BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047N07

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353432.1|  PREDICTED: uncharacterized protein LOC102583...    302   1e-92   Solanum tuberosum [potatoes]
ref|XP_004240914.1|  PREDICTED: uncharacterized protein LOC101246145    301   2e-92   Solanum lycopersicum
emb|CDP13987.1|  unnamed protein product                                292   1e-90   Coffea canephora [robusta coffee]
ref|XP_009587726.1|  PREDICTED: uncharacterized protein LOC104085415    297   1e-90   Nicotiana tomentosiformis
ref|XP_006353433.1|  PREDICTED: uncharacterized protein LOC102583...    296   2e-90   
ref|XP_009799471.1|  PREDICTED: uncharacterized protein LOC104245548    293   4e-89   Nicotiana sylvestris
ref|XP_007163566.1|  hypothetical protein PHAVU_001G2449001g            264   3e-85   Phaseolus vulgaris [French bean]
ref|XP_009369204.1|  PREDICTED: uncharacterized protein LOC103958637    281   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_008369281.1|  PREDICTED: uncharacterized protein LOC103432852    280   2e-84   Malus domestica [apple tree]
gb|KDO68907.1|  hypothetical protein CISIN_1g002690mg                   270   2e-83   Citrus sinensis [apfelsine]
ref|XP_011084880.1|  PREDICTED: uncharacterized protein LOC105167...    277   3e-83   Sesamum indicum [beniseed]
ref|XP_010658247.1|  PREDICTED: uncharacterized protein LOC100241...    277   3e-83   Vitis vinifera
ref|XP_011084881.1|  PREDICTED: uncharacterized protein LOC105167...    277   3e-83   Sesamum indicum [beniseed]
ref|XP_002273020.1|  PREDICTED: uncharacterized protein LOC100241...    276   3e-83   Vitis vinifera
emb|CAN60362.1|  hypothetical protein VITISV_024684                     276   4e-83   Vitis vinifera
ref|XP_010658246.1|  PREDICTED: uncharacterized protein LOC100241...    276   4e-83   Vitis vinifera
ref|XP_010658245.1|  PREDICTED: uncharacterized protein LOC100241...    276   5e-83   Vitis vinifera
gb|KHN31294.1|  hypothetical protein glysoja_022948                     273   6e-83   Glycine soja [wild soybean]
ref|XP_006435779.1|  hypothetical protein CICLE_v10030686mg             276   6e-83   Citrus clementina [clementine]
ref|XP_002315147.1|  hypothetical protein POPTR_0010s19320g             276   6e-83   Populus trichocarpa [western balsam poplar]
gb|KDO68906.1|  hypothetical protein CISIN_1g002690mg                   270   8e-83   Citrus sinensis [apfelsine]
gb|KHN04776.1|  hypothetical protein glysoja_031876                     274   1e-82   Glycine soja [wild soybean]
ref|XP_010257084.1|  PREDICTED: uncharacterized protein LOC104597...    275   2e-82   Nelumbo nucifera [Indian lotus]
gb|EYU43434.1|  hypothetical protein MIMGU_mgv1a001986mg                272   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_006601947.1|  PREDICTED: uncharacterized protein LOC100788...    274   2e-82   Glycine max [soybeans]
ref|XP_006591388.1|  PREDICTED: uncharacterized protein LOC100804...    274   3e-82   Glycine max [soybeans]
ref|XP_003538476.2|  PREDICTED: uncharacterized protein LOC100804...    274   3e-82   Glycine max [soybeans]
ref|XP_003552278.1|  PREDICTED: uncharacterized protein LOC100788...    274   3e-82   Glycine max [soybeans]
gb|KDO68901.1|  hypothetical protein CISIN_1g002690mg                   272   2e-81   Citrus sinensis [apfelsine]
gb|KDO68900.1|  hypothetical protein CISIN_1g002690mg                   272   2e-81   Citrus sinensis [apfelsine]
ref|XP_011035906.1|  PREDICTED: uncharacterized protein LOC105133...    272   3e-81   Populus euphratica
ref|XP_011035907.1|  PREDICTED: uncharacterized protein LOC105133...    271   3e-81   Populus euphratica
gb|KGN45802.1|  hypothetical protein Csa_6G012270                       266   6e-81   Cucumis sativus [cucumbers]
gb|KDP44727.1|  hypothetical protein JCGZ_01227                         271   8e-81   Jatropha curcas
ref|XP_010105429.1|  UDP-sugar pyrophospharylase                        265   3e-80   
ref|XP_004500507.1|  PREDICTED: uncharacterized protein LOC101505226    268   7e-80   
ref|XP_009386480.1|  PREDICTED: uncharacterized protein LOC103973588    268   8e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002528323.1|  conserved hypothetical protein                     268   8e-80   Ricinus communis
ref|XP_007219560.1|  hypothetical protein PRUPE_ppa001281mg             268   9e-80   Prunus persica
ref|XP_004138414.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    267   2e-79   
ref|XP_008233789.1|  PREDICTED: uncharacterized protein LOC103332812    266   4e-79   Prunus mume [ume]
ref|XP_010257085.1|  PREDICTED: uncharacterized protein LOC104597...    265   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_008441479.1|  PREDICTED: UDP-sugar pyrophosphorylase             265   1e-78   Cucumis melo [Oriental melon]
ref|XP_010031181.1|  PREDICTED: uncharacterized protein LOC104421052    264   2e-78   Eucalyptus grandis [rose gum]
gb|KDO68902.1|  hypothetical protein CISIN_1g002690mg                   263   3e-78   Citrus sinensis [apfelsine]
gb|KCW50445.1|  hypothetical protein EUGRSUZ_J00183                     264   3e-78   Eucalyptus grandis [rose gum]
gb|KJB74378.1|  hypothetical protein B456_011G291300                    261   2e-77   Gossypium raimondii
ref|XP_004307650.1|  PREDICTED: uncharacterized protein LOC101304420    261   3e-77   Fragaria vesca subsp. vesca
ref|XP_003600957.1|  hypothetical protein MTR_3g071440                  259   7e-77   Medicago truncatula
gb|KEH34804.1|  UDP-glucose pyrophosphorylase                           259   8e-77   Medicago truncatula
ref|XP_007008906.1|  UDP-glucose pyrophosphorylase 3 isoform 3          258   2e-76   
gb|KHG20503.1|  UDP-sugar pyrophospharylase                             258   3e-76   Gossypium arboreum [tree cotton]
ref|XP_010693077.1|  PREDICTED: uncharacterized protein LOC104906066    253   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008811681.1|  PREDICTED: uncharacterized protein LOC103722...    253   2e-74   
ref|XP_008811677.1|  PREDICTED: uncharacterized protein LOC103722...    252   4e-74   
ref|XP_010907871.1|  PREDICTED: uncharacterized protein LOC105034415    251   7e-74   Elaeis guineensis
ref|XP_010427407.1|  PREDICTED: uncharacterized protein LOC104712252    234   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006655397.1|  PREDICTED: UDP-sugar pyrophosphorylase-like        245   8e-72   Oryza brachyantha
ref|XP_008656382.1|  PREDICTED: uncharacterized protein LOC103635...    244   3e-71   Zea mays [maize]
ref|XP_006403031.1|  hypothetical protein EUTSA_v10005783mg             243   8e-71   Eutrema salsugineum [saltwater cress]
gb|EMS56381.1|  hypothetical protein TRIUR3_23522                       239   1e-70   Triticum urartu
ref|XP_010554677.1|  PREDICTED: uncharacterized protein LOC104824329    242   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_010536381.1|  PREDICTED: uncharacterized protein LOC104811372    242   3e-70   Tarenaya hassleriana [spider flower]
emb|CAB87858.1|  putative protein                                       241   5e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567031.1|  UDP-glucose pyrophosphorylase 3                       241   5e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34847.1|  hypothetical protein AALP_AA5G200800                    240   1e-69   Arabis alpina [alpine rockcress]
ref|XP_002878057.1|  hypothetical protein ARALYDRAFT_486043             239   4e-69   
ref|XP_009116298.1|  PREDICTED: uncharacterized protein LOC103841...    239   4e-69   Brassica rapa
ref|XP_009116297.1|  PREDICTED: uncharacterized protein LOC103841...    238   4e-69   Brassica rapa
emb|CDY66808.1|  BnaA09g55090D                                          238   5e-69   Brassica napus [oilseed rape]
ref|XP_006403032.1|  hypothetical protein EUTSA_v10005783mg             238   5e-69   Eutrema salsugineum [saltwater cress]
gb|AAT47007.1|  unknown protein                                         236   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010516200.1|  PREDICTED: uncharacterized protein LOC104791893    237   2e-68   Camelina sativa [gold-of-pleasure]
gb|AFW82285.1|  hypothetical protein ZEAMMB73_228026                    237   2e-68   
ref|XP_003566160.2|  PREDICTED: UDP-sugar pyrophosphorylase             237   2e-68   Brachypodium distachyon [annual false brome]
gb|EEE64040.1|  hypothetical protein OsJ_18869                          237   2e-68   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85276.1|  predicted protein                                      236   2e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX72178.1|  BnaC08g26960D                                          235   7e-68   
gb|EEC79378.1|  hypothetical protein OsI_20285                          235   7e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_010427408.1|  PREDICTED: uncharacterized protein LOC104712253    235   9e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006292431.1|  hypothetical protein CARUB_v10018646mg             233   3e-67   Capsella rubella
ref|XP_006847401.1|  hypothetical protein AMTR_s00153p00036670          231   2e-66   
gb|KDO68903.1|  hypothetical protein CISIN_1g002690mg                   230   2e-66   Citrus sinensis [apfelsine]
ref|XP_010504481.1|  PREDICTED: uncharacterized protein LOC104781...    227   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010257086.1|  PREDICTED: uncharacterized protein LOC104597...    226   8e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010504480.1|  PREDICTED: uncharacterized protein LOC104781...    226   8e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008811680.1|  PREDICTED: uncharacterized protein LOC103722...    224   4e-64   
ref|NP_001055800.2|  Os05g0468600                                       223   1e-63   
ref|XP_007008905.1|  UDP-glucose pyrophosphorylase 3 isoform 2          221   1e-62   
ref|XP_008354177.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    189   6e-52   
gb|KDO68904.1|  hypothetical protein CISIN_1g002690mg                   189   1e-51   Citrus sinensis [apfelsine]
ref|XP_007008904.1|  UDP-glucose pyrophosphorylase 3 isoform 1          184   6e-50   
gb|KJB74379.1|  hypothetical protein B456_011G291300                    183   2e-49   Gossypium raimondii
ref|XP_007008907.1|  UDP-glucose pyrophosphorylase 3 isoform 4          179   4e-48   
gb|EPS73539.1|  hypothetical protein M569_01218                         165   6e-48   Genlisea aurea
ref|XP_008656383.1|  PREDICTED: uncharacterized protein LOC103635...    179   6e-48   
ref|XP_002988988.1|  hypothetical protein SELMODRAFT_159835             157   3e-40   
ref|XP_002975099.1|  hypothetical protein SELMODRAFT_150184             155   2e-39   
ref|XP_002949328.1|  hypothetical protein VOLCADRAFT_59132              135   1e-32   Volvox carteri f. nagariensis
emb|CCB89762.1|  putative uncharacterized protein                       133   1e-31   Simkania negevensis Z
ref|WP_041419450.1|  hypothetical protein                               130   4e-31   
ref|XP_001420890.1|  predicted protein                                  117   3e-26   Ostreococcus lucimarinus CCE9901
ref|WP_006340614.1|  hypothetical protein                               117   4e-26   Parachlamydia acanthamoebae
emb|CEG00018.1|  UTP--glucose-1-phosphate uridylyltransferase           117   6e-26   Ostreococcus tauri
ref|XP_011402066.1|  hypothetical protein F751_6536                     115   6e-26   Auxenochlorella protothecoides
ref|XP_003082504.1|  unnamed protein product                            116   6e-26   
ref|WP_013924194.1|  hypothetical protein                               114   3e-25   Parachlamydia acanthamoebae
gb|KIA76347.1|  hypothetical protein DB43_AK00070                       114   4e-25   Parachlamydia acanthamoebae
gb|AAY31019.1|  low photochemical bleaching 1 protein                   114   6e-25   Chlamydomonas reinhardtii
gb|AAY31018.1|  low photochemical bleaching 1 protein                   114   6e-25   Chlamydomonas reinhardtii
ref|XP_003057529.1|  predicted protein                                  113   7e-25   Micromonas pusilla CCMP1545
ref|XP_007515057.1|  predicted protein                                  114   7e-25   Bathycoccus prasinos
ref|XP_002502005.1|  predicted protein                                  107   2e-23   Micromonas commoda
ref|XP_005850851.1|  hypothetical protein CHLNCDRAFT_140453             102   8e-22   Chlorella variabilis
emb|CAF23048.1|  hypothetical protein pc0324                            103   3e-21   Candidatus Protochlamydia amoebophila UWE25
ref|WP_039356565.1|  hypothetical protein                               102   3e-21   
ref|WP_044045343.1|  hypothetical protein                               102   3e-21   
gb|KIC73590.1|  hypothetical protein DB44_BC00180                       102   3e-21   Candidatus Protochlamydia amoebophila
emb|CDZ79581.1|  hypothetical protein BN1013_00075                      102   4e-21   Candidatus Rubidus massiliensis
ref|WP_042282241.1|  hypothetical protein                               102   5e-21   
ref|XP_004160752.1|  PREDICTED: uncharacterized LOC101221986          93.6    7e-21   
ref|WP_042103582.1|  hypothetical protein                               101   9e-21   
ref|XP_005651201.1|  nucleotide-diphospho-sugar transferase             102   1e-20   Coccomyxa subellipsoidea C-169
gb|KIC72534.1|  hypothetical protein DB41_KJ00090                     98.6    1e-19   Neochlamydia sp. TUME1
ref|WP_039386373.1|  hypothetical protein                             98.2    1e-19   
gb|KIC75402.1|  hypothetical protein DB42_AC00080                     98.2    1e-19   Neochlamydia sp. EPS4
ref|WP_042240571.1|  hypothetical protein                             98.2    1e-19   
ref|WP_032125914.1|  hypothetical protein                             94.0    3e-18   
gb|EKE08140.1|  hypothetical protein ACD_17C00324G0001                85.5    5e-17   uncultured bacterium
ref|WP_041017774.1|  hypothetical protein                             89.0    1e-16   
emb|CDR34196.1|  Conserved hypothetical protein                       89.0    2e-16   Criblamydia sequanensis CRIB-18
gb|KJB74377.1|  hypothetical protein B456_011G291300                  85.5    2e-15   Gossypium raimondii
gb|EKE21602.1|  hypothetical protein ACD_7C00172G0003                 75.1    2e-12   uncultured bacterium
gb|ADI37750.1|  conserved hypothetical protein                        67.8    1e-09   Waddlia chondrophila WSU 86-1044
ref|WP_041941704.1|  hypothetical protein                             67.4    1e-09   
ref|XP_011084882.1|  PREDICTED: uncharacterized protein LOC105167...  51.6    3e-04   Sesamum indicum [beniseed]



>ref|XP_006353432.1| PREDICTED: uncharacterized protein LOC102583756 isoform X1 [Solanum 
tuberosum]
Length=870

