gb|ABC77449.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB]
Length=175

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = -3

Query  733  AILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCCD  554
             ++TVSD  + G   D SG   V ++   S       +  TA++PD+  +IR  L+   D
Sbjct  17   GVVTVSDKGSRGEREDLSGKEVVRMLEELS-----ILISETAIIPDEKDQIRQTLIDLAD  71

Query  553  IDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAGI  374
               +DL++T GGTG +PRDVTP+AT  ++++  PG+   M QESLK TP AM+SR  AGI
Sbjct  72   NKKLDLIVTTGGTGVTPRDVTPDATLEVIERVLPGMAEAMRQESLKKTPHAMISRAVAGI  131

Query  373  RGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            RG TLIIN+PG+P  V E +  +LPALKHAL++IRGD+ E
Sbjct  132  RGQTLIINLPGSPRGVRENLAVILPALKHALEKIRGDETE  171



>ref|WP_041584862.1| cytoplasmic protein [Syntrophus aciditrophicus]
Length=164

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = -3

Query  733  AILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCCD  554
             ++TVSD  + G   D SG   V ++   S       +  TA++PD+  +IR  L+   D
Sbjct  6    GVVTVSDKGSRGEREDLSGKEVVRMLEELS-----ILISETAIIPDEKDQIRQTLIDLAD  60

Query  553  IDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAGI  374
               +DL++T GGTG +PRDVTP+AT  ++++  PG+   M QESLK TP AM+SR  AGI
Sbjct  61   NKKLDLIVTTGGTGVTPRDVTPDATLEVIERVLPGMAEAMRQESLKKTPHAMISRAVAGI  120

Query  373  RGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            RG TLIIN+PG+P  V E +  +LPALKHAL++IRGD+ E
Sbjct  121  RGQTLIINLPGSPRGVRENLAVILPALKHALEKIRGDETE  160



>ref|XP_008863022.1| hypothetical protein, variant 3 [Aphanomyces invadans]
 gb|ETW09211.1| hypothetical protein, variant 3 [Aphanomyces invadans]
Length=629

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 109/159 (69%), Gaps = 6/159 (4%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG--ARVVTTAVVPDDIQKIRDILL  566
            R  +LTVSD+V+ G   DRSGP    V+ ++   + G    +V  AVV D++ +I++++ 
Sbjct  461  RACVLTVSDSVSRGDSTDRSGP----VMQTTLTEMPGLAVEIVQAAVVADEVDEIQNVVR  516

Query  565  RCCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  386
              CD+ H+DL++T GGTG SPRDVTPEA K LL ++ PGL+H M+Q SL +TP A+L+RP
Sbjct  517  TWCDVAHVDLIVTSGGTGFSPRDVTPEAVKVLLDRDAPGLVHKMLQASLDVTPMAILARP  576

Query  385  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             AG+RG TL++ +PG PNAV E +  L P L HAL  ++
Sbjct  577  VAGMRGHTLVLTLPGKPNAVVETLTALAPVLPHALHLLQ  615



>gb|KIE17875.1| cytoplasmic protein [Smithella sp. SC_K08D17]
Length=163

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 106/161 (66%), Gaps = 9/161 (6%)
 Frame = -3

Query  730  ILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGA--RVVTTAVVPDDIQKIRDILLRCC  557
            I+TVSD  + G   D SGP       + +E L G    +  T ++PD+  +I++ L+   
Sbjct  6    IITVSDKGSQGKREDLSGP-------AIAEMLAGIAIEIKQTIIIPDEKDQIQEALINFA  58

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            D+  +DL+LT GGTG SPRD+TP+AT  ++ KE PG+   M Q+SL ITP AM+SR  AG
Sbjct  59   DVQKLDLILTTGGTGVSPRDLTPDATLAVIDKEVPGMAEAMRQKSLLITPHAMISRAVAG  118

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            IRG  LIIN+PG+P +V E +  +LPALKHA+++I+GD  E
Sbjct  119  IRGRCLIINLPGSPRSVKENLAVILPALKHAIEKIKGDDSE  159



>ref|WP_014355808.1| molybdenum cofactor biosynthesis protein MoaB [Acetobacterium 
woodii]
 gb|AFA48205.1| molybdenum cofactor biosynthesis protein MoaB [Acetobacterium 
woodii DSM 1030]
Length=167

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            R  I+T+SD  + G   D+SGP   +++++++      +VV T ++PDD++ I+  L+  
Sbjct  3    RTGIMTLSDKGSKGQREDKSGPMIQTMLSTTNLY----QVVKTIILPDDLETIKKNLITW  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D DH+DL+LT GGTG S RD TPEAT  + ++ TPG+   M   SL+ITP AMLSR AA
Sbjct  59   VDDDHLDLILTTGGTGFSQRDWTPEATIAVCERMTPGIPEAMRYHSLQITPKAMLSRSAA  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQI  272
            GIR  TLIIN+PG+P AV E +E +LPAL H L+ +
Sbjct  119  GIRKQTLIINLPGSPKAVKENLEAILPALDHGLEML  154



>ref|XP_008863020.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 gb|ETW09209.1| hypothetical protein, variant 1 [Aphanomyces invadans]
Length=669

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 109/159 (69%), Gaps = 6/159 (4%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG--ARVVTTAVVPDDIQKIRDILL  566
            R  +LTVSD+V+ G   DRSGP    V+ ++   + G    +V  AVV D++ +I++++ 
Sbjct  501  RACVLTVSDSVSRGDSTDRSGP----VMQTTLTEMPGLAVEIVQAAVVADEVDEIQNVVR  556

Query  565  RCCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  386
              CD+ H+DL++T GGTG SPRDVTPEA K LL ++ PGL+H M+Q SL +TP A+L+RP
Sbjct  557  TWCDVAHVDLIVTSGGTGFSPRDVTPEAVKVLLDRDAPGLVHKMLQASLDVTPMAILARP  616

Query  385  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             AG+RG TL++ +PG PNAV E +  L P L HAL  ++
Sbjct  617  VAGMRGHTLVLTLPGKPNAVVETLTALAPVLPHALHLLQ  655



>ref|WP_037380935.1| MULTISPECIES: cytoplasmic protein [Smithella]
 gb|KFZ44231.1| cytoplasmic protein [Smithella sp. D17]
Length=162

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 106/161 (66%), Gaps = 9/161 (6%)
 Frame = -3

Query  730  ILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGA--RVVTTAVVPDDIQKIRDILLRCC  557
            I+TVSD  + G   D SGP       + +E L G    +  T ++PD+  +I++ L+   
Sbjct  5    IITVSDKGSQGKREDLSGP-------AIAEMLAGIAIEIKQTIIIPDEKDQIQEALINFA  57

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            D+  +DL+LT GGTG SPRD+TP+AT  ++ KE PG+   M Q+SL ITP AM+SR  AG
Sbjct  58   DVQKLDLILTTGGTGVSPRDLTPDATLAVIDKEVPGMAEAMRQKSLLITPHAMISRAVAG  117

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            IRG  LIIN+PG+P +V E +  +LPALKHA+++I+GD  E
Sbjct  118  IRGRCLIINLPGSPRSVKENLAVILPALKHAIEKIKGDDSE  158



>ref|WP_037388918.1| cytoplasmic protein [Smithella sp. SCADC]
 gb|KFO66623.1| cytoplasmic protein [Smithella sp. SCADC]
Length=163

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 106/161 (66%), Gaps = 9/161 (6%)
 Frame = -3

Query  730  ILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGA--RVVTTAVVPDDIQKIRDILLRCC  557
            I+TVSD  + G   D SGP       + +E L G    +  T ++PD+  +I++ ++   
Sbjct  6    IITVSDKGSQGKREDLSGP-------AIAEMLAGIAIEIKQTIIIPDEKDQIQEAIINFA  58

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            D+  +DL+LT GGTG SPRD+TP+AT  ++ KE PG+   M Q+SL ITP AM+SR  AG
Sbjct  59   DVQKLDLILTTGGTGVSPRDLTPDATLAVIDKEVPGMAEAMRQKSLLITPHAMISRAVAG  118

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            IRG  LIIN+PG+P +V E +  +LPALKHA+++I+GD  E
Sbjct  119  IRGRCLIINLPGSPKSVKENLAVILPALKHAIEKIKGDDSE  159



>ref|WP_013823924.1| molybdenum cofactor synthesis domain-containing protein [Desulfotomaculum 
kuznetsovii]
 gb|AEG16413.1| molybdenum cofactor synthesis domain protein [Desulfotomaculum 
kuznetsovii DSM 6115]
Length=163

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 104/158 (66%), Gaps = 5/158 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV ILT SD  + G   D+S      V+      +GG  VV+  +VPDD+  +++ L++ 
Sbjct  3    RVGILTASDKGSRGEREDKS----AQVIRDMVAGIGG-EVVSYRIVPDDLDVLKEALIKM  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D + +DL+LT GGTG +PRD TPEAT+ ++Q+E PG+  VM  ESLK TP AMLSR  A
Sbjct  58   VDQEKLDLILTTGGTGFAPRDNTPEATRAVIQREVPGIPEVMRYESLKKTPRAMLSRAVA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            GIR  TLIIN+PG+  AV EC+E +LPAL H L+ + G
Sbjct  118  GIRHQTLIINLPGSARAVRECLEVILPALAHGLEILTG  155



>ref|WP_003425841.1| molybdenum cofactor synthesis protein [Clostridium butyricum]
 gb|EMU55261.1| molybdenum cofactor synthesis protein [Clostridium butyricum 
DKU-01]
 gb|ETI90293.1| Molybdopterin biosynthesis mog protein [Clostridium butyricum 
DORA_1]
Length=163

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 5/158 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA++T SD+   G   D+SGP    +V        G  VV T ++PD+ + + D ++R 
Sbjct  3    RVAVITSSDSGYEGKREDKSGPEIERIVKEY-----GYEVVHTIILPDERKILADEMMRI  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D +  DL+LT GGTG S RD TPEATK ++++E PG+   M   SL+IT  AMLSR AA
Sbjct  58   ADNNIADLILTTGGTGFSKRDWTPEATKDIVEREVPGIPEAMRSYSLQITKRAMLSRAAA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            GIR  TLIINMPG+P AV EC++ ++  L H LK ++G
Sbjct  118  GIRKETLIINMPGSPKAVDECLQYIISELDHGLKILKG  155



>ref|XP_008314898.1| PREDICTED: gephyrin-like isoform X3 [Cynoglossus semilaevis]
Length=750

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPDDI++I++ LL 
Sbjct  15   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDDIEEIKETLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG SPRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDEQELNLILTTGGTGFSPRDVTPEATRDVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_002580709.1| molybdenum cofactor biosynthesis protein B [Clostridium butyricum]
 gb|EDT73333.1| molybdopterin biosynthesis mog protein [Clostridium butyricum 
5521]
 gb|EEP53750.1| molybdenum cofactor synthesis protein [Clostridium butyricum 
E4 str. BoNT E BL5262]
 gb|ENZ33712.1| molybdenum cofactor synthesis domain-containing protein [Clostridium 
butyricum 60E.3]
 gb|KIU08533.1| molybdopterin biosynthesis mog protein [Clostridium butyricum]
Length=163

 Score =   141 bits (356),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 5/158 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVA++T SD+   G   D+SGP    +V        G  VV T ++PD+ + + D ++R 
Sbjct  3    RVAVITSSDSGYEGKREDKSGPEIERIVKEY-----GYEVVHTIILPDERKILADEMMRI  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D +  DL+LT GGTG S RD TPEATK ++++E PG+   M   SL+IT  AMLSR AA
Sbjct  58   ADNNIADLILTTGGTGFSKRDWTPEATKDIVEREVPGIPEAMRAYSLQITKRAMLSRAAA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            GIR  TLIINMPG+P AV EC++ ++  L H LK ++G
Sbjct  118  GIRKETLIINMPGSPKAVDECLQYIISELDHGLKILKG  155



>ref|XP_004881940.1| PREDICTED: gephyrin-like [Heterocephalus glaber]
Length=381

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008314890.1| PREDICTED: gephyrin-like isoform X2 [Cynoglossus semilaevis]
Length=784

 Score =   150 bits (380),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPDDI++I++ LL 
Sbjct  15   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDDIEEIKETLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG SPRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDEQELNLILTTGGTGFSPRDVTPEATRDVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>gb|EAW80925.1| gephyrin, isoform CRA_c [Homo sapiens]
Length=398

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_041082573.1| cytoplasmic protein [Thermotoga profunda]
Length=168

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 106/158 (67%), Gaps = 6/158 (4%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            R A++T+SD   AG   D+SG + + ++ + +     A V    ++PD+ + IR+ L+  
Sbjct  3    RAAVITLSDKGFAGQREDQSGKKVIEILQNIN-----AVVEHYEILPDEFETIRNKLIDL  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            C+  + DL++T GGTG SPRDVTP+AT  +++K   G+   MM ESLK TPF MLSR  A
Sbjct  58   CE-RNFDLIITTGGTGVSPRDVTPDATLSVVEKRLYGIEMAMMNESLKYTPFGMLSRAVA  116

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            G++G TLIIN+PG+P AV E +  +LPA+ HA+++I+G
Sbjct  117  GVKGRTLIINLPGSPKAVQENLNVILPAIPHAIEKIKG  154



>ref|WP_039740847.1| cytoplasmic protein [Geobacter pickeringii]
 gb|AJE02727.1| cytoplasmic protein [Geobacter pickeringii]
Length=168

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 5/165 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            + AILT+SD  + G   D SGP  VS +   +ER  GA  V TA++PD+   I + L   
Sbjct  2    KTAILTLSDKGSRGERTDASGPALVSWL---AER--GAETVRTAIIPDEAALIEETLRNW  56

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D    DL+LT GGTG SPRDVTP+AT  +L +  PG   VM   SL+ TP AM+SR  A
Sbjct  57   ADSGEFDLILTTGGTGVSPRDVTPDATVKILDRLIPGFGEVMRMRSLQKTPHAMISRAVA  116

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNP  245
            GIR +TLIIN+PG+P    E +E + PA+ HA+++I+GD R+  P
Sbjct  117  GIRKATLIINLPGSPRGAVENLEAVWPAVPHAVEKIQGDTRDCAP  161



>ref|WP_034122161.1| cytoplasmic protein [Peptococcaceae bacterium BICA1-7]
Length=164