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKFH GSIS GSELQIEVAEF WRDVQLDGSLIILAENV+GS  ++ENGETVL YG
Sbjct  698  EVTRQKFHRGSISRGSELQIEVAEFLWRDVQLDGSLIILAENVLGSPRIDENGETVLHYG  757

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            KRC RCKL+NVK+LNDGIDWN+R+NLYWKHDV RFE+VKVILHGNAEFEA+DVILQGNHV
Sbjct  758  KRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEFEAVDVILQGNHV  817

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  205
            FEVPDGYKMKIT G+SG  V+L  IEN+ M+SG+WFWNYKIMG H+QLELV
Sbjct  818  FEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHVQLELV  868



>ref|XP_004240914.1| PREDICTED: uncharacterized protein LOC101246145 [Solanum lycopersicum]
Length=867

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EVIRQKF+ GSIS+GSEL IEVAEF WRDVQLDGSLIILAENV+GS  ++ENGETVL YG
Sbjct  695  EVIRQKFYRGSISKGSELLIEVAEFLWRDVQLDGSLIILAENVLGSPRIDENGETVLHYG  754

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            KRC RCKL+NVK+LNDGIDWN+R+NLYWKHDV RFE+VKVILHGNAEFEA+DVILQGNHV
Sbjct  755  KRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEFEAVDVILQGNHV  814

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYKMKIT G+SG  V+L  IEN+ M+SG+WFWNYKIMG H+QLELVE
Sbjct  815  FEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHVQLELVE  866



>emb|CDP13987.1| unnamed protein product [Coffea canephora]
Length=651

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKFHGGSIS GSELQ+EVAEF WRDVQL GSLIILAEN+MGS ++NENGETVLQYG
Sbjct  479  EVTRQKFHGGSISMGSELQVEVAEFVWRDVQLHGSLIILAENIMGSMIINENGETVLQYG  538

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            KRC RCKL+NVKV+N GIDWNS DNLYWKHDV R E+VKVILHGNAEFEAMDV LQGNH+
Sbjct  539  KRCGRCKLENVKVVNKGIDWNSGDNLYWKHDVDRIEAVKVILHGNAEFEAMDVTLQGNHL  598

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGY+M++T G SG +VQL AIE + ++SG+WFW+YKI GTHIQLELVE
Sbjct  599  FEVPDGYRMRVTSGKSGLQVQLRAIEEKWVESGSWFWSYKIEGTHIQLELVE  650



>ref|XP_009587726.1| PREDICTED: uncharacterized protein LOC104085415 [Nicotiana tomentosiformis]
Length=871

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKFH GSIS GSELQIEVAEF WRDVQLDGSLIILAEN++GST ++ENGET+LQYG
Sbjct  699  EVTRQKFHRGSISRGSELQIEVAEFLWRDVQLDGSLIILAENILGSTTIDENGETILQYG  758

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            KRC RCKL+NVK+LNDGI+WNS++NLYWKHDV RFE+VKVILHGNAEFEA DV+LQGNHV
Sbjct  759  KRCGRCKLENVKILNDGINWNSKENLYWKHDVERFEAVKVILHGNAEFEAADVMLQGNHV  818

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKIT G+SG  V+L  IE + M+ G+WFWNYKIMG H+QLELVE
Sbjct  819  FEVPNGYKMKITTGDSGLAVELKPIEKKLMECGSWFWNYKIMGKHVQLELVE  870



>ref|XP_006353433.1| PREDICTED: uncharacterized protein LOC102583756 isoform X2 [Solanum 
tuberosum]
Length=838

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            E+   KFH GSIS GSELQIEVAEF WRDVQLDGSLIILAENV+GS  ++ENGETVL YG
Sbjct  666  EIKLPKFHRGSISRGSELQIEVAEFLWRDVQLDGSLIILAENVLGSPRIDENGETVLHYG  725

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            KRC RCKL+NVK+LNDGIDWN+R+NLYWKHDV RFE+VKVILHGNAEFEA+DVILQGNHV
Sbjct  726  KRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEFEAVDVILQGNHV  785

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  205
            FEVPDGYKMKIT G+SG  V+L  IEN+ M+SG+WFWNYKIMG H+QLELV
Sbjct  786  FEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHVQLELV  836



>ref|XP_009799471.1| PREDICTED: uncharacterized protein LOC104245548 [Nicotiana sylvestris]
Length=875

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+ GSIS GSELQIEVAEF WRDVQLDGSLIILAEN++GST ++ENGET+LQYG
Sbjct  703  EVTRQKFYRGSISRGSELQIEVAEFLWRDVQLDGSLIILAENILGSTTIDENGETILQYG  762

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            KRC RCKL+NVK+LNDGI+WNS++NLYWKHDV RFE+V V+LHGNAEFEA DV+LQGNHV
Sbjct  763  KRCGRCKLENVKILNDGINWNSKENLYWKHDVQRFEAVNVLLHGNAEFEAADVVLQGNHV  822

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKIT G+SG  V+L  IE + M+ G+WFWNYKIMG H+QLELVE
Sbjct  823  FEVPNGYKMKITTGDSGLAVELKPIEKKLMECGSWFWNYKIMGKHVQLELVE  874



>ref|XP_007163566.1| hypothetical protein PHAVU_001G2449001g, partial [Phaseolus vulgaris]
 gb|ESW35560.1| hypothetical protein PHAVU_001G2449001g, partial [Phaseolus vulgaris]
Length=199

 Score =   264 bits (674),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV +QKF+GGS+SEGSELQIEVAEF+WR+VQL+GSLII+AENVMGS  +NE+GE++L YG
Sbjct  27   EVTKQKFYGGSVSEGSELQIEVAEFFWRNVQLNGSLIIIAENVMGSMKINESGESILHYG  86

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC +CKL+NVKVLN GIDWN   N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  87   QRCGKCKLQNVKVLNKGIDWNCGRNIYWKHDVQRSEMLQIILHGNAEFEATDVVLQGNHV  146

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDG+++KI PG+ G  +QL+ I+   M+SG+W WNY++ G+H+QL+LVES
Sbjct  147  FEVPDGHRLKIMPGSPGLAIQLDPIDQDRMESGSWHWNYRVQGSHVQLDLVES  199



>ref|XP_009369204.1| PREDICTED: uncharacterized protein LOC103958637 [Pyrus x bretschneideri]
Length=871

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGS+SEGSELQ+EVAEF WR+VQLDGSL++ A+NVMGST +++NGE +LQYG
Sbjct  699  EVTRQKFYGGSVSEGSELQVEVAEFLWRNVQLDGSLLVEADNVMGSTRIDQNGEPILQYG  758

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLNDGIDWN  DN+YWKHDV R E+ KV+LHGNAEFEA DVILQGNH 
Sbjct  759  HRCGRCKLQNVKVLNDGIDWNFEDNVYWKHDVQRLEACKVVLHGNAEFEATDVILQGNHT  818

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKIT G+SG   +L+ IE   MDSG+WFW Y+I GTHIQLELVE
Sbjct  819  FEVPNGYKMKITAGDSGLATRLDPIEQNMMDSGSWFWEYRIKGTHIQLELVE  870



>ref|XP_008369281.1| PREDICTED: uncharacterized protein LOC103432852 [Malus domestica]
Length=872

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGS+SEGSELQ+EVAEF WR+VQLDGSLI+ A+NVMGST +++NGE +LQYG
Sbjct  700  EVTRQKFYGGSVSEGSELQVEVAEFLWRNVQLDGSLIVEADNVMGSTRIDQNGEPILQYG  759

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLNDGIDWN  DN+YWKHDV R E+ KV+LHGNAEFEA DVILQGNH 
Sbjct  760  HRCGRCKLQNVKVLNDGIDWNFEDNVYWKHDVQRLEACKVVLHGNAEFEATDVILQGNHT  819

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKIT G+SG   +L+ IE   MDSG+WFW Y++ GTHIQLELVE
Sbjct  820  FEVPNGYKMKITAGDSGLAARLDPIELNMMDSGSWFWEYRVKGTHIQLELVE  871



>gb|KDO68907.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=548

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST + +NGE++LQYG
Sbjct  376  EVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTRIADNGESILQYG  435

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEFEA DV LQGNHV
Sbjct  436  YRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEFEASDVTLQGNHV  495

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI LELVE
Sbjct  496  FEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVLELVE  547



>ref|XP_011084880.1| PREDICTED: uncharacterized protein LOC105167026 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF  GSI+ GSELQIEVAEF WR+VQLDGSL++LAEN +GS  +NENGE ++QYG
Sbjct  695  EVTRQKFRCGSIAMGSELQIEVAEFLWRNVQLDGSLLVLAENAVGSIEINENGEPIIQYG  754

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC+RCKL+NVK+LN+GIDW+SRDN+YWKHDV RFE++KVILHGNAEFEA DV++QGN+V
Sbjct  755  RRCARCKLENVKILNNGIDWSSRDNVYWKHDVQRFEALKVILHGNAEFEATDVVIQGNYV  814

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            F VPDG+KM++T G SG +VQL  IE   MDSGTWFWNYKI GTHI+LEL+E
Sbjct  815  FNVPDGHKMQVTSGISGLDVQLKPIEEDLMDSGTWFWNYKIRGTHIELELIE  866



>ref|XP_010658247.1| PREDICTED: uncharacterized protein LOC100241552 isoform X3 [Vitis 
vinifera]
Length=861

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST ++ENGE +LQYG
Sbjct  689  EVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTRIDENGEPMLQYG  748

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEFEA DVILQ NHV
Sbjct  749  HRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEFEATDVILQRNHV  808

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI LELVE
Sbjct  809  FEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHLELVE  860



>ref|XP_011084881.1| PREDICTED: uncharacterized protein LOC105167026 isoform X2 [Sesamum 
indicum]
Length=866

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF  GSI+ GSELQIEVAEF WR+VQLDGSL++LAEN +GS  +NENGE ++QYG
Sbjct  694  EVTRQKFRCGSIAMGSELQIEVAEFLWRNVQLDGSLLVLAENAVGSIEINENGEPIIQYG  753

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC+RCKL+NVK+LN+GIDW+SRDN+YWKHDV RFE++KVILHGNAEFEA DV++QGN+V
Sbjct  754  RRCARCKLENVKILNNGIDWSSRDNVYWKHDVQRFEALKVILHGNAEFEATDVVIQGNYV  813

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            F VPDG+KM++T G SG +VQL  IE   MDSGTWFWNYKI GTHI+LEL+E
Sbjct  814  FNVPDGHKMQVTSGISGLDVQLKPIEEDLMDSGTWFWNYKIRGTHIELELIE  865



>ref|XP_002273020.1| PREDICTED: uncharacterized protein LOC100241552 isoform X4 [Vitis 
vinifera]
 emb|CBI25447.3| unnamed protein product [Vitis vinifera]
Length=860

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST ++ENGE +LQYG
Sbjct  688  EVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTRIDENGEPMLQYG  747

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEFEA DVILQ NHV
Sbjct  748  HRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEFEATDVILQRNHV  807

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI LELVE
Sbjct  808  FEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHLELVE  859



>emb|CAN60362.1| hypothetical protein VITISV_024684 [Vitis vinifera]
Length=866

 Score =   276 bits (707),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST ++ENGE +LQYG
Sbjct  694  EVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTRIDENGEPMLQYG  753

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEFEA DVILQ NHV
Sbjct  754  HRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEFEATDVILQRNHV  813

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI LELVE
Sbjct  814  FEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHLELVE  865



>ref|XP_010658246.1| PREDICTED: uncharacterized protein LOC100241552 isoform X2 [Vitis 
vinifera]
Length=872

 Score =   276 bits (707),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST ++ENGE +LQYG
Sbjct  700  EVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTRIDENGEPMLQYG  759

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEFEA DVILQ NHV
Sbjct  760  HRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEFEATDVILQRNHV  819

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI LELVE
Sbjct  820  FEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHLELVE  871



>ref|XP_010658245.1| PREDICTED: uncharacterized protein LOC100241552 isoform X1 [Vitis 
vinifera]
Length=873

 Score =   276 bits (707),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST ++ENGE +LQYG
Sbjct  701  EVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTRIDENGEPMLQYG  760

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEFEA DVILQ NHV
Sbjct  761  HRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEFEATDVILQRNHV  820

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI LELVE
Sbjct  821  FEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHLELVE  872



>gb|KHN31294.1| hypothetical protein glysoja_022948 [Glycine soja]
Length=690

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII++ENVMGS  +NENGE++L YG
Sbjct  518  EVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIISENVMGSMKINENGESILHYG  577

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  578  QRCGRCKLQNVKVLNKGIDWTCGENIYWKHDVQRSEVLQIILHGNAEFEATDVVLQGNHV  637

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KITPG+ G  ++L+ I+   M+SG+W W+YKI G+HIQLELVES
Sbjct  638  FEVPDGYKLKITPGSPGLAIKLDPIDQDMMESGSWHWDYKIEGSHIQLELVES  690



>ref|XP_006435779.1| hypothetical protein CICLE_v10030686mg [Citrus clementina]
 ref|XP_006486288.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Citrus sinensis]
 gb|ESR49019.1| hypothetical protein CICLE_v10030686mg [Citrus clementina]
Length=868

 Score =   276 bits (706),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST + +NGE++LQYG
Sbjct  696  EVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTRIADNGESILQYG  755

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NVKVLN GIDW+  DN YWKHDV RFE++KVILHGNAEFEA DV LQGNHV
Sbjct  756  YRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQRFEALKVILHGNAEFEASDVTLQGNHV  815

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI LELVE
Sbjct  816  FEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVLELVE  867



>ref|XP_002315147.1| hypothetical protein POPTR_0010s19320g [Populus trichocarpa]
 gb|EEF01318.1| hypothetical protein POPTR_0010s19320g [Populus trichocarpa]
Length=877

 Score =   276 bits (706),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS+GSELQIEVAEF WR+VQLDGSLII+AENVMGST ++ NGE +LQYG
Sbjct  705  EVTRQKFNGGSISKGSELQIEVAEFSWRNVQLDGSLIIIAENVMGSTRIDPNGEPILQYG  764

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RC+L+NVKV+N GI+W+  DN+YWKHDV RFE++KVILHGNAEFEA +V +QGN +
Sbjct  765  NRCGRCRLQNVKVVNKGINWSFGDNIYWKHDVQRFEALKVILHGNAEFEADNVTIQGNQI  824

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FE+PDGYKMKIT G+SG +VQLN +E + MDSG+W WNYKI G+HIQLELVE+
Sbjct  825  FEIPDGYKMKITSGDSGLQVQLNPLEQKIMDSGSWHWNYKIHGSHIQLELVET  877



>gb|KDO68906.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=612

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST + +NGE++LQYG
Sbjct  440  EVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTRIADNGESILQYG  499

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEFEA DV LQGNHV
Sbjct  500  YRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEFEASDVTLQGNHV  559

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI LELVE
Sbjct  560  FEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVLELVE  611



>gb|KHN04776.1| hypothetical protein glysoja_031876 [Glycine soja]
Length=772

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII+AENVMGS  +NEN E++L YG
Sbjct  600  EVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIIAENVMGSMKINENSESILHYG  659

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  660  QRCGRCKLQNVKVLNKGIDWTCDENIYWKHDVQRSEVLQIILHGNAEFEATDVVLQGNHV  719

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KI PG+SG  +QL+ I+   M+SG+W W+YKI G+HIQLELVES
Sbjct  720  FEVPDGYKLKIMPGSSGLAIQLDPIDQDMMESGSWHWDYKIEGSHIQLELVES  772



>ref|XP_010257084.1| PREDICTED: uncharacterized protein LOC104597312 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+ GSIS+GSELQ+EVAEF WRDVQLDGSLI++AEN+MGST ++E GE +L YG
Sbjct  703  EVTRQKFYRGSISDGSELQVEVAEFLWRDVQLDGSLIVVAENIMGSTRIDEAGEPILIYG  762

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLN GIDW+S +N+YWK DV RFE++KVILHGNAEFEA DV+LQGNHV
Sbjct  763  HRCGRCKLQNVKVLNRGIDWSSSENIYWKLDVQRFEALKVILHGNAEFEAKDVVLQGNHV  822

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKM+IT GNSGF V+L+ IE   MD G+WFW YK+ GTHIQLE++E
Sbjct  823  FEVPNGYKMQITAGNSGFSVRLDPIEKGMMDCGSWFWKYKLRGTHIQLEMIE  874



>gb|EYU43434.1| hypothetical protein MIMGU_mgv1a001986mg [Erythranthe guttata]
Length=730

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+GSELQIEVAEF WR+VQLDGSLIILAENV+GST  NE GE +LQYG
Sbjct  558  EVTRQKFLGGSISKGSELQIEVAEFLWRNVQLDGSLIILAENVVGSTKTNEIGEPILQYG  617

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC+RCKL+NV+V+N GIDWNS DNLYWKH+V RF ++KVILHGNAEFEA DV++QGNHV
Sbjct  618  RRCARCKLENVRVVNGGIDWNSEDNLYWKHEVQRFGTLKVILHGNAEFEATDVVIQGNHV  677

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            F+VPDG+K+KIT G SG E++L  IE+  MDSGTWFW YK+ GTH++LE V+
Sbjct  678  FDVPDGHKLKITSGISGLEMKLKPIEDELMDSGTWFWKYKLNGTHVELESVD  729



>ref|XP_006601947.1| PREDICTED: uncharacterized protein LOC100788781 isoform X2 [Glycine 
max]
Length=843

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII++ENVMGS  +NENGE++L YG
Sbjct  671  EVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIISENVMGSMKINENGESILHYG  730

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  731  QRCGRCKLQNVKVLNKGIDWTCGENIYWKHDVQRSEVLQIILHGNAEFEATDVVLQGNHV  790

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KITPG+ G  ++L+ I+   M+SG+W W+YKI G+HIQLELVES
Sbjct  791  FEVPDGYKLKITPGSPGLAIKLDPIDQDMMESGSWHWDYKIEGSHIQLELVES  843



>ref|XP_006591388.1| PREDICTED: uncharacterized protein LOC100804343 isoform X2 [Glycine 
max]
Length=837

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII+AENVMGS  +NEN E++L YG
Sbjct  665  EVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIIAENVMGSMKINENSESILHYG  724

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  725  QRCGRCKLQNVKVLNKGIDWTCDENIYWKHDVQRSEVLQIILHGNAEFEATDVVLQGNHV  784

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KI PG+SG  +QL+ I+   M+SG+W W+YKI G+HIQLELVES
Sbjct  785  FEVPDGYKLKIMPGSSGLAIQLDPIDQDMMESGSWHWDYKIEGSHIQLELVES  837



>ref|XP_003538476.2| PREDICTED: uncharacterized protein LOC100804343 isoform X1 [Glycine 
max]
Length=863

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII+AENVMGS  +NEN E++L YG
Sbjct  691  EVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIIAENVMGSMKINENSESILHYG  750

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  751  QRCGRCKLQNVKVLNKGIDWTCDENIYWKHDVQRSEVLQIILHGNAEFEATDVVLQGNHV  810

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KI PG+SG  +QL+ I+   M+SG+W W+YKI G+HIQLELVES
Sbjct  811  FEVPDGYKLKIMPGSSGLAIQLDPIDQDMMESGSWHWDYKIEGSHIQLELVES  863



>ref|XP_003552278.1| PREDICTED: uncharacterized protein LOC100788781 isoform X1 [Glycine 
max]
Length=857

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII++ENVMGS  +NENGE++L YG
Sbjct  685  EVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIISENVMGSMKINENGESILHYG  744

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  745  QRCGRCKLQNVKVLNKGIDWTCGENIYWKHDVQRSEVLQIILHGNAEFEATDVVLQGNHV  804

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KITPG+ G  ++L+ I+   M+SG+W W+YKI G+HIQLELVES
Sbjct  805  FEVPDGYKLKITPGSPGLAIKLDPIDQDMMESGSWHWDYKIEGSHIQLELVES  857



>gb|KDO68901.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=864

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST + +NGE++LQYG
Sbjct  692  EVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTRIADNGESILQYG  751

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEFEA DV LQGNHV
Sbjct  752  YRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEFEASDVTLQGNHV  811

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI LELVE
Sbjct  812  FEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVLELVE  863



>gb|KDO68900.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=892

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST + +NGE++LQYG
Sbjct  720  EVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTRIADNGESILQYG  779

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEFEA DV LQGNHV
Sbjct  780  YRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEFEASDVTLQGNHV  839

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI LELVE
Sbjct  840  FEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVLELVE  891



>ref|XP_011035906.1| PREDICTED: uncharacterized protein LOC105133562 isoform X1 [Populus 
euphratica]
Length=877

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS+GSELQIEVAEF WR+VQLDGSLII+AENVMGST ++ NG+ +LQYG
Sbjct  705  EVTRQKFNGGSISKGSELQIEVAEFSWRNVQLDGSLIIIAENVMGSTRIDPNGDPILQYG  764

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RC+L+NVKV+N GI+W+  DN+YWKHDV RFE+++VILHGNAEFEA +V +QGN +
Sbjct  765  NRCGRCRLQNVKVVNKGINWSFGDNIYWKHDVQRFEALEVILHGNAEFEADNVTIQGNQI  824

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FE+PDGYKMKIT G+SG +VQLN +E + MDSG+W WNYKI G HIQLELVE
Sbjct  825  FEIPDGYKMKITSGDSGLQVQLNPLEQKIMDSGSWHWNYKIHGPHIQLELVE  876



>ref|XP_011035907.1| PREDICTED: uncharacterized protein LOC105133562 isoform X2 [Populus 
euphratica]
Length=863

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS+GSELQIEVAEF WR+VQLDGSLII+AENVMGST ++ NG+ +LQYG
Sbjct  691  EVTRQKFNGGSISKGSELQIEVAEFSWRNVQLDGSLIIIAENVMGSTRIDPNGDPILQYG  750

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RC+L+NVKV+N GI+W+  DN+YWKHDV RFE+++VILHGNAEFEA +V +QGN +
Sbjct  751  NRCGRCRLQNVKVVNKGINWSFGDNIYWKHDVQRFEALEVILHGNAEFEADNVTIQGNQI  810

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FE+PDGYKMKIT G+SG +VQLN +E + MDSG+W WNYKI G HIQLELVE
Sbjct  811  FEIPDGYKMKITSGDSGLQVQLNPLEQKIMDSGSWHWNYKIHGPHIQLELVE  862



>gb|KGN45802.1| hypothetical protein Csa_6G012270 [Cucumis sativus]
Length=645

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS GSELQ+EVAEF WR+VQLDGSLI+L+ENVMGS  ++ENGE+++ YG
Sbjct  473  EVTRQKFSGGSISRGSELQVEVAEFLWRNVQLDGSLIVLSENVMGSLKIDENGESLIHYG  532

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+N+KVLN GIDWN  DN+YWK +V R E  K+ILHGNAEFEA  V+LQGNHV
Sbjct  533  QRCGRCKLENIKVLNKGIDWNGEDNVYWKLEVQRHEGCKIILHGNAEFEATGVVLQGNHV  592

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYK+KI+PG SGFE QL+ IE    D+G+W+WNYKI G+HI+LE VE
Sbjct  593  FEVPDGYKLKISPGTSGFEAQLDQIELDKQDTGSWYWNYKIEGSHIKLEYVE  644



>gb|KDP44727.1| hypothetical protein JCGZ_01227 [Jatropha curcas]
Length=881

 Score =   271 bits (692),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            V RQKFH GSISEGSELQ+EVAEF WR+V+LDGSLI++A N+MGST ++ NGE +LQYG 
Sbjct  710  VTRQKFHKGSISEGSELQVEVAEFLWRNVELDGSLIVIAANIMGSTRIDANGEPILQYGH  769

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            RC RC+L+NVKV+N+GIDW+S +N+YWKH V RFE+ KVILHGNAEFEA +V L+GNHVF
Sbjct  770  RCGRCRLQNVKVVNEGIDWSSGENVYWKHKVQRFEACKVILHGNAEFEANNVTLEGNHVF  829

Query  354  EVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            EVPDGYKM++  GNSG EVQLN IE   M SG+WFWNYK+ GT+IQLELVE
Sbjct  830  EVPDGYKMQVKSGNSGLEVQLNRIEPSMMGSGSWFWNYKLKGTNIQLELVE  880



>ref|XP_010105429.1| UDP-sugar pyrophospharylase [Morus notabilis]
 gb|EXC04704.1| UDP-sugar pyrophospharylase [Morus notabilis]
Length=655

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            E+ RQKF+GGSIS+GSELQ+EVAEF WR++QLDGSL+I A++VMGST ++ENGE +LQYG
Sbjct  483  EITRQKFYGGSISKGSELQVEVAEFLWRNIQLDGSLVIEADSVMGSTRIDENGEHILQYG  542

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RC+L+NVKVLN GIDWN  D++YWKH V RFE+ K+ILHGNAEFEA DV +QGNH+
Sbjct  543  HRCGRCRLENVKVLNKGIDWNCGDSVYWKHAVQRFEACKIILHGNAEFEATDVTIQGNHI  602

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYK+K+T  +SG +V+L  I    MDSG+W+WNYKI GTHIQLEL E
Sbjct  603  FEVPDGYKLKVTSESSGMQVKLYPIGKNMMDSGSWYWNYKINGTHIQLELAE  654



>ref|XP_004500507.1| PREDICTED: uncharacterized protein LOC101505226 [Cicer arietinum]
Length=878

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSISEGSELQIEVAEF+WR+VQL+GSL+I+AENVMGS  ++E+G+++L  G
Sbjct  706  EVTRQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLVIIAENVMGSMKIDESGQSILHNG  765

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN GIDW+   N+YWKHDVHR E +++ILHGNAEFEA DV+LQGNHV
Sbjct  766  QRCGRCKLQNVKVLNKGIDWSYGGNVYWKHDVHRSEVLQIILHGNAEFEATDVVLQGNHV  825

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KI PG+ G  +QL+ IE   MDSG+W W+YKI G HI+LELVES
Sbjct  826  FEVPDGYKLKIMPGSPGLAIQLDPIEQGMMDSGSWHWDYKIEGYHIKLELVES  878



>ref|XP_009386480.1| PREDICTED: uncharacterized protein LOC103973588 [Musa acuminata 
subsp. malaccensis]
Length=870

 Score =   268 bits (684),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            E+ RQKF+GGSISEGSELQIEVAEF WR+VQL GSLII+A+N+MGS  +N+N E VL YG
Sbjct  698  EITRQKFYGGSISEGSELQIEVAEFVWRNVQLSGSLIIVADNIMGSARMNQNNEPVLHYG  757

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC+RCKL+NVKVLN GIDW S +N+YWKHDV R E++K+ILHGNAEFEA+DV+LQGNHV
Sbjct  758  QRCARCKLQNVKVLNRGIDWMSSENVYWKHDVQRLETMKIILHGNAEFEAVDVVLQGNHV  817

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYKM I P NSGF ++L+ I    M++G+WFW Y++ GTHI LE+VE
Sbjct  818  FEVPDGYKMCIIPENSGFMIRLDPIREDEMETGSWFWKYEMKGTHINLEMVE  869



>ref|XP_002528323.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34081.1| conserved hypothetical protein [Ricinus communis]
Length=884

 Score =   268 bits (685),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS GSELQ+EVAEF WR+V+LDGSLI++AEN MGST ++ NGE +LQYG
Sbjct  712  EVTRQKFSGGSISRGSELQVEVAEFLWRNVELDGSLIVIAENAMGSTRIHSNGEPILQYG  771

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+N+KVLN GI+W+S +N+YWKH+V RFE+ K+ILHGNAEFEA +V ++GN V
Sbjct  772  HRCGRCKLQNIKVLNQGINWSSGENVYWKHNVQRFEAFKIILHGNAEFEASNVTIEGNQV  831

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYKMKIT G SG +VQLN IE   MDSG+WFWNYK+ GTHI LELVE
Sbjct  832  FEVPDGYKMKITSGYSGLDVQLNTIEPIMMDSGSWFWNYKLNGTHILLELVE  883



>ref|XP_007219560.1| hypothetical protein PRUPE_ppa001281mg [Prunus persica]
 gb|EMJ20759.1| hypothetical protein PRUPE_ppa001281mg [Prunus persica]
Length=864

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+ GSIS+GSELQ+EVAEF WR+VQLDGSLII A+N+MGST +++NGE +LQYG
Sbjct  692  EVTRQKFYEGSISKGSELQVEVAEFLWRNVQLDGSLIIEADNIMGSTKIDQNGEPLLQYG  751

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLN+GIDW   DN+YWKHDV R E+ KV+LHGNAEFEA DVILQGNH+
Sbjct  752  HRCGRCKLQNVKVLNEGIDWTFGDNVYWKHDVQRIEACKVVLHGNAEFEATDVILQGNHI  811

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+ YKMKIT G+SG  V+L+ IE   MDSG+W+W Y I GTHIQLE+VE
Sbjct  812  FEVPNSYKMKITQGDSGLVVRLDPIEQNMMDSGSWYWEYSIKGTHIQLEMVE  863



>ref|XP_004138414.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101221986 
[Cucumis sativus]
Length=865

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS GSELQ+EVAEF WR+VQLDGSLI+L+ENVMGS  ++ENGE+++ YG
Sbjct  693  EVTRQKFSGGSISRGSELQVEVAEFLWRNVQLDGSLIVLSENVMGSLKIDENGESLIHYG  752

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+N+KVLN GIDWN  DN+YWK +V R E  K+ILHGNAEFEA  V+LQGNHV
Sbjct  753  QRCGRCKLENIKVLNKGIDWNGEDNVYWKLEVQRHEGCKIILHGNAEFEATGVVLQGNHV  812

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYK+KI+PG SGFE QL+ IE    D+G+W+WNYKI G+HI+LE VE
Sbjct  813  FEVPDGYKLKISPGTSGFEAQLDQIELDKQDTGSWYWNYKIEGSHIKLEYVE  864



>ref|XP_008233789.1| PREDICTED: uncharacterized protein LOC103332812 [Prunus mume]
Length=864

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+ GSIS+ SELQ+EVAEF WR+VQLDGSLII A+N+MGST +++NGE +LQYG
Sbjct  692  EVTRQKFYEGSISKASELQVEVAEFLWRNVQLDGSLIIEADNIMGSTKIDQNGEPLLQYG  751