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV ILT SD  AAG   D S      +++       G +VV  ++VPDD + I++ L+  
Sbjct  3    RVGILTASDKGAAGEREDLSAEAIRGIISRQ-----GWQVVIYSIVPDDTEAIKEALVGM  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D +DL+LT GGTG SPRD TPEAT+ ++QKE PG+  VM  ES K T  AMLSR AA
Sbjct  58   ADRDGVDLILTTGGTGFSPRDNTPEATRAVIQKEVPGIPEVMRAESFKKTHRAMLSRAAA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            GIR  TLIIN+PG+  AV EC+E ++ +L H L  + G   E
Sbjct  118  GIRHKTLIINLPGSRKAVVECLEAIMESLPHGLDILTGRSGE  159



>ref|WP_014117170.1| molybdenum cofactor biosynthesis protein [Oscillibacter valericigenes]
 dbj|BAK98486.1| molybdenum cofactor biosynthesis protein [Oscillibacter valericigenes 
Sjm18-20]
Length=166

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 100/158 (63%), Gaps = 5/158 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            + A+LTVSD    G  PD  GP   +++  +     G  ++ TA+VPD+ ++I  +L   
Sbjct  4    KAAVLTVSDRSFRGQRPDEGGPLVSALLQGA-----GYEILRTAMVPDEQEEIARVLREW  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D   + LVLT GGTG SPRDVTPEAT  + Q+ TPG+   M   SL ITP AMLSR AA
Sbjct  59   ADAGDVQLVLTTGGTGFSPRDVTPEATLAVCQRLTPGIPEAMRAASLSITPRAMLSRAAA  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            GIRG TLI+N+PG+P A  E +E +LPAL H L+ + G
Sbjct  119  GIRGGTLIVNLPGSPRAAKENLEAVLPALGHGLQMLSG  156



>ref|XP_006800724.1| PREDICTED: gephyrin-like [Neolamprologus brichardi]
Length=651

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  51   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLLE  108

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  109  WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  168

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADAV  218
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    +
Sbjct  169  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSPL  228

Query  217  PADTWERSH  191
             A+T+  +H
Sbjct  229  QANTYANTH  237



>ref|WP_040663553.1| cytoplasmic protein [Oscillibacter ruminantium]
Length=166

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 100/159 (63%), Gaps = 5/159 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            + A+LTVSD  + G  PD  GP   +++  +     G  V+ TA+VPD+  +I   L   
Sbjct  4    KAAVLTVSDRSSRGERPDEGGPLISALLQDA-----GYEVLRTAIVPDEQAEIARFLREW  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             DI  + L+LT GGTG +PRDVTPEAT  + Q+ TPG+   M   SL ITP AMLSR AA
Sbjct  59   ADIGEVQLILTTGGTGFAPRDVTPEATCSVCQRMTPGIPEAMRAASLAITPRAMLSRAAA  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  263
            GIRG TLI+N+PG+P A  E +E +LP L H L+ + G+
Sbjct  119  GIRGGTLIVNLPGSPKAAKENLEAVLPTLGHGLQMLSGE  157



>ref|XP_005461956.1| PREDICTED: gephyrin-like isoform X4 [Oreochromis niloticus]
Length=784

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  51   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLLE  108

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  109  WCDEQELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPV  168

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADAV  218
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    +
Sbjct  169  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSPL  228

Query  217  PADTWERSH  191
             A+T+  +H
Sbjct  229  QANTYANTH  237



>ref|XP_005812094.1| PREDICTED: gephyrin-like [Xiphophorus maculatus]
Length=736

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I++I++ LL 
Sbjct  15   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIEEIKETLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005090818.1| PREDICTED: uncharacterized protein LOC101848404 isoform X1 [Aplysia 
californica]
Length=1637

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 107/160 (67%), Gaps = 2/160 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +V ILTVSD+   G   DRSG     VV S   +L   RV+T  ++PD+ ++I++ LL  
Sbjct  11   KVGILTVSDSCFNGTATDRSGENLKQVVES--RKLFNGRVITKDILPDEQEQIKNKLLHW  68

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D   +DL+LT GGTG +PRDVTPEATK +++KE PG++  M++ SL+ITP AMLSRP  
Sbjct  69   SDHLKLDLILTTGGTGFAPRDVTPEATKSVIEKEAPGMIVAMLKGSLEITPLAMLSRPVC  128

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDK  260
            G RG TLIIN+PG+    +EC++ +   + HA+  +RG K
Sbjct  129  GTRGCTLIINLPGSTKGSSECLQLVSAGIPHAVDLLRGHK  168



>ref|XP_007575455.1| PREDICTED: gephyrin-like isoform X2 [Poecilia formosa]
Length=736

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I++I++ LL 
Sbjct  15   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIEEIKETLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005461953.1| PREDICTED: gephyrin-like isoform X1 [Oreochromis niloticus]
 ref|XP_005461954.1| PREDICTED: gephyrin-like isoform X2 [Oreochromis niloticus]
Length=818

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  51   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLLE  108

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  109  WCDEQELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPV  168

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADAV  218
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    +
Sbjct  169  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSPL  228

Query  217  PADTWERSH  191
             A+T+  +H
Sbjct  229  QANTYANTH  237



>ref|XP_003962333.1| PREDICTED: gephyrin-like isoform 1 [Takifugu rubripes]
Length=744

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ LL 
Sbjct  15   TRVGILTVSDSCFRNLAEDRSGVNLKDLVHDPS--LLGGVIVAYKIVPDEIDEIKETLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDDLELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>tpg|DAA35544.1| TPA: hypothetical protein ZEAMMB73_028448 [Zea mays]
Length=346

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  415  ITPFAMLSRPAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRHV  236
            ITPFAMLSR  AGIRGSTLIINMPGNPNAVAEC+E LLPALKHALKQI+GDKREK+PRH 
Sbjct  239  ITPFAMLSRATAGIRGSTLIINMPGNPNAVAECLEALLPALKHALKQIKGDKREKHPRHT  298

Query  235  PHADAVPADTWERSHKLASIG  173
            PHA   P D WERS + ASIG
Sbjct  299  PHAAVAPVDQWERSFRAASIG  319



>ref|XP_004356987.1| Gephyrin, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR24968.1| Gephyrin, putative [Acanthamoeba castellanii str. Neff]
Length=181

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 110/165 (67%), Gaps = 3/165 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
             V +LTVSD V+ G   D SGP A+S++    + L  A+VV TAVV D++  I+ +L   
Sbjct  11   EVGVLTVSDRVSRGEAEDLSGPLAISIIE---QHLKHAKVVATAVVADEVDDIQRVLKEW  67

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D   + L+LT GGTG +PRD+TPEATK +L +E PG++  M+  SL++TP AMLSRPAA
Sbjct  68   SDGRKLQLILTTGGTGFAPRDITPEATKAILDREAPGMVVAMVSASLQVTPHAMLSRPAA  127

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNP  245
            G+R  TLI+N+PG+  AV E ++ LLP L HA+  +R D R   P
Sbjct  128  GMRKQTLIVNLPGSSKAVKENIDVLLPVLPHAIGLLRQDPRAAQP  172



>ref|XP_003707233.1| PREDICTED: LOW QUALITY PROTEIN: gephyrin-like [Megachile rotundata]
Length=633