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLN+GIDW   DN+YWKHDV R E+ KV+LHGNAEFEA DVILQGNH+
Sbjct  752  HRCGRCKLQNVKVLNEGIDWTFGDNVYWKHDVQRIEACKVVLHGNAEFEATDVILQGNHI  811

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+ YKMKIT G+SG  V+L+ IE   MDSG+W+W Y I GTHIQLE+VE
Sbjct  812  FEVPNSYKMKITQGDSGLVVRLDPIEQNMMDSGSWYWEYSIKGTHIQLEMVE  863



>ref|XP_010257085.1| PREDICTED: uncharacterized protein LOC104597312 isoform X2 [Nelumbo 
nucifera]
Length=872

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+ GSIS+GSELQ+EVAEF WRDVQLDGSLI++AEN+MGST ++E GE +L YG
Sbjct  703  EVTRQKFYRGSISDGSELQVEVAEFLWRDVQLDGSLIVVAENIMGSTRIDEAGEPILIYG  762

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLN GIDW+S +N+YWK DV RFE++KVILHGNAEFEA DV+LQGNHV
Sbjct  763  HRCGRCKLQNVKVLNRGIDWSSSENIYWKLDVQRFEALKVILHGNAEFEAKDVVLQGNHV  822

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKM+IT GNS   V+L+ IE   MD G+WFW YK+ GTHIQLE++E
Sbjct  823  FEVPNGYKMQITAGNS---VRLDPIEKGMMDCGSWFWKYKLRGTHIQLEMIE  871



>ref|XP_008441479.1| PREDICTED: UDP-sugar pyrophosphorylase [Cucumis melo]
Length=870

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS GSELQ+EVAEF WR+VQLDGSLI+L+ENVMGS  ++ENGE+++ YG
Sbjct  698  EVTRQKFSGGSISRGSELQVEVAEFLWRNVQLDGSLIVLSENVMGSLKIDENGESLIHYG  757

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL++VKVLN GIDWN  DN+YWK +V R E  K+ILHGNAEFEA  V+LQGNHV
Sbjct  758  QRCGRCKLEDVKVLNKGIDWNVEDNIYWKLEVQRHEGCKIILHGNAEFEATGVVLQGNHV  817

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYK+KI PG SGFE QL  IE    D+G+W+WNYKI G+HI+LE VE
Sbjct  818  FEVPDGYKLKIAPGTSGFEAQLGQIELDKQDTGSWYWNYKIEGSHIKLEYVE  869



>ref|XP_010031181.1| PREDICTED: uncharacterized protein LOC104421052 [Eucalyptus grandis]
Length=876

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV+RQKF GGSIS+GSEL +EVAEF WRDVQL+GSLII AENVMGST + +NG+ +LQYG
Sbjct  704  EVLRQKFCGGSISKGSELIVEVAEFLWRDVQLEGSLIIEAENVMGSTGIGKNGDLILQYG  763

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLN+GIDWN   N++WKHDV R ES+KVILHGNAEFEA DV  QGNHV
Sbjct  764  HRCGRCKLQNVKVLNEGIDWNFSGNVFWKHDVQRSESLKVILHGNAEFEATDVSFQGNHV  823

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+KMKITPG SGF VQL  +    +DSG+W+W YKI G HI LELVE
Sbjct  824  FEVPDGHKMKITPGISGFSVQLETLAPNMVDSGSWYWKYKINGKHIGLELVE  875



>gb|KDO68902.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=862

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGS+S+GSELQIEVAEF WR+  LDGSLII+AENVMGST + +NGE++LQYG
Sbjct  692  EVTRQKFKGGSVSKGSELQIEVAEFLWRN--LDGSLIIVAENVMGSTRIADNGESILQYG  749

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEFEA DV LQGNHV
Sbjct  750  YRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEFEASDVTLQGNHV  809

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI LELVE
Sbjct  810  FEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVLELVE  861



>gb|KCW50445.1| hypothetical protein EUGRSUZ_J00183 [Eucalyptus grandis]
Length=917

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV+RQKF GGSIS+GSEL +EVAEF WRDVQL+GSLII AENVMGST + +NG+ +LQYG
Sbjct  745  EVLRQKFCGGSISKGSELIVEVAEFLWRDVQLEGSLIIEAENVMGSTGIGKNGDLILQYG  804

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLN+GIDWN   N++WKHDV R ES+KVILHGNAEFEA DV  QGNHV
Sbjct  805  HRCGRCKLQNVKVLNEGIDWNFSGNVFWKHDVQRSESLKVILHGNAEFEATDVSFQGNHV  864

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+KMKITPG SGF VQL  +    +DSG+W+W YKI G HI LELVE
Sbjct  865  FEVPDGHKMKITPGISGFSVQLETLAPNMVDSGSWYWKYKINGKHIGLELVE  916



>gb|KJB74378.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=869

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+GSELQ+EVAEF WR++QLDGS+II+AEN+MGST +++ GE +LQ+G
Sbjct  697  EVTRQKFSGGSISKGSELQVEVAEFLWRNIQLDGSMIIVAENIMGSTRIDDKGELILQHG  756

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NV VLNDG+DW S DN+YWKHD+ R E++KVILHGNAEFEA +VI+QGNHV
Sbjct  757  HRCGRCKLCNVTVLNDGVDWTSGDNVYWKHDIRRSEALKVILHGNAEFEAYNVIIQGNHV  816

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYKMKIT G+SG  VQ++ I    MD+G+WFW Y   G+HI LELVE
Sbjct  817  FEVPDGYKMKITAGDSGLVVQMDLIPQNLMDNGSWFWKYDTKGSHILLELVE  868



>ref|XP_004307650.1| PREDICTED: uncharacterized protein LOC101304420 [Fragaria vesca 
subsp. vesca]
Length=876

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSI +GSELQ+EVAEF WR+VQLDGSLII A+NVMGS+ ++E+GE +LQYG
Sbjct  704  EVTRQKFYGGSIRKGSELQVEVAEFLWRNVQLDGSLIIEADNVMGSSRVDEDGEPILQYG  763

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RC+L+NV+V N+GIDWN  DN+YWK+DV R E+ KV+LHGNAEFEA DVIL+GNH+
Sbjct  764  HRCGRCRLQNVRVSNEGIDWNFEDNIYWKNDVQRIEACKVVLHGNAEFEATDVILKGNHI  823

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP+GYKMKI PG+SG  + L+ I    MDSG+W+W Y I  THIQLELVE
Sbjct  824  FEVPNGYKMKIMPGDSGLAIGLDPIAENMMDSGSWYWKYGINDTHIQLELVE  875



>ref|XP_003600957.1| hypothetical protein MTR_3g071440 [Medicago truncatula]
 gb|AES71208.1| UDP-glucose pyrophosphorylase [Medicago truncatula]
Length=868

 Score =   259 bits (663),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS+GSELQIEVAE +WR+VQ++GSL+I AEN+MGS  ++E+GE++L +G
Sbjct  696  EVTRQKFNGGSISKGSELQIEVAELFWRNVQVNGSLVIKAENIMGSMKIDESGESILHHG  755

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN+GIDW+   N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  756  QRCGRCKLQNVKVLNEGIDWSYGGNVYWKHDVKRSEVLQIILHGNAEFEATDVVLQGNHV  815

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KI PG+ G  +QL+ IE   MDSG+W W+YKI G+HI+LE VES
Sbjct  816  FEVPDGYKLKIMPGSPGLAIQLDPIEEGMMDSGSWHWDYKIEGSHIKLEFVES  868



>gb|KEH34804.1| UDP-glucose pyrophosphorylase [Medicago truncatula]
Length=863

 Score =   259 bits (663),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSIS+GSELQIEVAE +WR+VQ++GSL+I AEN+MGS  ++E+GE++L +G
Sbjct  691  EVTRQKFNGGSISKGSELQIEVAELFWRNVQVNGSLVIKAENIMGSMKIDESGESILHHG  750

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC RCKL+NVKVLN+GIDW+   N+YWKHDV R E +++ILHGNAEFEA DV+LQGNHV
Sbjct  751  QRCGRCKLQNVKVLNEGIDWSYGGNVYWKHDVKRSEVLQIILHGNAEFEATDVVLQGNHV  810

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPDGYK+KI PG+ G  +QL+ IE   MDSG+W W+YKI G+HI+LE VES
Sbjct  811  FEVPDGYKLKIMPGSPGLAIQLDPIEEGMMDSGSWHWDYKIEGSHIKLEFVES  863



>ref|XP_007008906.1| UDP-glucose pyrophosphorylase 3 isoform 3, partial [Theobroma 
cacao]
 gb|EOY17716.1| UDP-glucose pyrophosphorylase 3 isoform 3, partial [Theobroma 
cacao]
Length=876

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+GSELQIEVAEF WR+VQL+GS+II A+N+MGST ++ENGE  L+YG
Sbjct  704  EVTRQKFSGGSISKGSELQIEVAEFLWRNVQLEGSMIIAADNIMGSTRVDENGEPTLRYG  763

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             R  RCKL NVKVLNDGIDW+S DN+YWKHDV RFE++KVILHGNAEFEA +V +QGNH+
Sbjct  764  HRYGRCKLHNVKVLNDGIDWSSGDNVYWKHDVRRFEALKVILHGNAEFEASNVTIQGNHL  823

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGY+MKIT G+ G  +QL+ +    MD G+WFW Y I G HI LEL+E
Sbjct  824  FEVPDGYRMKITSGDPGLALQLDPLPQSLMDRGSWFWKYNINGCHILLELIE  875



>gb|KHG20503.1| UDP-sugar pyrophospharylase [Gossypium arboreum]
Length=875

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+GSELQ+EVAEF WR+VQLDGS+II+AEN++GS  +++ GE +LQ+G
Sbjct  703  EVTRQKFSGGSISKGSELQVEVAEFLWRNVQLDGSMIIVAENIIGSIRIDDKGEPILQHG  762

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NV VLNDGIDW S DN+YWKHD+ R E++KVILHGNAEFEA +VI+QGNHV
Sbjct  763  HRCGRCKLCNVTVLNDGIDWTSGDNVYWKHDICRSEALKVILHGNAEFEAYNVIIQGNHV  822

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDGYKMKIT G+SG  VQ++ I    MD+G+WFW Y   G+HI LELVE
Sbjct  823  FEVPDGYKMKITSGDSGLVVQMDLIPQNLMDNGSWFWKYDTNGSHILLELVE  874



>ref|XP_010693077.1| PREDICTED: uncharacterized protein LOC104906066 [Beta vulgaris 
subsp. vulgaris]
Length=875

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKFHGGSIS+GSELQIE+AEF+W+DVQL+GSLII+A+NVMG+   +++GE +L+YG
Sbjct  703  EVSRQKFHGGSISKGSELQIEIAEFFWKDVQLNGSLIIVADNVMGAMKADKSGEPLLEYG  762

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC+RCKL+NV+VLN GIDW S  N+YW+H+VHR E +KV+LHGNAEFEA+DV L+GNHV
Sbjct  763  HRCARCKLQNVRVLNKGIDWESGLNMYWRHEVHRNECLKVMLHGNAEFEAIDVTLEGNHV  822

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+++KIT  NSG   QL  IE+   DSG+W+W YK+ G H++LE+VE
Sbjct  823  FEVPDGHRLKITSTNSGISKQLGPIEDSKKDSGSWYWKYKMDGAHVKLEMVE  874



>ref|XP_008811681.1| PREDICTED: uncharacterized protein LOC103722778 isoform X3 [Phoenix 
dactylifera]
Length=841

 Score =   253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            E+ RQKF GGSIS+GSELQIEVAEF WRDVQL+GSLII+AEN+MGS  +++NGE VLQYG
Sbjct  669  EITRQKFFGGSISKGSELQIEVAEFLWRDVQLEGSLIIVAENIMGSIRMSQNGEPVLQYG  728

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GIDW S +N+YWKHDV R E +K+ILHGNAEFEA DV+LQG+HV
Sbjct  729  DRCGRCKLQNVKVQNKGIDWTSPNNVYWKHDVQRLECLKIILHGNAEFEATDVVLQGSHV  788

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP G +M I+   +G   +L  I    MDSG+WFW YKI GTHI LE++E
Sbjct  789  FEVPSGCRMCISSDTTGIVGKLEPIREDLMDSGSWFWKYKIKGTHIHLEMIE  840



>ref|XP_008811677.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811678.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811679.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
Length=867

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            E+ RQKF GGSIS+GSELQIEVAEF WRDVQL+GSLII+AEN+MGS  +++NGE VLQYG
Sbjct  695  EITRQKFFGGSISKGSELQIEVAEFLWRDVQLEGSLIIVAENIMGSIRMSQNGEPVLQYG  754

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GIDW S +N+YWKHDV R E +K+ILHGNAEFEA DV+LQG+HV
Sbjct  755  DRCGRCKLQNVKVQNKGIDWTSPNNVYWKHDVQRLECLKIILHGNAEFEATDVVLQGSHV  814

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP G +M I+   +G   +L  I    MDSG+WFW YKI GTHI LE++E
Sbjct  815  FEVPSGCRMCISSDTTGIVGKLEPIREDLMDSGSWFWKYKIKGTHIHLEMIE  866



>ref|XP_010907871.1| PREDICTED: uncharacterized protein LOC105034415 [Elaeis guineensis]
Length=868

 Score =   251 bits (642),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            E+ RQKF GGSIS+GSELQIEVAEF WRDVQL+GSLII+AEN+MGS  +++NGE  LQYG
Sbjct  696  EITRQKFFGGSISKGSELQIEVAEFLWRDVQLEGSLIIVAENIMGSIRMSQNGEPTLQYG  755

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GIDW S +N+YWKHDV R E +K+ILHGNAEFEA DV+LQG+HV
Sbjct  756  NRCGRCKLQNVKVQNKGIDWTSSNNVYWKHDVQRLECLKIILHGNAEFEATDVVLQGSHV  815

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP GY+M I+   +G  V+L  I    MD+G+WFW YKI GTHI LE++E
Sbjct  816  FEVPSGYRMCISSDTTGNIVKLEHIREDLMDNGSWFWKYKIKGTHIYLEMIE  867



>ref|XP_010427407.1| PREDICTED: uncharacterized protein LOC104712252 [Camelina sativa]
Length=310

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST +N++GE +LQYG
Sbjct  135  EVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTTINDHGEPILQYG  194

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++GNHV
Sbjct  195  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTVEGNHV  254

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+ MKIT GN+G  + L A++   +++G+W+W+Y++ G+HI L+ VE
Sbjct  255  FEVPDGHIMKITQGNAGLSINLEAMKEGVLETGSWYWDYQLNGSHIHLQQVE  306



>ref|XP_006655397.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Oryza brachyantha]
Length=818

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            +++RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MG T  N  GE ++ YG
Sbjct  646  DIMRQKFVGGSVSQGSELQIEVAEFLWKDVELDGSLIVLADNIMGLTKKNNTGEQIMHYG  705

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL++VK++N+GI+W+S +N+YWKHDV R ESVK+ILHGNAEFEA DV+LQGNH+
Sbjct  706  TRCGRCKLRSVKIVNEGINWSSANNVYWKHDVERSESVKIILHGNAEFEAKDVVLQGNHI  765

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP G++M+I    +GF V+L+ I    MDSGTW+W Y + G H++LE+VE
Sbjct  766  FEVPSGHRMRIIQEAAGFVVKLDPISEEVMDSGTWYWKYAVDGAHVKLEMVE  817



>ref|XP_008656382.1| PREDICTED: uncharacterized protein LOC103635785 isoform X1 [Zea 
mays]
Length=872

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++IRQKF GGS+S+GSELQIEVAEF W+DV+LDGS IILA+NVMGST  ++NGE +L YG
Sbjct  700  DIIRQKFVGGSVSKGSELQIEVAEFLWKDVELDGSFIILADNVMGSTKNSKNGEQILHYG  759

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RC+L++VK++N+GI+W S +N+YWKHDV R ESVK+ILHGNAEFEA DV+L+GNHV
Sbjct  760  SRCGRCRLQSVKIVNEGINWTSPNNVYWKHDVERSESVKIILHGNAEFEAKDVVLKGNHV  819

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG++M I    +GF V+L+ I +  MDSGTW W Y + G H++L +VE
Sbjct  820  FEVPDGHRMCIIQDRAGFVVKLDLIRDELMDSGTWHWKYAVDGVHVKLNMVE  871



>ref|XP_006403031.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
 gb|ESQ44484.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
Length=886

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AE  W +VQ+DGSLII AEN MGST +NENGE +LQYG
Sbjct  711  EVSRQKFKGGSISNCSELQLEIAEVSWNNVQVDGSLIITAENAMGSTTINENGEPILQYG  770

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDW S+ N+YW++DV+R E+ K+ILHGNAEFEA +V +QGN V
Sbjct  771  LRCGKCKLHNVKVVNQGIDWKSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIQGNQV  830

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+++KIT GNSG  + L AI    M++G+W+WNY++ G+HI LE VE
Sbjct  831  FEVPDGHRLKITQGNSGLSINLEAIREEVMETGSWYWNYQLDGSHINLEQVE  882



>gb|EMS56381.1| hypothetical protein TRIUR3_23522 [Triticum urartu]
Length=630

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++I+QKF GGSIS+GSELQIEVAEF W+DV+LDGSLIILA+N+MGST  N +GE +L YG
Sbjct  458  DIIKQKFIGGSISKGSELQIEVAEFLWQDVELDGSLIILADNIMGSTKRNTDGEQILHYG  517

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVK++N+GI W+S  N+YWKH V R ES+K+ILHGNAEFEA D++L+GNH+
Sbjct  518  ARCGRCKLQNVKIVNEGISWDSPINVYWKHHVERSESLKIILHGNAEFEAKDILLKGNHM  577

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG++M I    +GF V+L+ I    MDSGTW+W Y + G H++L +V+
Sbjct  578  FEVPDGHRMCIIQDEAGFVVKLDPISKEMMDSGTWYWEYTVDGAHVKLNMVD  629



>ref|XP_010554677.1| PREDICTED: uncharacterized protein LOC104824329 [Tarenaya hassleriana]
Length=877

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+ SELQ+E+AEF W +V++DGSLII AEN MGST ++EN E +LQYG
Sbjct  697  EVSRQKFSGGSISKCSELQLEIAEFSWSNVEVDGSLIIRAENAMGSTRIDENEEPILQYG  756

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC +CKL NVKV+N GIDWN   N+YWKH+V R E+ K++LHGNAEFEA++V +QG HV
Sbjct  757  QRCGKCKLHNVKVVNRGIDWNCEANVYWKHEVCRLETCKIVLHGNAEFEAVNVTIQGGHV  816

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVES  199
            FEVPD +++KITPGNSG  + L  I+   M++GTW+W Y++ GTH+Q+E  E 
Sbjct  817  FEVPDSHRLKITPGNSGLNIDLEPIKQELMETGTWYWKYQLKGTHVQIEQAEP  869



>ref|XP_010536381.1| PREDICTED: uncharacterized protein LOC104811372 [Tarenaya hassleriana]
Length=896

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV+RQKF  GSIS+ SELQ+EVAEF+W +VQ+DGSLI++AEN MGST +NENGE +L YG
Sbjct  719  EVMRQKFSRGSISKCSELQLEVAEFWWNNVQVDGSLIVMAENAMGSTRINENGEPILHYG  778

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL+NV++LN GIDWN + N+YWKH VHR E+ K++LHGNAEFEA +V +QG+ V
Sbjct  779  HRCGKCKLQNVEILNRGIDWNCKTNVYWKHHVHRLETCKIVLHGNAEFEASNVTIQGDQV  838

Query  357  FEVPDGYKMKITPGNS-GFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLE  211
            FEVPDG+++KITP NS G +++L  I+   M SGTW W YK+ GTHIQL+
Sbjct  839  FEVPDGHRLKITPANSGGVDMKLEPIKEELMSSGTWGWKYKLQGTHIQLQ  888



>emb|CAB87858.1| putative protein [Arabidopsis thaliana]
Length=871

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AEF W +VQ+DGSLI+ AEN MGST  N+NGE +LQYG
Sbjct  696  EVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIVTAENAMGSTTPNDNGEPILQYG  755

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NV V+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++G+HV
Sbjct  756  LRCGKCKLHNVNVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIEGHHV  815

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KIT GN+G  + L A++   M++G+W+WNY++ G+HI L+ VE
Sbjct  816  FEVPDGHKLKITSGNAGLSINLEALKEEVMETGSWYWNYQLNGSHIHLQQVE  867



>ref|NP_567031.1| UDP-glucose pyrophosphorylase 3 [Arabidopsis thaliana]
 gb|AEE79469.1| UDP-glucose pyrophosphorylase 3 [Arabidopsis thaliana]
Length=883

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AEF W +VQ+DGSLI+ AEN MGST  N+NGE +LQYG
Sbjct  708  EVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIVTAENAMGSTTPNDNGEPILQYG  767

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NV V+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++G+HV
Sbjct  768  LRCGKCKLHNVNVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIEGHHV  827

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KIT GN+G  + L A++   M++G+W+WNY++ G+HI L+ VE
Sbjct  828  FEVPDGHKLKITSGNAGLSINLEALKEEVMETGSWYWNYQLNGSHIHLQQVE  879



>gb|KFK34847.1| hypothetical protein AALP_AA5G200800 [Arabis alpina]
Length=870

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AEF W +VQ+DGSLII AEN MGS  L++NGE +LQYG
Sbjct  695  EVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIISAENAMGSATLHKNGEPILQYG  754

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHG+AEFEA +V +QGN V
Sbjct  755  LRCGRCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGDAEFEASNVTIQGNQV  814

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+++KIT GNSG  + L A++   M++G+W+WNY++ G+HI LE V+
Sbjct  815  FEVPDGHRLKITRGNSGLCINLEAMKEEIMETGSWYWNYQLNGSHIHLEQVQ  866



>ref|XP_002878057.1| hypothetical protein ARALYDRAFT_486043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54316.1| hypothetical protein ARALYDRAFT_486043 [Arabidopsis lyrata subsp. 
lyrata]
Length=883

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AEF W +VQ+DGSLII AEN MGST  N+NGE +LQYG
Sbjct  708  EVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIITAENAMGSTTPNDNGEPILQYG  767

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NV+V+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++ +HV
Sbjct  768  LRCGKCKLHNVRVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVAIEEHHV  827

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+K+KITPGN+G  + L  ++    ++G+W+WNY++ G+HI L+ VE
Sbjct  828  FEVPDGHKLKITPGNAGLSINLETLKEEVKETGSWYWNYQLNGSHIHLQQVE  879



>ref|XP_009116298.1| PREDICTED: uncharacterized protein LOC103841505 isoform X2 [Brassica 
rapa]
Length=872

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AEF W +V++DGSL+I AEN MGST +NE GE +LQYG
Sbjct  696  EVSRQKFKGGSISSCSELQLEIAEFSWNNVEVDGSLVINAENAMGSTTINEKGEPILQYG  755

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++GNHV
Sbjct  756  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIEGNHV  815

Query  357  FEVPDGYKMKITPGNS-GFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  205
            FEVPDG+++KIT G S G  + L AIE    ++G+W+WNYK+ G+HIQLE V
Sbjct  816  FEVPDGHRLKITRGRSPGLSINLEAIEEEVRETGSWYWNYKLNGSHIQLEQV  867



>ref|XP_009116297.1| PREDICTED: uncharacterized protein LOC103841505 isoform X1 [Brassica 
rapa]
Length=874

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AEF W +V++DGSL+I AEN MGST +NE GE +LQYG
Sbjct  696  EVSRQKFKGGSISSCSELQLEIAEFSWNNVEVDGSLVINAENAMGSTTINEKGEPILQYG  755

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++GNHV
Sbjct  756  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIEGNHV  815

Query  357  FEVPDGYKMKITPG---NSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  205
            FEVPDG+++KIT G   +SG  + L AIE    ++G+W+WNYK+ G+HIQLE V
Sbjct  816  FEVPDGHRLKITRGRSPDSGLSINLEAIEEEVRETGSWYWNYKLNGSHIQLEQV  869



>emb|CDY66808.1| BnaA09g55090D [Brassica napus]
Length=866

 Score =   238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AEF W +V++DGSL+I AEN MGST +NE GE +LQYG
Sbjct  688  EVSRQKFKGGSISSCSELQLEIAEFSWNNVEVDGSLVINAENAMGSTTINEKGEPILQYG  747

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++GNHV
Sbjct  748  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIEGNHV  807

Query  357  FEVPDGYKMKITPG---NSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  205
            FEVPDG+++KIT G   +SG  + L AIE    ++G+W+WNYK+ G+HIQLE V
Sbjct  808  FEVPDGHRLKITRGRSPDSGLSINLEAIEEEVRETGSWYWNYKLNGSHIQLEQV  861



>ref|XP_006403032.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
 gb|ESQ44485.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
Length=888

 Score =   238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AE  W +VQ+DGSLII AEN MGST +NENGE +LQYG
Sbjct  711  EVSRQKFKGGSISNCSELQLEIAEVSWNNVQVDGSLIITAENAMGSTTINENGEPILQYG  770

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDW S+ N+YW++DV+R E+ K+ILHGNAEFEA +V +QGN V
Sbjct  771  LRCGKCKLHNVKVVNQGIDWKSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIQGNQV  830

Query  357  FEVPDGYKMKITPGNS--GFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+++KIT GNS  G  + L AI    M++G+W+WNY++ G+HI LE VE
Sbjct  831  FEVPDGHRLKITQGNSDLGLSINLEAIREEVMETGSWYWNYQLDGSHINLEQVE  884



>gb|AAT47007.1| unknown protein [Oryza sativa Japonica Group]
Length=808

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++ RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MGST  N  GE ++ YG
Sbjct  636  DITRQKFVGGSVSQGSELQIEVAEFLWQDVELDGSLIVLADNIMGSTNKNNTGEQIMHYG  695

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL++VK++N GI+W+S +N+YWKHDV R ESVK+ILH NAEFEA DV+L+GNH+
Sbjct  696  ARCGRCKLQSVKIVNKGINWSSANNVYWKHDVERSESVKIILHENAEFEAKDVVLKGNHI  755

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP G++M+I      F  +L+ I    MDSGTW+W Y + G H++LE+VE
Sbjct  756  FEVPTGHRMRIVQDGPEFVAKLDPISKEMMDSGTWYWKYAVDGAHVKLEMVE  807



>ref|XP_010516200.1| PREDICTED: uncharacterized protein LOC104791893 [Camelina sativa]
Length=885

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST +N++GE +LQYG
Sbjct  710  EVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTTINDHGEPILQYG  769

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++GNHV
Sbjct  770  LRCGKCKLHNVKVMNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIEGNHV  829

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+ +KIT GN+G  + L A++   +++G+W+W+YK+ G+HI L+ VE
Sbjct  830  FEVPDGHILKITQGNAGLSIHLEAMKEEVLETGSWYWDYKLNGSHIHLQQVE  881



>gb|AFW82285.1| hypothetical protein ZEAMMB73_228026 [Zea mays]
Length=964

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++IRQKF GGS+S+GSELQIEVAEF W+DV+LDGS IILA+NVMGST  ++NGE +L YG
Sbjct  777  DIIRQKFVGGSVSKGSELQIEVAEFLWKDVELDGSFIILADNVMGSTKNSKNGEQILHYG  836

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RC+L++VK++N+GI+W S +N+YWKHDV R ESVK+ILHGNAEFEA DV+L+GNHV
Sbjct  837  SRCGRCRLQSVKIVNEGINWTSPNNVYWKHDVERSESVKIILHGNAEFEAKDVVLKGNHV  896

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTH  223
            FEVPDG++M I    +GF V+L+ I +  MDSGTW W Y + G H
Sbjct  897  FEVPDGHRMCIIQDRAGFVVKLDLIRDELMDSGTWHWKYAVDGVH  941



>ref|XP_003566160.2| PREDICTED: UDP-sugar pyrophosphorylase [Brachypodium distachyon]
Length=865

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++I+QKF GGSIS+GSELQIEVAEF W++V+LDGSLII+A+N+MGST  N +GE +L YG
Sbjct  693  DIIKQKFVGGSISKGSELQIEVAEFLWKNVELDGSLIIVADNIMGSTKRNTHGEQILHYG  752

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             R  RCKL+NVK++N+GI+W S  N+YWKHDV R ES+K+ILHGNAEFEA DV+L+GN++
Sbjct  753  ARSGRCKLQNVKIVNEGINWGSPSNVYWKHDVERSESLKIILHGNAEFEAKDVLLKGNNM  812

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG++M +    +GF V+L+ I N SMDSGTW+W Y++ G  ++L +V+
Sbjct  813  FEVPDGHRMCLIQDKAGFAVKLDPISNESMDSGTWYWQYRVDGAQVKLNIVD  864



>gb|EEE64040.1| hypothetical protein OsJ_18869 [Oryza sativa Japonica Group]
Length=1033

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = -3

Query  717   EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
             ++ RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MGST  N  GE ++ YG
Sbjct  861   DITRQKFVGGSVSQGSELQIEVAEFLWQDVELDGSLIVLADNIMGSTNKNNTGEQIMHYG  920

Query  537   KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
              RC RCKL++VK++N GI+W+S +N+YWKHDV R ESVK+ILH NAEFEA DV+L+GNH+
Sbjct  921   ARCGRCKLQSVKIVNKGINWSSANNVYWKHDVERSESVKIILHENAEFEAKDVVLKGNHI  980

Query  357   FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
             FEVP G++M+I      F  +L+ I    MDSGTW+W Y + G H++LE+VE
Sbjct  981   FEVPTGHRMRIVQDGPEFVAKLDPISKEMMDSGTWYWKYAVDGAHVKLEMVE  1032



>dbj|BAJ85276.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=854

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++++QKF GGSI++GSELQIEVAEF W DV+LDGSLIILA+N+MGST  N +GE +L YG
Sbjct  682  DIVKQKFIGGSIAKGSELQIEVAEFLWEDVELDGSLIILADNIMGSTKRNTDGEQILHYG  741

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVK++N+GI+W+S  N+YWKH V R ES+K+ILHGNAEFEA DV L+GNH+
Sbjct  742  ARCGRCKLQNVKIVNEGINWDSPSNVYWKHHVERSESLKIILHGNAEFEAKDVFLKGNHM  801

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG++M +    +GF  +L+ I   +MDSG+W+W Y + G H++L +VE
Sbjct  802  FEVPDGHRMCVFQDEAGFVGKLDPISKETMDSGSWYWEYSVDGAHVKLNMVE  853