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 104/166 (63%), Gaps = 4/166 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG---ARVVTTAVVPDDIQKIRDIL  569
            R  +LTVSD+       D+SGP     ++++   +G     +V    +VPDD   I++ L
Sbjct  5    RFGLLTVSDSCYKYKKEDKSGPEVELCISNNGTEIGKILRGQVFHKDIVPDDEYAIKEKL  64

Query  568  LRCCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSR  389
            +   D   +D++ T+GGTG S RDVTPEATK ++QKE PGL+  M+  SLKITP AMLSR
Sbjct  65   ISWSDSRQVDVIFTIGGTGFSKRDVTPEATKEIIQKEAPGLVIAMLTSSLKITPMAMLSR  124

Query  388  PAAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREK  251
             A GIR  TLIIN+PG+P A  EC+  + PA+ HA+  IR D  EK
Sbjct  125  AACGIRDKTLIINLPGSPKAAKECLSVIAPAISHAVDLIR-DNTEK  169



>ref|WP_026370918.1| cytoplasmic protein [bacterium JKG1]
Length=171

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 103/165 (62%), Gaps = 4/165 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RVAILTVSD  AAG   D SG    +++ +  +    A+V    VVPD+   I   L   
Sbjct  4    RVAILTVSDRSAAGQRADASGDVIRALITTRLD----AQVTAYRVVPDEQPAIVAALCEW  59

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D   +DL+LT GGTG +PRDVTPEAT+ ++++E PG+   M    L++TPFAMLSR  A
Sbjct  60   ADSGAIDLILTTGGTGLAPRDVTPEATRAVIEREVPGIPEAMRAAGLRVTPFAMLSRMVA  119

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNP  245
            G RG  LIIN+PG+P  V E +E LLPAL H L ++ GD R+  P
Sbjct  120  GTRGRCLIINLPGSPKGVRENLEVLLPALGHGLDKLLGDPRDCAP  164



>ref|XP_005751787.1| PREDICTED: gephyrin-like isoform X2 [Pundamilia nyererei]
Length=738

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  51   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLLE  108

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  109  WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  168

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADAV  218
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    +
Sbjct  169  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSPL  228

Query  217  PADTWERSH  191
             A+T+  +H
Sbjct  229  QANTYANTH  237



>ref|XP_007575454.1| PREDICTED: gephyrin-like isoform X1 [Poecilia formosa]
Length=766

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I++I++ LL 
Sbjct  15   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIEEIKETLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_009820958.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV88558.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=563

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 106/159 (67%), Gaps = 6/159 (4%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG--ARVVTTAVVPDDIQKIRDILL  566
            R  +LTVSD+V+ G   DRSGP    V+ S+   + G    +V  A+V D+  +I+ ++ 
Sbjct  395  RACVLTVSDSVSQGLAIDRSGP----VMQSTLLAIPGLDVEIVQAAIVADEHDEIQHVVR  450

Query  565  RCCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  386
              CD  H+D V+T GGTG SPRDVTPEA K LL ++ PGL+H M+Q SL++TP A+L+RP
Sbjct  451  SWCDDLHVDFVVTSGGTGFSPRDVTPEAVKTLLHRDAPGLVHKMLQASLEVTPMAILARP  510

Query  385  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             AGIRG TL++ +PG PNAV E +  + P L HAL  ++
Sbjct  511  VAGIRGHTLVVTLPGKPNAVVETLNAIAPVLPHALHLLQ  549



>ref|XP_001627768.1| predicted protein [Nematostella vectensis]
 gb|EDO35668.1| predicted protein [Nematostella vectensis]
Length=624

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 99/154 (64%), Gaps = 2/154 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD  + G   DRSGP    +V     RL   + V    VPDDI++I+ +LLR 
Sbjct  8    RVGVLTVSDRCSRGKAEDRSGPNLTRLV-LEEPRLS-IKEVAHECVPDDIEEIKKVLLRW  65

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D DH++L+LT GGTG SPRDVTPEAT  ++ +  PGL H MM+ESLK+TP AMLSRP  
Sbjct  66   SDEDHLNLILTTGGTGFSPRDVTPEATSQVIDRLAPGLAHRMMEESLKVTPLAMLSRPVC  125

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALK  278
            G R  TLIIN PG+     EC   +  AL HA++
Sbjct  126  GTRKRTLIINFPGSVKGSQECFHFISRALPHAIE  159



>ref|WP_031517960.1| cytoplasmic protein [Desulfotomaculum alkaliphilum]
Length=163

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +V ++T+SD  + G   D+SG     V+     ++GG  +    V+ DD++ I++ LL C
Sbjct  3    KVGVITLSDKGSRGEREDKSG----QVIKEMMAQIGG-ELAYYRVIADDLELIKEQLLYC  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++LVLT GGTG SPRD TP+AT  ++ KE PG+   M  ESL+ITP AMLSR  A
Sbjct  58   CDDLKLNLVLTTGGTGFSPRDNTPDATLAVIDKEAPGIAEAMRLESLRITPKAMLSRAVA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRG  266
            GIR STLIIN+PG+P  V EC+  +LPAL H L+ + G
Sbjct  118  GIRKSTLIINLPGSPKGVRECLAVVLPALPHGLEILSG  155



>ref|NP_001125964.1| gephyrin [Pongo abelii]
 emb|CAH91640.1| hypothetical protein [Pongo abelii]
Length=468

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGPQECFQFILPALPHAIDLLR  170



>ref|XP_003962334.1| PREDICTED: gephyrin-like isoform 2 [Takifugu rubripes]
Length=778

 Score =   148 bits (374),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ LL 
Sbjct  15   TRVGILTVSDSCFRNLAEDRSGVNLKDLVHDPS--LLGGVIVAYKIVPDEIDEIKETLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDDLELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007545562.1| PREDICTED: gephyrin isoform X6 [Poecilia formosa]
Length=686

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_015326915.1| molybdenum cofactor synthesis domain protein [Halobacteroides 
halobius]
 gb|AGB41193.1| molybdenum cofactor synthesis domain protein [Halobacteroides 
halobius DSM 5150]
Length=163

 Score =   138 bits (348),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +V ILT+SDT AAG   D+SG R   +++    ++GG  V    V+PDD + I   L + 
Sbjct  3    KVGILTLSDTGAAGKRKDKSGKRIEELIS----QIGG-EVTYYQVLPDDKETIVRELKKM  57

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D   ++L+LT GGTG +PRDVTPEAT  ++  E PG+   +  +SL  TP AMLSR  A
Sbjct  58   TDQSKLELILTTGGTGLAPRDVTPEATTEVIDTEVPGIAEAIRAKSLAKTPKAMLSRAVA  117

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            G+R  +LIIN+PG+P AV EC+E +LP L HA+K I+   +E
Sbjct  118  GVRNESLIINLPGSPKAVEECLEVVLPVLTHAVKLIKDQVKE  159



>ref|XP_005751786.1| PREDICTED: gephyrin-like isoform X1 [Pundamilia nyererei]
Length=784

 Score =   148 bits (373),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  51   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLLE  108

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  109  WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  168

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADAV  218
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    +
Sbjct  169  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSPL  228

Query  217  PADTWERSH  191
             A+T+  +H
Sbjct  229  QANTYANTH  237



>ref|XP_004569994.1| PREDICTED: gephyrin-like [Maylandia zebra]
Length=777

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  51   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLLE  108

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  109  WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  168

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADAV  218
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    +
Sbjct  169  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREAMVRVKSTHAALEQLPSPSPL  228

Query  217  PADTWERSH  191
             A+T+  +H
Sbjct  229  QANTYANTH  237



>ref|XP_005942199.1| PREDICTED: gephyrin-like isoform X2 [Haplochromis burtoni]
Length=785

 Score =   148 bits (373),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  51   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLLE  108

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  109  WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  168

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADAV  218
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    +
Sbjct  169  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSPL  228

Query  217  PADTWERSH  191
             A+T+  +H
Sbjct  229  QANTYANTH  237



>ref|XP_005942198.1| PREDICTED: gephyrin-like isoform X1 [Haplochromis burtoni]
Length=819

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  51   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKETLLE  108

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  109  WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  168

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKREKNPRH-----VPHADAV  218
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R         H     +P    +
Sbjct  169  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLREATVRVKSTHAALEQLPSPSPL  228

Query  217  PADTWERSH  191
             A+T+  +H
Sbjct  229  QANTYANTH  237



>ref|XP_009820957.1| hypothetical protein H257_00123 [Aphanomyces astaci]
 gb|ETV88557.1| hypothetical protein H257_00123 [Aphanomyces astaci]
Length=631

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 106/159 (67%), Gaps = 6/159 (4%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGG--ARVVTTAVVPDDIQKIRDILL  566
            R  +LTVSD+V+ G   DRSGP    V+ S+   + G    +V  A+V D+  +I+ ++ 
Sbjct  463  RACVLTVSDSVSQGLAIDRSGP----VMQSTLLAIPGLDVEIVQAAIVADEHDEIQHVVR  518

Query  565  RCCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRP  386
              CD  H+D V+T GGTG SPRDVTPEA K LL ++ PGL+H M+Q SL++TP A+L+RP
Sbjct  519  SWCDDLHVDFVVTSGGTGFSPRDVTPEAVKTLLHRDAPGLVHKMLQASLEVTPMAILARP  578

Query  385  AAGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             AGIRG TL++ +PG PNAV E +  + P L HAL  ++
Sbjct  579  VAGIRGHTLVVTLPGKPNAVVETLNAIAPVLPHALHLLQ  617



>ref|XP_010743433.1| PREDICTED: gephyrin-like isoform X2 [Larimichthys crocea]
Length=744

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I+D LL 
Sbjct  15   TRVGILTVSDSCFRNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKDTLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDELELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_021738416.1| molybdenum cofactor synthesis domain protein [Eubacterium ramulus]
 gb|ERK52516.1| molybdenum cofactor synthesis domain protein [Eubacterium ramulus 
ATCC 29099]
Length=161

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 102/161 (63%), Gaps = 6/161 (4%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            V I+T SD    G   DRSG R   ++ +      G  V    ++PDD Q ++D ++  C
Sbjct  3    VGIITASDKGYLGEREDRSGARIAEIMEAQ-----GYTVRKKVILPDDQQMLQDEMIAMC  57

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            + D + L+LT GGTG S RDVTPEATK ++++E PG+   ++Q SL IT  AMLSR AAG
Sbjct  58   N-DDIQLILTTGGTGFSKRDVTPEATKAVIEREVPGIPMAILQYSLTITERAMLSRAAAG  116

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            IRG TLI+N+PG+P AV E +  +LP+LKH L  + G+  E
Sbjct  117  IRGETLIVNLPGSPKAVDEALSYILPSLKHGLDILLGNDAE  157



>ref|XP_007545554.1| PREDICTED: gephyrin isoform X5 [Poecilia formosa]
Length=736

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006207020.1| PREDICTED: gephyrin isoform X5 [Vicugna pacos]
 ref|XP_010960583.1| PREDICTED: gephyrin isoform X8 [Camelus bactrianus]
 ref|XP_010974936.1| PREDICTED: gephyrin isoform X8 [Camelus dromedarius]
Length=736

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007545546.1| PREDICTED: gephyrin isoform X4 [Poecilia formosa]
Length=737

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007545531.1| PREDICTED: gephyrin isoform X2 [Poecilia formosa]
Length=781

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_022036283.1| hypothetical protein [Roseburia sp. CAG:50]
 emb|CCZ64771.1| putative uncharacterized protein [Roseburia sp. CAG:50]
Length=161

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 102/161 (63%), Gaps = 6/161 (4%)
 Frame = -3

Query  736  VAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCC  557
            V I+T SD    G   DRSG R   ++ +      G  V    ++PDD Q ++D ++  C
Sbjct  3    VGIITASDKGYLGEREDRSGARIAEIMEAQ-----GYTVRKKVILPDDQQMLQDEMIVMC  57

Query  556  DIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAG  377
            + D + L+LT GGTG S RDVTPEATK ++++E PG+   ++Q SL IT  AMLSR AAG
Sbjct  58   N-DDIQLILTTGGTGFSKRDVTPEATKAVIEREVPGIPMAILQYSLTITERAMLSRAAAG  116

Query  376  IRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGDKRE  254
            IRG TLI+N+PG+P AV E +  +LP+LKH L  + G+  E
Sbjct  117  IRGETLIVNLPGSPKAVDEALSYILPSLKHGLDILLGNDAE  157



>ref|XP_010743432.1| PREDICTED: gephyrin-like isoform X1 [Larimichthys crocea]
Length=778

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I+D LL 
Sbjct  15   TRVGILTVSDSCFRNLAEDRSGVNLKDLVHDPS--LLGGVIAAYKIVPDEIDEIKDTLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDELELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960581.1| PREDICTED: gephyrin isoform X6 [Camelus bactrianus]
 ref|XP_010974935.1| PREDICTED: gephyrin isoform X7 [Camelus dromedarius]
Length=755

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005072876.1| PREDICTED: gephyrin [Mesocricetus auratus]
Length=704

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960577.1| PREDICTED: gephyrin isoform X2 [Camelus bactrianus]
 ref|XP_010974931.1| PREDICTED: gephyrin isoform X3 [Camelus dromedarius]
Length=813

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960579.1| PREDICTED: gephyrin isoform X4 [Camelus bactrianus]
 ref|XP_010974933.1| PREDICTED: gephyrin isoform X5 [Camelus dromedarius]
Length=779

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960582.1| PREDICTED: gephyrin isoform X7 [Camelus bactrianus]
 ref|XP_010974929.1| PREDICTED: gephyrin isoform X1 [Camelus dromedarius]
Length=837

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007545524.1| PREDICTED: gephyrin isoform X1 [Poecilia formosa]
Length=794

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960578.1| PREDICTED: gephyrin isoform X3 [Camelus bactrianus]
 ref|XP_010974932.1| PREDICTED: gephyrin isoform X4 [Camelus dromedarius]
Length=794

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006207018.1| PREDICTED: gephyrin isoform X3 [Vicugna pacos]
Length=769