>emb|CDX72178.1| BnaC08g26960D [Brassica napus]
Length=867

 Score =   235 bits (599),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 139/174 (80%), Gaps = 3/174 (2%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SELQ+E+AEF W +V++ GSLII AEN MGST +NE  E +LQYG
Sbjct  689  EVSRQKFKGGSISSCSELQLEIAEFSWNNVEVHGSLIINAENAMGSTTINEKAEPILQYG  748

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++GNHV
Sbjct  749  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTIEGNHV  808

Query  357  FEVPDGYKMKITPG---NSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  205
            FEVPDG+++KIT G   +SG  + L AIE   M++G+W+WNYK+ G+HI+LE V
Sbjct  809  FEVPDGHRLKITRGRSPDSGLSINLEAIEEEVMETGSWYWNYKLNGSHIRLEQV  862



>gb|EEC79378.1| hypothetical protein OsI_20285 [Oryza sativa Indica Group]
Length=860

 Score =   235 bits (599),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++ RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MGST  N  GE ++ YG
Sbjct  688  DITRQKFVGGSVSQGSELQIEVAEFLWQDVELDGSLIVLADNIMGSTNKNNTGEQIMHYG  747

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL++VK++N GI+W+S +N+YWKHDV R ESVK+ILH NAEFEA DV+L+GNH+
Sbjct  748  ARCGRCKLRSVKIVNKGINWSSANNVYWKHDVERSESVKIILHENAEFEAKDVVLKGNHI  807

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP G++M+I      F  +L+ I    MD GTW+W Y + G H++LE+VE
Sbjct  808  FEVPTGHRMRIVQDGPEFVAKLDPISKEMMDGGTWYWKYAVDGAHVKLEMVE  859



>ref|XP_010427408.1| PREDICTED: uncharacterized protein LOC104712253 [Camelina sativa]
Length=889

 Score =   235 bits (599),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST +N++GE +LQYG
Sbjct  714  EVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTTINDHGEPILQYG  773

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++GNHV
Sbjct  774  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTVEGNHV  833

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+ MKIT GN+G  + L A++   +++G+W+W+Y++ G+HI L+ VE
Sbjct  834  FEVPDGHIMKITQGNAGLSINLEAMKEGVLETGSWYWDYQLNGSHIHLQQVE  885



>ref|XP_006292431.1| hypothetical protein CARUB_v10018646mg [Capsella rubella]
 gb|EOA25329.1| hypothetical protein CARUB_v10018646mg [Capsella rubella]
Length=879

 Score =   233 bits (595),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLI+ AEN MGST +N++GE +LQYG
Sbjct  704  EVSRQKFMGGSISSCSEVQLEIAELSWNNVQVDGSLIVTAENAMGSTTINDHGEQILQYG  763

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEFEA +V ++GNHV
Sbjct  764  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTVEGNHV  823

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+ +KIT GN+G  + L A++   +++G+W+W+Y++ G+HI L+ VE
Sbjct  824  FEVPDGHILKITQGNAGLSINLEAMKEEVLETGSWYWDYQLNGSHIHLQQVE  875



>ref|XP_006847401.1| hypothetical protein AMTR_s00153p00036670 [Amborella trichopoda]
 gb|ERN08982.1| hypothetical protein AMTR_s00153p00036670 [Amborella trichopoda]
Length=904

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKFHGG IS+GSELQIE+ EF WR+V+L+GSLII+AENV+GS   +ENG+ ++ YG
Sbjct  732  EVTRQKFHGGQISKGSELQIELTEFSWRNVELNGSLIIVAENVLGSVQTDENGDPLIHYG  791

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RC L+N+ ++N GIDWN   N YWKH+V RFE +KV+LHGNAE EA DV ++GNH 
Sbjct  792  YRCGRCLLENIMIINKGIDWNCPGNTYWKHEVQRFECLKVVLHGNAELEAKDVTIEGNHT  851

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  205
            FEVP+GY+++IT GN+G   ++  I+   MD+G+WFW Y +  +HI LE+V
Sbjct  852  FEVPNGYRLQITGGNAGLSCKMIPIQTEMMDTGSWFWKYGLKDSHIHLEMV  902



>gb|KDO68903.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=834

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST + +NGE++LQYG
Sbjct  692  EVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTRIADNGESILQYG  751

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEFEA DV LQGNHV
Sbjct  752  YRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEFEASDVTLQGNHV  811

Query  357  FEVPDGYKMKITPGNSGF  304
            FEVPDG+K+KIT GNSGF
Sbjct  812  FEVPDGHKLKITSGNSGF  829



>ref|XP_010504481.1| PREDICTED: uncharacterized protein LOC104781493 isoform X2 [Camelina 
sativa]
Length=885

 Score =   227 bits (578),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 137/172 (80%), Gaps = 1/172 (1%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST +N++GE +LQYG
Sbjct  711  EVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTTINDHGEPILQYG  770

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R ES K+ILHGNAEFEA +V ++GNHV
Sbjct  771  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLESCKIILHGNAEFEASNVTVEGNHV  830

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+ +KIT GN+   + L A++    + G+W+W+YK+ G+HI L+ VE
Sbjct  831  FEVPDGHILKITQGNAVL-INLEAMKEEVSEKGSWYWDYKLNGSHIHLQQVE  881



>ref|XP_010257086.1| PREDICTED: uncharacterized protein LOC104597312 isoform X3 [Nelumbo 
nucifera]
Length=855

 Score =   226 bits (577),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+ GSIS+GSELQ+EVAEF WRDVQLDGSLI++AEN+MGST ++E GE +L YG
Sbjct  703  EVTRQKFYRGSISDGSELQVEVAEFLWRDVQLDGSLIVVAENIMGSTRIDEAGEPILIYG  762

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKVLN GIDW+S +N+YWK DV RFE++KVILHGNAEFEA DV+LQGNHV
Sbjct  763  HRCGRCKLQNVKVLNRGIDWSSSENIYWKLDVQRFEALKVILHGNAEFEAKDVVLQGNHV  822

Query  357  FEVPDGYKMKITPGNSG  307
            FEVP+GYKM+IT GNSG
Sbjct  823  FEVPNGYKMQITAGNSG  839



>ref|XP_010504480.1| PREDICTED: uncharacterized protein LOC104781493 isoform X1 [Camelina 
sativa]
Length=885

 Score =   226 bits (577),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 137/172 (80%), Gaps = 1/172 (1%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST +N++GE +LQYG
Sbjct  711  EVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTTINDHGEPILQYG  770

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC +CKL NVKV+N GIDWNS+ N+YW++DV+R ES K+ILHGNAEFEA +V ++GNHV
Sbjct  771  LRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLESCKIILHGNAEFEASNVTVEGNHV  830

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVPDG+ +KIT GN+   + L A++    + G+W+W+YK+ G+HI L+ VE
Sbjct  831  FEVPDGHILKITQGNAVL-INLEAMKEEVSEKGSWYWDYKLNGSHIHLQQVE  881



>ref|XP_008811680.1| PREDICTED: uncharacterized protein LOC103722778 isoform X2 [Phoenix 
dactylifera]
Length=857

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 129/172 (75%), Gaps = 10/172 (6%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            E+ RQKF GGSIS+GSELQIE          L+GSLII+AEN+MGS  +++NGE VLQYG
Sbjct  695  EITRQKFFGGSISKGSELQIE----------LEGSLIIVAENIMGSIRMSQNGEPVLQYG  744

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             RC RCKL+NVKV N GIDW S +N+YWKHDV R E +K+ILHGNAEFEA DV+LQG+HV
Sbjct  745  DRCGRCKLQNVKVQNKGIDWTSPNNVYWKHDVQRLECLKIILHGNAEFEATDVVLQGSHV  804

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            FEVP G +M I+   +G   +L  I    MDSG+WFW YKI GTHI LE++E
Sbjct  805  FEVPSGCRMCISSDTTGIVGKLEPIREDLMDSGSWFWKYKIKGTHIHLEMIE  856



>ref|NP_001055800.2| Os05g0468600 [Oryza sativa Japonica Group]
 dbj|BAF17714.2| Os05g0468600 [Oryza sativa Japonica Group]
Length=850

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 135/179 (75%), Gaps = 8/179 (4%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++ RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MGST  N  GE ++ Y 
Sbjct  641  DITRQKFVGGSVSQGSELQIEVAEFLWQDVELDGSLIVLADNIMGSTNKNNTGEQIMHYD  700

Query  537  K--------RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMD  382
            +        RC RCKL++VK++N GI+W+S +N+YWKHDV R ESVK+ILH NAEFEA D
Sbjct  701  ETQNSMVVERCGRCKLQSVKIVNKGINWSSANNVYWKHDVERSESVKIILHENAEFEAKD  760

Query  381  VILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  205
            V+L+GNH+FEVP G++M+I      F  +L+ I    MDSGTW+W Y + G H++LE+ 
Sbjct  761  VVLKGNHIFEVPTGHRMRIVQDGPEFVAKLDPISKEMMDSGTWYWKYAVDGAHVKLEMA  819



>ref|XP_007008905.1| UDP-glucose pyrophosphorylase 3 isoform 2, partial [Theobroma 
cacao]
 gb|EOY17715.1| UDP-glucose pyrophosphorylase 3 isoform 2, partial [Theobroma 
cacao]
Length=840

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+GSELQIEVAEF WR+VQL+GS+II A+N+MGST ++ENGE  L+YG
Sbjct  703  EVTRQKFSGGSISKGSELQIEVAEFLWRNVQLEGSMIIAADNIMGSTRVDENGEPTLRYG  762

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             R  RCKL NVKVLNDGIDW+S DN+YWKHDV RFE++KVILHGNAEFEA +V +QGNH+
Sbjct  763  HRYGRCKLHNVKVLNDGIDWSSGDNVYWKHDVRRFEALKVILHGNAEFEASNVTIQGNHL  822

Query  357  FEVPDGYKMKITPGNSG  307
            FEVPDGY+MKIT G+ G
Sbjct  823  FEVPDGYRMKITSGDPG  839



>ref|XP_008354177.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103417800 
[Malus domestica]
Length=686

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF+GGSISEGSELQ+EVAEF WR+VQLDGSLI+ A NVMGST ++++GE +LQYG
Sbjct  559  EVTRQKFYGGSISEGSELQVEVAEFLWRNVQLDGSLIVEAXNVMGSTRIDQSGEPILQYG  618

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQ  370
             RC RCKL+NVKVLNDGIDWN  DN+YWKHDV R E+ KV+LHGNAEF A DV LQ
Sbjct  619  HRCGRCKLQNVKVLNDGIDWNFEDNVYWKHDVKRIEACKVVLHGNAEFGATDVTLQ  674



>gb|KDO68904.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=811

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST + +NGE++LQYG
Sbjct  692  EVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTRIADNGESILQYG  751

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQ  370
             RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEFEA DV LQ
Sbjct  752  YRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEFEASDVTLQ  807



>ref|XP_007008904.1| UDP-glucose pyrophosphorylase 3 isoform 1 [Theobroma cacao]
 gb|EOY17714.1| UDP-glucose pyrophosphorylase 3 isoform 1 [Theobroma cacao]
Length=830

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+GSELQIEVAEF WR+VQL+GS+II A+N+MGST ++ENGE  L+YG
Sbjct  706  EVTRQKFSGGSISKGSELQIEVAEFLWRNVQLEGSMIIAADNIMGSTRVDENGEPTLRYG  765

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
             R  RCKL NVKVLNDGIDW+S DN+YWKHDV RFE++KVILHGNAEFEA +V +Q   +
Sbjct  766  HRYGRCKLHNVKVLNDGIDWSSGDNVYWKHDVRRFEALKVILHGNAEFEASNVTIQAAAI  825

Query  357  F  355
             
Sbjct  826  L  826



>gb|KJB74379.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=821

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+GSELQ+EVAEF WR++QLDGS+II+AEN+MGST +++ GE +LQ+G
Sbjct  697  EVTRQKFSGGSISKGSELQVEVAEFLWRNIQLDGSMIIVAENIMGSTRIDDKGELILQHG  756

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQ  370
             RC RCKL NV VLNDG+DW S DN+YWKHD+ R E++KVILHGNAEFEA +VI+Q
Sbjct  757  HRCGRCKLCNVTVLNDGVDWTSGDNVYWKHDIRRSEALKVILHGNAEFEAYNVIIQ  812



>ref|XP_007008907.1| UDP-glucose pyrophosphorylase 3 isoform 4, partial [Theobroma 
cacao]
 gb|EOY17717.1| UDP-glucose pyrophosphorylase 3 isoform 4, partial [Theobroma 
cacao]
Length=833

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            EV RQKF GGSIS+GSELQIEVAEF WR+VQL+GS+II A+N+MGST ++ENGE  L+YG
Sbjct  703  EVTRQKFSGGSISKGSELQIEVAEFLWRNVQLEGSMIIAADNIMGSTRVDENGEPTLRYG  762

Query  537  -KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQ  370
              R  RCKL NVKVLNDGIDW+S DN+YWKHDV RFE++KVILHGNAEFEA +V +Q
Sbjct  763  HSRYGRCKLHNVKVLNDGIDWSSGDNVYWKHDVRRFEALKVILHGNAEFEASNVTIQ  819



>gb|EPS73539.1| hypothetical protein M569_01218, partial [Genlisea aurea]
Length=109

 Score =   165 bits (418),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -3

Query  567  ENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEA  388
            E GE ++QYG+R +RC+L+NV VLNDGIDWNS DN+YWKHDV RFE ++V+L+GNAEFEA
Sbjct  1    EAGEPIIQYGRRSARCRLENVTVLNDGIDWNSGDNVYWKHDVKRFECLQVVLNGNAEFEA  60

Query  387  MDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  241
            +DV + GNHVF VP G+ MKIT G SG +++LN I N S+D+GTWFWNY
Sbjct  61   IDVTIHGNHVFNVPGGHTMKITSGVSGLDIELNPIPNESIDTGTWFWNY  109



>ref|XP_008656383.1| PREDICTED: uncharacterized protein LOC103635785 isoform X2 [Zea 
mays]
Length=827

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++IRQKF GGS+S+GSELQIEVAEF W+DV+LDGS IILA+NVMGST  ++NGE +L YG
Sbjct  700  DIIRQKFVGGSVSKGSELQIEVAEFLWKDVELDGSFIILADNVMGSTKNSKNGEQILHYG  759

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQ  370
             RC RC+L++VK++N+GI+W S +N+YWKHDV R ESVK+ILHGNAEFEA DV+L+
Sbjct  760  SRCGRCRLQSVKIVNEGINWTSPNNVYWKHDVERSESVKIILHGNAEFEAKDVVLK  815



>ref|XP_002988988.1| hypothetical protein SELMODRAFT_159835 [Selaginella moellendorffii]
 gb|EFJ10017.1| hypothetical protein SELMODRAFT_159835 [Selaginella moellendorffii]
Length=742

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 114/172 (66%), Gaps = 10/172 (6%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            + RQK +GGSI +GSE+Q+E++E  W +V + GSL++ AEN+MG+       + +L YG+
Sbjct  564  IFRQKIYGGSIRKGSEVQLEISELSWTNVDVSGSLVVEAENIMGTVK-----DGILHYGE  618