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_001026720.1| gephyrin [Gallus gallus]
 sp|Q9PW38.1|GEPH_CHICK RecName: Full=Gephyrin; Includes: RecName: Full=Molybdopterin 
adenylyltransferase; Short=MPT adenylyltransferase; AltName: 
Full=Domain G; Includes: RecName: Full=Molybdopterin molybdenumtransferase; 
Short=MPT Mo-transferase; AltName: Full=Domain 
E [Gallus gallus]
 gb|AAD49748.1|AF174130_1 gephyrin [Gallus gallus]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005803171.1| PREDICTED: gephyrin-like isoform X5 [Xiphophorus maculatus]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004624968.1| PREDICTED: gephyrin [Octodon degus]
Length=756

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005803170.1| PREDICTED: gephyrin-like isoform X4 [Xiphophorus maculatus]
Length=776

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008301210.1| PREDICTED: gephyrin-like [Stegastes partitus]
Length=779

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = -3

Query  742  SRVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLR  563
            +RV ILTVSD+       DRSG     +V+  S  L G  +    +VPD+I +I++ LL 
Sbjct  15   TRVGILTVSDSCFKNLAEDRSGVNLKDLVHDPS--LLGGVISAYKIVPDEIDEIKETLLE  72

Query  562  CCDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPA  383
             CD   ++L+LT GGTG +PRDVTPEAT+ ++++E PG+   M+  SL +TP  MLSRP 
Sbjct  73   WCDEQELNLILTTGGTGFAPRDVTPEATREVIEREAPGMALAMLMGSLNVTPLGMLSRPV  132

Query  382  AGIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
             GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  133  CGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960576.1| PREDICTED: gephyrin isoform X1 [Camelus bactrianus]
 ref|XP_010974930.1| PREDICTED: gephyrin isoform X2 [Camelus dromedarius]
Length=815

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005803169.1| PREDICTED: gephyrin-like isoform X3 [Xiphophorus maculatus]
Length=781

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_074056.2| gephyrin [Rattus norvegicus]
 ref|XP_006515970.1| PREDICTED: gephyrin isoform X9 [Mus musculus]
 emb|CAA47009.2| Gephyrin [Rattus norvegicus]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010960580.1| PREDICTED: gephyrin isoform X5 [Camelus bactrianus]
 ref|XP_010974934.1| PREDICTED: gephyrin isoform X6 [Camelus dromedarius]
Length=772

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395704.1| PREDICTED: gephyrin isoform X11 [Poecilia reticulata]
Length=803

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>emb|CAC81240.1| gephyrin [Homo sapiens]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_009004421.1| PREDICTED: gephyrin isoform X8 [Callithrix jacchus]
Length=779

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008137161.1| PREDICTED: gephyrin isoform X4 [Eptesicus fuscus]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395700.1| PREDICTED: gephyrin isoform X7 [Poecilia reticulata]
Length=848

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005149323.1| PREDICTED: gephyrin isoform X2 [Melopsittacus undulatus]
 ref|XP_005230782.1| PREDICTED: gephyrin isoform X2 [Falco peregrinus]
 ref|XP_005306755.1| PREDICTED: gephyrin isoform X9 [Chrysemys picta bellii]
 ref|XP_005520408.1| PREDICTED: gephyrin isoform X2 [Pseudopodoces humilis]
 ref|XP_005961618.1| PREDICTED: gephyrin isoform X3 [Pantholops hodgsonii]
 ref|XP_006266489.1| PREDICTED: gephyrin isoform X2 [Alligator mississippiensis]
 ref|XP_007940488.1| PREDICTED: gephyrin isoform X3 [Orycteropus afer afer]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006207017.1| PREDICTED: gephyrin isoform X2 [Vicugna pacos]
Length=772

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  V    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTVSAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006113471.1| PREDICTED: gephyrin isoform X2 [Pelodiscus sinensis]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006515967.1| PREDICTED: gephyrin isoform X6 [Mus musculus]
Length=790

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008171028.1| PREDICTED: gephyrin isoform X8 [Chrysemys picta bellii]
Length=755

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395699.1| PREDICTED: gephyrin isoform X6 [Poecilia reticulata]
Length=848

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_008395702.1| PREDICTED: gephyrin isoform X9 [Poecilia reticulata]
Length=834

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|NP_001019389.1| gephyrin isoform 2 [Homo sapiens]
 ref|NP_001244744.1| gephyrin [Macaca mulatta]
 ref|XP_001369878.1| PREDICTED: gephyrin isoform X3 [Monodelphis domestica]
 ref|XP_002754065.1| PREDICTED: gephyrin isoform X13 [Callithrix jacchus]
 ref|XP_001135627.2| PREDICTED: gephyrin isoform X21 [Pan troglodytes]
 ref|XP_003435080.1| PREDICTED: gephyrin isoformX2 [Canis lupus familiaris]
 ref|XP_003586639.1| PREDICTED: gephyrin isoform X10 [Bos taurus]
 ref|XP_003824107.1| PREDICTED: gephyrin isoform X8 [Pan paniscus]
 ref|XP_003924493.1| PREDICTED: gephyrin isoform X10 [Saimiri boliviensis boliviensis]
 ref|XP_004010776.1| PREDICTED: gephyrin isoform 2 [Ovis aries]
 ref|XP_004087211.1| PREDICTED: gephyrin isoform 2 [Nomascus leucogenys]
 ref|XP_004262187.1| PREDICTED: gephyrin isoform 2 [Orcinus orca]
 ref|XP_004371017.1| PREDICTED: gephyrin isoform 2 [Trichechus manatus latirostris]
 ref|XP_004397631.1| PREDICTED: gephyrin isoform 4 [Odobenus rosmarus divergens]
 ref|XP_004426313.1| PREDICTED: gephyrin isoform 2 [Ceratotherium simum simum]
 ref|XP_004584526.1| PREDICTED: gephyrin isoform X4 [Ochotona princeps]
 ref|XP_004612405.1| PREDICTED: gephyrin isoform X5 [Sorex araneus]
 ref|XP_004681829.1| PREDICTED: gephyrin isoform X5 [Condylura cristata]
 ref|XP_004739023.1| PREDICTED: gephyrin isoform X7 [Mustela putorius furo]
 ref|XP_004797269.1| PREDICTED: gephyrin isoform X6 [Mustela putorius furo]
 ref|XP_004837435.1| PREDICTED: gephyrin isoform X4 [Heterocephalus glaber]
 ref|XP_005343306.1| PREDICTED: gephyrin isoform X6 [Microtus ochrogaster]
 ref|XP_005399157.1| PREDICTED: gephyrin-like isoform X8 [Chinchilla lanigera]
 ref|XP_005561590.1| PREDICTED: gephyrin isoform X17 [Macaca fascicularis]
 ref|XP_005877968.1| PREDICTED: gephyrin isoform X4 [Myotis brandtii]
 ref|XP_006091049.1| PREDICTED: gephyrin isoform X9 [Myotis lucifugus]
 ref|XP_006973193.1| PREDICTED: gephyrin isoform X4 [Peromyscus maniculatus bairdii]
 ref|XP_007184378.1| PREDICTED: gephyrin isoform X10 [Balaenoptera acutorostrata scammoni]
 ref|XP_007525884.1| PREDICTED: gephyrin isoform X4 [Erinaceus europaeus]
 ref|XP_007985212.1| PREDICTED: gephyrin isoform X23 [Chlorocebus sabaeus]
 ref|XP_008850364.1| PREDICTED: gephyrin isoform X3 [Nannospalax galili]
 ref|XP_010643624.1| PREDICTED: gephyrin isoform X2 [Fukomys damarensis]
 ref|XP_011281585.1| PREDICTED: gephyrin isoform X6 [Felis catus]
 ref|XP_011382515.1| PREDICTED: gephyrin isoform X4 [Pteropus vampyrus]
 sp|Q9NQX3.1|GEPH_HUMAN RecName: Full=Gephyrin; Includes: RecName: Full=Molybdopterin 
adenylyltransferase; Short=MPT adenylyltransferase; AltName: 
Full=Domain G; Includes: RecName: Full=Molybdopterin molybdenumtransferase; 
Short=MPT Mo-transferase; AltName: Full=Domain 
E [Homo sapiens]
 gb|AAF81785.1|AF272663_1 gephyrin [Homo sapiens]
 dbj|BAG11318.1| gephyrin [synthetic construct]
Length=736

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395694.1| PREDICTED: gephyrin isoform X1 [Poecilia reticulata]
Length=867

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005803167.1| PREDICTED: gephyrin-like isoform X1 [Xiphophorus maculatus]
Length=795

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395695.1| PREDICTED: gephyrin isoform X2 [Poecilia reticulata]
Length=866

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005343305.1| PREDICTED: gephyrin isoform X5 [Microtus ochrogaster]
 ref|XP_006973192.1| PREDICTED: gephyrin isoform X3 [Peromyscus maniculatus bairdii]
Length=750

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007184373.1| PREDICTED: gephyrin isoform X5 [Balaenoptera acutorostrata scammoni]
 ref|XP_007473124.1| PREDICTED: gephyrin isoform X6 [Monodelphis domestica]
Length=779

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005803168.1| PREDICTED: gephyrin-like isoform X2 [Xiphophorus maculatus]
Length=794

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  16   RVEVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004477404.1| PREDICTED: gephyrin [Dasypus novemcinctus]
Length=741

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005561586.1| PREDICTED: gephyrin isoform X13 [Macaca fascicularis]
 ref|XP_007985205.1| PREDICTED: gephyrin isoform X17 [Chlorocebus sabaeus]
Length=771

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010586998.1| PREDICTED: LOW QUALITY PROTEIN: gephyrin [Loxodonta africana]
Length=729

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_011382505.1| PREDICTED: gephyrin isoform X3 [Pteropus vampyrus]
Length=741

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395703.1| PREDICTED: gephyrin isoform X10 [Poecilia reticulata]
Length=809

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005267311.1| PREDICTED: gephyrin isoform X5 [Homo sapiens]
 ref|XP_005561589.1| PREDICTED: gephyrin isoform X16 [Macaca fascicularis]
 ref|XP_007473125.1| PREDICTED: gephyrin isoform X7 [Monodelphis domestica]
 ref|XP_007985209.1| PREDICTED: gephyrin isoform X21 [Chlorocebus sabaeus]
 ref|XP_009004423.1| PREDICTED: gephyrin isoform X11 [Callithrix jacchus]
 ref|XP_008976029.1| PREDICTED: gephyrin isoform X7 [Pan paniscus]
 ref|XP_009426255.1| PREDICTED: gephyrin isoform X19 [Pan troglodytes]
 ref|XP_010333477.1| PREDICTED: gephyrin isoform X8 [Saimiri boliviensis boliviensis]
Length=755

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008976026.1| PREDICTED: gephyrin isoform X4 [Pan paniscus]
 ref|XP_010333475.1| PREDICTED: gephyrin isoform X6 [Saimiri boliviensis boliviensis]
Length=776

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395698.1| PREDICTED: gephyrin isoform X5 [Poecilia reticulata]
Length=853

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|NP_766540.2| gephyrin isoform 2 [Mus musculus]
 sp|Q8BUV3.2|GEPH_MOUSE RecName: Full=Gephyrin; Includes: RecName: Full=Molybdopterin 
adenylyltransferase; Short=MPT adenylyltransferase; AltName: 
Full=Domain G; Includes: RecName: Full=Molybdopterin molybdenumtransferase; 
Short=MPT Mo-transferase; AltName: Full=Domain 
E [Mus musculus]
Length=769

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>dbj|BAC38476.1| unnamed protein product [Mus musculus]
Length=769

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_010807867.1| PREDICTED: gephyrin isoform X9 [Bos taurus]
Length=760

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008395701.1| PREDICTED: gephyrin isoform X8 [Poecilia reticulata]
Length=842

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_008395697.1| PREDICTED: gephyrin isoform X4 [Poecilia reticulata]
Length=861

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_007525883.1| PREDICTED: gephyrin isoform X3 [Erinaceus europaeus]
Length=769

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004584525.1| PREDICTED: gephyrin isoform X3 [Ochotona princeps]
Length=769

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_001230231.1| gephyrin [Sus scrofa]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKEGSQECFQFILPALPHAIDLLR  170



>ref|XP_005306754.1| PREDICTED: gephyrin isoform X7 [Chrysemys picta bellii]
Length=769

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008850363.1| PREDICTED: gephyrin isoform X2 [Nannospalax galili]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008137160.1| PREDICTED: gephyrin isoform X3 [Eptesicus fuscus]
Length=769

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004397630.1| PREDICTED: gephyrin isoform 3 [Odobenus rosmarus divergens]
 ref|XP_004612403.1| PREDICTED: gephyrin isoform X3 [Sorex araneus]
 ref|XP_004681827.1| PREDICTED: gephyrin isoform X3 [Condylura cristata]
 ref|XP_004837434.1| PREDICTED: gephyrin isoform X3 [Heterocephalus glaber]
 ref|XP_005267310.1| PREDICTED: gephyrin isoform X4 [Homo sapiens]
 ref|XP_005343304.1| PREDICTED: gephyrin isoform X4 [Microtus ochrogaster]
 ref|XP_005322863.1| PREDICTED: gephyrin isoform X5 [Ictidomys tridecemlineatus]
 ref|XP_005399156.1| PREDICTED: gephyrin-like isoform X7 [Chinchilla lanigera]
 ref|XP_005561588.1| PREDICTED: gephyrin isoform X15 [Macaca fascicularis]
 ref|XP_006091048.1| PREDICTED: gephyrin isoform X8 [Myotis lucifugus]
 ref|XP_007985207.1| PREDICTED: gephyrin isoform X19 [Chlorocebus sabaeus]
 ref|XP_008850362.1| PREDICTED: gephyrin isoform X1 [Nannospalax galili]
 ref|XP_008976027.1| PREDICTED: gephyrin isoform X6 [Pan paniscus]
 ref|XP_009426253.1| PREDICTED: gephyrin isoform X17 [Pan troglodytes]
 ref|XP_010643625.1| PREDICTED: gephyrin isoform X3 [Fukomys damarensis]
Length=769

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_035612536.1| molybdopterin adenylyltransferase [Haloferula sp. BvORR071]
Length=157

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 3/159 (2%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            +VA LT+SD  + G   DRSGP    ++  +     G       V+PD+ ++I  +L + 
Sbjct  2    KVARLTLSDRASKGIYEDRSGPEIERILGEAQ---AGEIEWLRIVMPDEREEIEVLLKQL  58