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
               RC+  NV+V N GIDW    N+YW++ V R ES+K+IL G +EF+A DV+++G+HVF
Sbjct  619  GLGRCRFHNVQVSNQGIDWKCSTNVYWQNKVSRHESLKIILKGCSEFDASDVVIKGSHVF  678

Query  354  EVPDGYKMKITP-GNSGFEVQLNAIENRSMDSGTWFWNYKIM-GTHIQLELV  205
            EVPDG+KM++ P G +GF   L  +   S    +W W Y +     ++LE+V
Sbjct  679  EVPDGHKMRVRPSGPTGFSCTLERLPESSR---SWAWKYAMRENGEVELEMV  727



>ref|XP_002975099.1| hypothetical protein SELMODRAFT_150184 [Selaginella moellendorffii]
 gb|EFJ23884.1| hypothetical protein SELMODRAFT_150184 [Selaginella moellendorffii]
Length=745

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 114/173 (66%), Gaps = 10/173 (6%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            + RQK +GGSI +GSE+Q+E++E  W +V + GSL++ AEN+MG+       + +L YG+
Sbjct  567  IFRQKIYGGSIRKGSEVQLEISELSWTNVDVSGSLVVEAENIMGTVK-----DGILHYGE  621

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
               RC+  NV+V N GIDW    N+YW++ V R ES+K+IL G +EF+A DV+++G+HVF
Sbjct  622  GLGRCRFHNVQVSNQGIDWKCSTNVYWQNKVSRHESLKIILKGCSEFDASDVVIKGSHVF  681

Query  354  EVPDGYKMKI-TPGNSGFEVQLNAIENRSMDSGTWFWNYKIM-GTHIQLELVE  202
            EVPDG+KM++   G +GF   L  +   S    +W W Y +     ++LE+VE
Sbjct  682  EVPDGHKMRVRRSGPTGFSCTLERLPESSR---SWAWKYAMRENGEVELEMVE  731



>ref|XP_002949328.1| hypothetical protein VOLCADRAFT_59132 [Volvox carteri f. nagariensis]
 gb|EFJ49821.1| hypothetical protein VOLCADRAFT_59132 [Volvox carteri f. nagariensis]
Length=723

 Score =   135 bits (341),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 99/168 (59%), Gaps = 7/168 (4%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            +VI QK  GGS++ GSEL +EVAE   + + LDGSL +   +  G          +L+Y 
Sbjct  514  DVISQKIVGGSMAHGSELVLEVAEARLQQLHLDGSLEVRGADSGGGMSPAPGSAGLLRYS  573

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            +RC R +L NV+V+N GIDW + DN+YWKH V R ES K++L G +EFEA DV + G H 
Sbjct  574  RRCGRVQLVNVRVVNAGIDWEAPDNVYWKHQVSRRESCKIVLLGQSEFEAHDVTISGAHT  633

Query  357  FEVPDGYKMKITP---GNSGFEVQLNAIE-NRSMDSG---TWFWNYKI  235
            F VPDG+++ +T    G  G   QL  +    S+  G   +W W Y +
Sbjct  634  FVVPDGFRLTVTAAGDGVGGLRTQLAPLHPAASLMPGYEPSWDWIYSM  681



>emb|CCB89762.1| putative uncharacterized protein [Simkania negevensis Z]
Length=730

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 98/160 (61%), Gaps = 9/160 (6%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +IRQK  GG I  GSELQ+E+A+   + + LDGSL+I A+N+MG    + +G+ V  Y  
Sbjct  570  IIRQKIQGGEIRYGSELQLEIADLEMKSLFLDGSLLIFADNLMGHK--DSHGQLV--YSN  625

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            R  +C LKNV++ N GIDWN+ D+L+WKH++ R  S+ + L G++ FEA +V  QG+ + 
Sbjct  626  RTGQCSLKNVRIENGGIDWNAEDHLFWKHEIKRRASLTIHLQGHSRFEAENVTFQGDQMI  685

Query  354  EVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  235
            EVPDG  + +T  N          E R +     FW Y+I
Sbjct  686  EVPDGVHLIVTEQNGKLHY-----ERRLLSEDESFWTYQI  720



>ref|WP_041419450.1| hypothetical protein, partial [Simkania negevensis]
Length=613

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 96/158 (61%), Gaps = 9/158 (6%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +IRQK  GG I  GSELQ+E+A+   + + LDGSL+I A+N+MG    + +G+ V  Y  
Sbjct  465  IIRQKIQGGEIRYGSELQLEIADLEMKSLFLDGSLLIFADNLMGHK--DSHGQLV--YSN  520

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            R  +C LKNV++ N GIDWN+ D+L+WKH++ R  S+ + L G++ FEA +V  QG+ + 
Sbjct  521  RTGQCSLKNVRIENGGIDWNAEDHLFWKHEIKRRASLTIHLQGHSRFEAENVTFQGDQMI  580

Query  354  EVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  241
            EVPDG  + +T  N          E R +     FW Y
Sbjct  581  EVPDGVHLIVTEQNGKLHY-----ERRLLSEDESFWTY  613



>ref|XP_001420890.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99183.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=739

 Score =   117 bits (293),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 62/159 (39%), Positives = 93/159 (58%), Gaps = 8/159 (5%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            +V+ QK  GG I +GSE+++E+AE  WRDV + GSL + + +  G+T    + E+V    
Sbjct  573  DVVEQKIQGGEIKKGSEVRLEIAEIEWRDVSVQGSLFVESSSPFGTT----SAESVCFDE  628

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
              C RC+L NV V N GIDW+   N+YW + + R E   +++ GN EF+A DV L+G+  
Sbjct  629  SACGRCRLNNVVVSNAGIDWSEASNVYWSNFITRRERCSIVVEGNGEFDAKDVALEGDVR  688

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  241
            + VP G ++ + P  +G  VQ     + SM S  W W Y
Sbjct  689  YVVPTGKRLMLRPDGAG-GVQ-ETWSDISMPS--WRWKY  723



>ref|WP_006340614.1| hypothetical protein [Parachlamydia acanthamoebae]
 gb|EFB42236.1| hypothetical protein pah_c014o185 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=754

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 95/158 (60%), Gaps = 10/158 (6%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I QK   G ++  SEL +E+AE     V+L GSL I A+  +G      N E ++ YG+
Sbjct  592  IIAQKISQGKMAHQSELILEIAEILLHHVELKGSLKIYADRALGYL----NKEDIIHYGE  647

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            +  +C+LKNVK+ N GID+ S+ N++WK D+H  ES+++ +HGN EF A +V  +GN   
Sbjct  648  QSGKCRLKNVKIRNKGIDF-SQKNMFWKQDIHHLESMQIKIHGNGEFIAENVTFEGNIQI  706

Query  354  EVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  241
            EVP G++M+ +  ++    +   IE  S     W+W+Y
Sbjct  707  EVPHGHQMRASQKDNQIVYETTQIEKPS-----WYWSY  739



>emb|CEG00018.1| UTP--glucose-1-phosphate uridylyltransferase, partial [Ostreococcus 
tauri]
Length=773

 Score =   117 bits (292),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 61/160 (38%), Positives = 92/160 (58%), Gaps = 10/160 (6%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            +V+ QK  GG I +GSE+++E+AE  WRDV + GSL + A + +G      +G      G
Sbjct  607  DVVDQKIQGGVIEKGSEVRLEIAEIEWRDVSVRGSLFVEAASPLGPA---RDGTVYFDEG  663

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
              C RC+L+NV+V NDGID N   N+YW + + R E   + L G+ E +A+DV L G+  
Sbjct  664  A-CGRCRLRNVRVSNDGIDRNENSNVYWSNFIARTERCSIFLEGSGELDALDVTLAGDVR  722

Query  357  FEVPDGYKMKITP-GNSGFEVQLNAIENRSMDSGTWFWNY  241
            + VPDG ++ + P G  G +   + I      S +W W+Y
Sbjct  723  YVVPDGKRLTLRPDGAGGVQETWDDIV-----SPSWRWSY  757



>ref|XP_011402066.1| hypothetical protein F751_6536 [Auxenochlorella protothecoides]
 gb|KFM29017.1| hypothetical protein F751_6536 [Auxenochlorella protothecoides]
Length=547

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 101/183 (55%), Gaps = 16/183 (9%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAEN-------VMGSTMLNENGE  556
            V+ QK  GG ++  +ELQ+EVAE   + + L+GSL++LA++       V G+   N +  
Sbjct  359  VVAQKLRGGRLAPRAELQLEVAEADVQGLDLEGSLLVLADDPCDGEAEVGGACAENPDRH  418

Query  555  TVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVI  376
              L +  RC R +L+++ V N G+D+    N+YW+H V R  + +V LHG+AE +A  V 
Sbjct  419  PRLTFSSRCGRLRLRDLAVRNAGVDYADPSNVYWRHAVARHAACRVHLHGHAELDAAGVT  478

Query  375  LQGNHVFEVPDGYKMKITPGNS--GFEVQLNAIENRSMDSGTWFWNYKIM--GTHIQLEL  208
            L G+  F VPDG+++ + P  S  G+   L  I   S     W W Y +   GT + L L
Sbjct  479  LVGDLDFHVPDGHRLTLRPDASPRGWSAVLEPIAAPS-----WNWRYALGEDGTGVVLSL  533

Query  207  VES  199
             E+
Sbjct  534  EEA  536



>ref|XP_003082504.1| unnamed protein product, partial [Ostreococcus tauri]
Length=664

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 92/160 (58%), Gaps = 10/160 (6%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            +V+ QK  GG I +GSE+++E+AE  WRDV + GSL + A + +G      +G      G
Sbjct  498  DVVDQKIQGGVIEKGSEVRLEIAEIEWRDVSVRGSLFVEAASPLGPA---RDGTVYFDEG  554

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
              C RC+L+NV+V NDGID N   N+YW + + R E   + L G+ E +A+DV L G+  
Sbjct  555  A-CGRCRLRNVRVSNDGIDRNENSNVYWSNFIARTERCSIFLEGSGELDALDVTLAGDVR  613

Query  357  FEVPDGYKMKITP-GNSGFEVQLNAIENRSMDSGTWFWNY  241
            + VPDG ++ + P G  G +   + I      S +W W+Y
Sbjct  614  YVVPDGKRLTLRPDGAGGVQETWDDIV-----SPSWRWSY  648



>ref|WP_013924194.1| hypothetical protein [Parachlamydia acanthamoebae]
 emb|CCB85144.1| putative uncharacterized protein [Parachlamydia acanthamoebae 
UV-7]
Length=754

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 93/158 (59%), Gaps = 10/158 (6%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I QK   G ++  SEL +E+AE     V+L GSL I A+  +G      N E ++ YG+
Sbjct  592  IIAQKISQGKMAHQSELILEIAEILLHHVELQGSLKIYADRALGYL----NKEDIIHYGE  647

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            +  +C+LKNVK+ N GID+ S+ N++WK D+H  ES+++ +HGN EF A +V  +GN   
Sbjct  648  QSGKCRLKNVKIRNKGIDF-SQKNMFWKQDIHHLESMQIKIHGNGEFIAENVTFEGNIQI  706

Query  354  EVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  241
            EVP G++M+    ++         E   +   +W+W+Y
Sbjct  707  EVPHGHQMRAYQKDNQI-----VYETTQIKKPSWYWSY  739



>gb|KIA76347.1| hypothetical protein DB43_AK00070 [Parachlamydia acanthamoebae]
Length=758

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 93/158 (59%), Gaps = 10/158 (6%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I QK   G ++  SEL +E+AE     V+L GSL I A+  +G      N E ++ YG+
Sbjct  596  IIAQKISQGKMAHQSELILEIAEILLHHVELQGSLKIYADRALGYL----NKEDIIHYGE  651

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            +  +C+LKNVK+ N GID+ S+ N++WK D+H  ES+++ +HGN EF A +V  +GN   
Sbjct  652  QSGKCRLKNVKIRNKGIDF-SQKNMFWKQDIHHLESMQIKIHGNGEFIAENVTFEGNIQI  710

Query  354  EVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  241
            EVP G++M+    ++         E   +   +W+W+Y
Sbjct  711  EVPHGHQMRAYQKDNQI-----VYETTQIKKPSWYWSY  743



>gb|AAY31019.1| low photochemical bleaching 1 protein [Chlamydomonas reinhardtii]
Length=1061

 Score =   114 bits (286),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -3

Query  600  AENVMGSTMLNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVK  421
            A    GS  ++  G  +L+YG+RC R ++ NV+V N GIDW S DN+YWKH V R ES K
Sbjct  876  ASAAAGSPSVSAAGGGILRYGRRCGRVQMVNVRVRNAGIDWASPDNVYWKHQVRRHESCK  935

Query  420  VILHGNAEFEAMDVILQGNHVFEVPDGYKMKIT--PGNSGFEVQLNAI  283
            V+L G +EFEA DV L G+H F VPDG+++ +T  P  +G E +L  +
Sbjct  936  VVLLGQSEFEAHDVTLTGSHTFVVPDGHRLSVTAAPDGAGIEAKLTPL  983


 Score = 50.1 bits (118),  Expect = 0.001, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMG  583
            +VI QK  GGS+++GSEL +E AE    DV + GSL + AENVMG
Sbjct  758  DVISQKLVGGSLAQGSELVLECAEARLVDVDITGSLQVYAENVMG  802



>gb|AAY31018.1| low photochemical bleaching 1 protein [Chlamydomonas reinhardtii]
Length=1064

 Score =   114 bits (286),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -3

Query  600  AENVMGSTMLNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVK  421
            A    GS  ++  G  +L+YG+RC R ++ NV+V N GIDW S DN+YWKH V R ES K
Sbjct  879  ASAAAGSPSVSAAGGGILRYGRRCGRVQMVNVRVRNAGIDWASPDNVYWKHQVRRHESCK  938

Query  420  VILHGNAEFEAMDVILQGNHVFEVPDGYKMKIT--PGNSGFEVQLNAI  283
            V+L G +EFEA DV L G+H F VPDG+++ +T  P  +G E +L  +
Sbjct  939  VVLLGQSEFEAHDVTLTGSHTFVVPDGHRLSVTAAPDGAGIEAKLTPL  986



>ref|XP_003057529.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH59174.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=745

 Score =   113 bits (283),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 65/186 (35%), Positives = 101/186 (54%), Gaps = 15/186 (8%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNEN-----GET  553
            +V  QK  GG++ E +E+++E+AE  W+DV +DGSL+I A+   G   ++++     G+ 
Sbjct  489  DVTSQKIRGGALRERAEVRLEIAEIEWKDVDVDGSLLITADAPFGEEKVDDDAGAARGKP  548

Query  552  VLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVIL  373
                   C RC+L+ V V N G+DW++ D+  W   + R ES  V L GNAEF+A DV L
Sbjct  549  TSFDDDACGRCRLRGVAVRNAGVDWSAPDDEAWSATLTRSESCVVRLRGNAEFDARDVTL  608

Query  372  QGNHVFEVPDGYKMKITPGNS--GFEVQLNAIENRSMD------SGTWFWNYKIM-GTHI  220
             G+ +++VP G+++ + P     G E  L A+     D        TW W Y +  G  +
Sbjct  609  SGDVMYDVPAGWRLSLRPDTDERGGE-SLGAVREEWTDLSAAGGGPTWRWAYDVSDGGRV  667