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
             D D  DLV+T GGTG SPRDVTPEAT+ +L++E PG   VM  +S    P A+LSR  A
Sbjct  59   ADEDRCDLVVTTGGTGPSPRDVTPEATRAVLERELPGFGEVMRMQSFAKVPTAILSRSTA  118

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  263
            G RG TLI+N+PGNP A+ EC+  LLPA+   LK +RG+
Sbjct  119  GTRGQTLIVNLPGNPKAIGECLPLLLPAIAECLKHLRGE  157



>ref|XP_008395696.1| PREDICTED: gephyrin isoform X3 [Poecilia reticulata]
Length=862

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V+  S  L G  +V   +VPD+I +I++ L+  
Sbjct  83   RVGVLTVSDSCFRNLAEDRSGINLKDLVHDPS--LLGGMIVAYKIVPDEIDEIKETLVDW  140

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  141  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMSLAMLMGSLNVTPLGMLSRPVC  200

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  201  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  237



>ref|XP_005961617.1| PREDICTED: gephyrin isoform X2 [Pantholops hodgsonii]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_003586638.1| PREDICTED: gephyrin isoform X8 [Bos taurus]
 ref|XP_004010775.1| PREDICTED: gephyrin isoform 1 [Ovis aries]
 ref|XP_004262186.1| PREDICTED: gephyrin isoform 1 [Orcinus orca]
 ref|XP_010845042.1| PREDICTED: gephyrin isoform X2 [Bison bison bison]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_008137159.1| PREDICTED: gephyrin isoform X2 [Eptesicus fuscus]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006973191.1| PREDICTED: gephyrin isoform X2 [Peromyscus maniculatus bairdii]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_011382489.1| PREDICTED: gephyrin isoform X1 [Pteropus vampyrus]
Length=777

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004837433.1| PREDICTED: gephyrin isoform X2 [Heterocephalus glaber]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004426312.1| PREDICTED: gephyrin isoform 1 [Ceratotherium simum simum]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_003435079.1| PREDICTED: gephyrin isoformX1 [Canis lupus familiaris]
 ref|XP_006915196.1| PREDICTED: gephyrin [Pteropus alecto]
 ref|XP_011382497.1| PREDICTED: gephyrin isoform X2 [Pteropus vampyrus]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007614396.1| PREDICTED: uncharacterized protein LOC100762786 isoform X3, partial 
[Cricetulus griseus]
Length=504

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  278  RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  335

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  336  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  395

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  396  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  432



>ref|XP_007184374.1| PREDICTED: gephyrin isoform X6 [Balaenoptera acutorostrata scammoni]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>dbj|BAA92623.1| KIAA1385 protein [Homo sapiens]
Length=768

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  48   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  105

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  106  CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  165

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  166  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  202



>ref|XP_004837432.1| PREDICTED: gephyrin isoform X1 [Heterocephalus glaber]
Length=791

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005877967.1| PREDICTED: gephyrin isoform X3 [Myotis brandtii]
 ref|XP_006091047.1| PREDICTED: gephyrin isoform X7 [Myotis lucifugus]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_005399155.1| PREDICTED: gephyrin-like isoform X6 [Chinchilla lanigera]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_011281583.1| PREDICTED: gephyrin isoform X4 [Felis catus]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007940487.1| PREDICTED: gephyrin isoform X2 [Orycteropus afer afer]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004612402.1| PREDICTED: gephyrin isoform X2 [Sorex araneus]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004584524.1| PREDICTED: gephyrin isoform X2 [Ochotona princeps]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_001369816.1| PREDICTED: gephyrin isoform X1 [Monodelphis domestica]
Length=772

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_007449084.1| PREDICTED: gephyrin isoform X3 [Lipotes vexillifer]
Length=736

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLVDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004371016.1| PREDICTED: gephyrin isoform 1 [Trichechus manatus latirostris]
Length=773

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_006113470.1| PREDICTED: gephyrin isoform X1 [Pelodiscus sinensis]
Length=772

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|XP_004739021.1| PREDICTED: gephyrin isoform X5 [Mustela putorius furo]
 ref|XP_004797267.1| PREDICTED: gephyrin isoform X4 [Mustela putorius furo]
Length=772

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|WP_041720516.1| cytoplasmic protein [Desulfovibrio piezophilus]
Length=160

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 99/155 (64%), Gaps = 4/155 (3%)
 Frame = -3

Query  727  LTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRCCDID  548
            +T+SD  AAG   D+SGP    +V   SE+L  A  V   ++PDD ++++ +L     + 
Sbjct  1    MTLSDKGAAGKREDKSGPLIAKLV---SEKLDLA-FVQGFIIPDDPRQLKGLLADLALVQ  56

Query  547  HMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAAGIRG  368
              DL+LT GGTG  PRD+TPEAT  L++K  PG    M + SL  TP   +SR  AG   
Sbjct  57   RFDLILTTGGTGVGPRDITPEATLSLIEKRLPGYERAMTEASLSKTPHGAISRAIAGTLS  116

Query  367  STLIINMPGNPNAVAECMEPLLPALKHALKQIRGD  263
             TLI+NMPG+P AVAEC+EPLLP LKH L++++GD
Sbjct  117  ETLIVNMPGSPKAVAECLEPLLPTLKHTLEKLQGD  151



>ref|XP_010643623.1| PREDICTED: gephyrin isoform X1 [Fukomys damarensis]
Length=772

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



>ref|NP_065857.1| gephyrin isoform 1 [Homo sapiens]
 ref|XP_001135711.1| PREDICTED: gephyrin isoform X16 [Pan troglodytes]
 ref|XP_003263634.1| PREDICTED: gephyrin isoform 1 [Nomascus leucogenys]
 ref|XP_003824106.1| PREDICTED: gephyrin isoform X5 [Pan paniscus]
 ref|XP_003924492.1| PREDICTED: gephyrin isoform X7 [Saimiri boliviensis boliviensis]
 ref|XP_007985206.1| PREDICTED: gephyrin isoform X18 [Chlorocebus sabaeus]
 emb|CAC10537.1| gephyrin [Homo sapiens]
 gb|AAH30016.1| Gephyrin [Homo sapiens]
 gb|EAW80926.1| gephyrin, isoform CRA_d [Homo sapiens]
 gb|ABM83389.1| gephyrin [synthetic construct]
 gb|ABM86601.1| gephyrin [synthetic construct]
Length=769

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  739  RVAILTVSDTVAAGAGPDRSGPRAVSVVNSSSERLGGARVVTTAVVPDDIQKIRDILLRC  560
            RV +LTVSD+       DRSG     +V   S  L G  +    +VPD+I++I++ L+  
Sbjct  16   RVGVLTVSDSCFRNLAEDRSGINLKDLVQDPS--LLGGTISAYKIVPDEIEEIKETLIDW  73

Query  559  CDIDHMDLVLTLGGTGCSPRDVTPEATKPLLQKETPGLLHVMMQESLKITPFAMLSRPAA  380
            CD   ++L+LT GGTG +PRDVTPEATK ++++E PG+   M+  SL +TP  MLSRP  
Sbjct  74   CDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSLNVTPLGMLSRPVC  133

Query  379  GIRGSTLIINMPGNPNAVAECMEPLLPALKHALKQIR  269
            GIRG TLIIN+PG+     EC + +LPAL HA+  +R
Sbjct  134  GIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLR  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420