Query  219  QLELVE  202
             L L E
Sbjct  668  GLRLEE  673



>ref|XP_007515057.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15297.1| predicted protein [Bathycoccus prasinos]
Length=895

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 93/173 (54%), Gaps = 10/173 (6%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++I QK  GGSI+  SE+++E+AE  W +V++DGSL+I   NV G   +++         
Sbjct  729  DIIAQKLRGGSIARKSEVKLEIAELNWENVRVDGSLLITCTNVTGEGTMSD---------  779

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
              C R ++ +V VLN GIDW +  N+YW     R ES +++LHGNAE +     L GN  
Sbjct  780  IDCGRARIVDVDVLNAGIDWENEGNVYWSATYSRDESAEIVLHGNAEIDIEGCALHGNCA  839

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGT-HIQLELVE  202
            +EVP+G ++ I   N          E+      +W W Y   G   IQ +LV+
Sbjct  840  YEVPNGKRLVIRSVNGDAGCLSETYEDIVPGVPSWRWKYAFGGKDDIQSDLVQ  892



>ref|XP_002502005.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63263.1| predicted protein [Micromonas sp. RCC299]
Length=486

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 97/174 (56%), Gaps = 4/174 (2%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            +V  QK   GSI E SE+++E+AE  W DV + GSL++ A++ +G+T    +G   L + 
Sbjct  247  QVTEQKIARGSIGERSEVRLEIAEIEWADVHVTGSLLVEADSPLGATRQTPSGAPTLVFD  306

Query  537  K-RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNH  361
            +  C RC+L++VK+ N G+DW++     W   + R E  ++ + G+ EF+A  V ++G+ 
Sbjct  307  ENECGRCRLRDVKITNAGVDWHADGTTIWSAQLTRTECCEIRVEGDGEFDAKGVTIKGDA  366

Query  360  VFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSG--TWFWNYK-IMGTHIQLEL  208
             + VP G+++++ P        +    N +   G  TW W Y+   G  ++L L
Sbjct  367  RYVVPAGWRLQLRPDRDDPGTIVERWTNLAAAGGGPTWNWAYEGGAGGDVRLTL  420



>ref|XP_005850851.1| hypothetical protein CHLNCDRAFT_140453 [Chlorella variabilis]
 gb|EFN58749.1| hypothetical protein CHLNCDRAFT_140453 [Chlorella variabilis]
Length=414

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 79/135 (59%), Gaps = 19/135 (14%)
 Frame = -3

Query  558  ETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNA-------  400
            E  L Y +RC R +L NV+V N G+DW    N++W+H + R ES +++LHG +       
Sbjct  268  EPRLVYSERCGRLRLHNVRVENAGVDWEHPGNVWWRHSLARTESCQILLHGASGDRGRVG  327

Query  399  -------EFEAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  241
                   EFEA DV L GN VFEVPDG++M +T G  G E++    E R ++  +W W Y
Sbjct  328  RQLTAAGEFEARDVTLAGNLVFEVPDGHRMLVTAGPDG-ELRR---EVRPLERPSWRWRY  383

Query  240  KIMGT-HIQLELVES  199
            ++     +QL+L+ES
Sbjct  384  RLGAEGQVQLDLLES  398



>emb|CAF23048.1| hypothetical protein pc0324 [Candidatus Protochlamydia amoebophila 
UWE25]
Length=731

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 65/162 (40%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I+QK   G +S+GSELQIE+AE   + + L+GSLI+ +   +G    NE G  +L YGK
Sbjct  566  IIQQKISFGRLSKGSELQIELAEVDLKQIDLEGSLILESSTPLGQ--YNEQG--ILHYGK  621

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
               RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF A  + + GN  F
Sbjct  622  E-PRCSLHHVTIRNRGIDFQNTQQ-FWKNDLVRHECMKVVLKEGAEFYAEHLTIVGNQCF  679

Query  354  EVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  235
            EVP  ++  +K T GN+  E +L  I+       TW W Y+I
Sbjct  680  EVPAHHRLTLKSTSGNNWIE-ELTPIQQP-----TWTWLYQI  715



>ref|WP_039356565.1| hypothetical protein, partial [Candidatus Protochlamydia amoebophila]
Length=729

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 65/162 (40%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I+QK   G +S+GSELQIE+AE   + + L+GSLI+ +   +G    NE G  +L YGK
Sbjct  564  IIQQKISFGRLSKGSELQIELAEVDLKQIDLEGSLILESSTPLGQ--YNEQG--ILHYGK  619

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
               RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF A  + + GN  F
Sbjct  620  E-PRCSLHHVTIKNRGIDFQNTQQ-FWKNDLIRHECMKVVLKEGAEFYAEHLTIVGNQCF  677

Query  354  EVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  235
            EVP  ++  +K T GN+  E +L  I+       TW W Y+I
Sbjct  678  EVPAHHRLTLKSTSGNNWIE-ELTPIQQP-----TWTWLYQI  713



>ref|WP_044045343.1| hypothetical protein, partial [Candidatus Protochlamydia amoebophila]
Length=738

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 65/162 (40%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I+QK   G +S+GSELQIE+AE   + + L+GSLI+ +   +G    NE G  +L YGK
Sbjct  573  IIQQKISFGRLSKGSELQIELAEVDLKQIDLEGSLILESSTPLGQ--YNEQG--ILHYGK  628

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
               RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF A  + + GN  F
Sbjct  629  E-PRCSLHHVTIRNRGIDFQNTQQ-FWKNDLVRHECMKVVLKEGAEFYAEHLTIVGNQCF  686

Query  354  EVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  235
            EVP  ++  +K T GN+  E +L  I+       TW W Y+I
Sbjct  687  EVPAHHRLTLKSTSGNNWIE-ELTPIQQP-----TWTWLYQI  722



>gb|KIC73590.1| hypothetical protein DB44_BC00180 [Candidatus Protochlamydia 
amoebophila]
Length=731

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 65/162 (40%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I+QK   G +S+GSELQIE+AE   + + L+GSLI+ +   +G    NE G  +L YGK
Sbjct  566  IIQQKISFGRLSKGSELQIELAEVDLKQIDLEGSLILESSTPLGQ--YNEQG--ILHYGK  621

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
               RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF A  + + GN  F
Sbjct  622  E-PRCSLHHVTIKNRGIDFQNTQQ-FWKNDLIRHECMKVVLKEGAEFYAEHLTIVGNQCF  679

Query  354  EVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  235
            EVP  ++  +K T GN+  E +L  I+       TW W Y+I
Sbjct  680  EVPAHHRLTLKSTSGNNWIE-ELTPIQQP-----TWTWLYQI  715



>emb|CDZ79581.1| hypothetical protein BN1013_00075 [Chlamydia sp. 'Rubis']
Length=713

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 86/158 (54%), Gaps = 18/158 (11%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            ++ QK  GGSI E SEL +E+AE    ++ LDGSL+ILA             +   +   
Sbjct  559  IVGQKIRGGSIQEKSELHLEIAEIEIENLTLDGSLVILA------------SKQTAKLSN  606

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            R  RC LKNVK+ N G++W + + + WK ++ R ES KVIL G +EFEA ++   GN   
Sbjct  607  RTGRCLLKNVKIKNKGVNWEASEPI-WKGNIERLESFKVILEGFSEFEAENIEFIGNFEI  665

Query  354  EVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  241
             VPDGY+   T  +      L +I+   ++S  W W Y
Sbjct  666  IVPDGYRYCATLKDG-----LISIDKIKINSPKWEWKY  698



>ref|WP_042282241.1| hypothetical protein, partial [Candidatus Protochlamydia sp. 
R18]
Length=734

 Score =   102 bits (254),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 64/162 (40%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I+QK   G +S+GSELQ+E+AE   + + L+GSLI+ +   +G    NE G  +L YGK
Sbjct  569  IIQQKISFGRLSKGSELQVELAEVDLKQIDLEGSLILESSTPLGQ--YNEQG--ILHYGK  624

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
               RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF A  + + GN  F
Sbjct  625  E-PRCSLHHVTIRNRGIDFQNTQQ-FWKNDLVRHECMKVVLKEGAEFYAEHLTIVGNQCF  682

Query  354  EVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  235
            EVP  ++  +K T GN+  E +L  I+       TW W Y+I
Sbjct  683  EVPAHHRLTLKSTSGNNWIE-ELTPIQQP-----TWTWLYQI  718



>ref|XP_004160752.1| PREDICTED: uncharacterized LOC101221986 [Cucumis sativus]
Length=63

 Score = 93.6 bits (231),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -3

Query  378  ILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELVE  202
            +L GNHVFEVPDGYK+KI+PG SGFE QL+ IE    D+G+W+WNYKI G+HI+LE VE
Sbjct  4    LLDGNHVFEVPDGYKLKISPGTSGFEAQLDQIELDKQDTGSWYWNYKIEGSHIKLEYVE  62



>ref|WP_042103582.1| hypothetical protein, partial [Parachlamydiaceae bacterium HS-T3]
Length=702

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 95/159 (60%), Gaps = 11/159 (7%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            VI QK   G ++ GSELQ+E+ E Y   ++L+GS++I A + +G    N      L Y  
Sbjct  542  VIEQKIQHGWLAFGSELQLEITELYIHQLRLEGSMMIKASHPLGHHEKNR-----LIYSD  596

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            R  +C LKN++V N GID++++ N +WK++++R E +++ L  +AEF A ++I QG+H  
Sbjct  597  RMGKCYLKNIEVKNKGIDFSAK-NKFWKNEIYRKEVLEIFLEEDAEFYAENIIFQGSHQI  655

Query  354  EVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYK  238
             VP G++M       G E+     E  S+ + +W W+Y+
Sbjct  656  SVPKGHRM--VARMEGSEI---IYELASISAPSWHWHYE  689



>ref|XP_005651201.1| nucleotide-diphospho-sugar transferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26657.1| nucleotide-diphospho-sugar transferase [Coccomyxa subellipsoidea 
C-169]
Length=943

 Score =   102 bits (253),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = -3

Query  549  LQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQ  370
            L +  RC R +L  V V N GIDW S DN YW+H V R E+ +++LHG +EFEA  V+L+
Sbjct  805  LVFSDRCGRVRLTGVVVRNKGIDWGSPDNCYWQHKVARKEAARIVLHGQSEFEASHVVLE  864

Query  369  GNHVFEVPDGYKMKITPGNS-GFEVQLNAIENRSMDSGTWFWNYKI  235
            G+  FEVPDGYKM ++   + G    L  +  R     +W W+Y++
Sbjct  865  GDQTFEVPDGYKMVVSAAPAGGLRRALFPLHKR---RPSWQWDYQM  907



>gb|KIC72534.1| hypothetical protein DB41_KJ00090 [Neochlamydia sp. TUME1]
Length=736

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 5/128 (4%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++N + ++ Y +
Sbjct  573  VIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HKNAQGIITYSE  628

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            +  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A +V L+G+   
Sbjct  629  KVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAENVTLEGDLEI  687

Query  354  EVPDGYKM  331
            EV DG ++
Sbjct  688  EVADGERL  695



>ref|WP_039386373.1| hypothetical protein [Neochlamydia sp. TUME1]
Length=752

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 5/128 (4%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++N + ++ Y +
Sbjct  589  VIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HKNAQGIITYSE  644

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            +  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A +V L+G+   
Sbjct  645  KVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAENVTLEGDLEI  703

Query  354  EVPDGYKM  331
            EV DG ++
Sbjct  704  EVADGERL  711



>gb|KIC75402.1| hypothetical protein DB42_AC00080 [Neochlamydia sp. EPS4]
Length=736

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 5/128 (4%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++N + ++ Y +
Sbjct  573  VIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HKNAQGIITYSE  628

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            +  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A +V L+G+   
Sbjct  629  KVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAENVTLEGDLEI  687

Query  354  EVPDGYKM  331
            EV DG ++
Sbjct  688  EVADGERL  695



>ref|WP_042240571.1| hypothetical protein, partial [Neochlamydia sp. S13]
Length=719

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 5/128 (4%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++N + ++ Y +
Sbjct  556  VIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HKNAQGIITYSE  611

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
            +  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A +V L+G+   
Sbjct  612  KVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAENVTLEGDLEI  670

Query  354  EVPDGYKM  331
            EV DG ++
Sbjct  671  EVADGERL  678



>ref|WP_032125914.1| hypothetical protein, partial [Chlamydia sp. 'Diamant']
Length=725

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 93/159 (58%), Gaps = 12/159 (8%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            V++QK   G  ++ SELQIE+AE     + LDGSL+I + + +GS  +NEN   +L+YG 
Sbjct  563  VVQQKIRHGRFADRSELQIELAEVNIDHLDLDGSLLIESPSPLGS--INEND--LLEYGL  618

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
              SRC L++V + N GID+    + +WK+ + R E V++ L   AEF A  + L GN  F
Sbjct  619  E-SRCHLQHVTIRNKGIDYRLPQH-FWKNKLQRNECVRIHLKEGAEFHAEHITLTGNCYF  676

Query  354  EVPDGYKMKITPGNSG-FEVQLNAIENRSMDSGTWFWNY  241
            EVP  +++ +   + G +  +L  IEN S     W W+Y
Sbjct  677  EVPAYHRLTLKAASDGTWAEELTKIENPS-----WSWHY  710



>gb|EKE08140.1| hypothetical protein ACD_17C00324G0001 [uncultured bacterium]
Length=158

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I++K  GG    G+ +  E+A+ Y ++++++G L I AE  +G    + + +  L + K
Sbjct  33   IIQRKIQGGHFHLGASVLFELADLYAKNLEVNGCLEIYAEKPIG----HYSSKGDLHFSK  88

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
                C L+NV + N G+DW S    YWK ++   ESVK++L G ++F A ++ LQG+H F
Sbjct  89   EAGSCILENVTIENTGVDWKSSSP-YWKMNLKTRESVKIVLKGKSKFIARNLHLQGSHTF  147

Query  354  EVPDGYKMKI  325
             + DG  +KI
Sbjct  148  IIEDGQTIKI  157



>ref|WP_041017774.1| hypothetical protein, partial [Criblamydia sequanensis]
Length=708

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 95/162 (59%), Gaps = 13/162 (8%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++I QK   G I + SEL +E++E + RD+ L+GSL++ A++  G     +  E+  ++ 
Sbjct  550  DIICQKIQKGKIYKKSELILEISEIFIRDLTLEGSLVVDAKSPFG-----KRAES--RFS  602

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            ++ +R +L+NV V+N G+   S    Y   +  R ESVK+IL+G +EF+A +V+ +G+ V
Sbjct  603  EKAARVRLENVSVINKGLKLESPIG-YPAGNFKREESVKIILNGFSEFQAKNVVFKGDQV  661

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIM  232
             E+P+GY  K+T    G +++        +D  +W + Y  +
Sbjct  662  IEIPEGY--KVTAFEEGGKIKF---LKEKIDRPSWSYCYHFL  698



>emb|CDR34196.1| Conserved hypothetical protein [Criblamydia sequanensis CRIB-18]
Length=706

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 95/162 (59%), Gaps = 13/162 (8%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  538
            ++I QK   G I + SEL +E++E + RD+ L+GSL++ A++  G     +  E+  ++ 
Sbjct  548  DIICQKIQKGKIYKKSELILEISEIFIRDLTLEGSLVVDAKSPFG-----KRAES--RFS  600

Query  537  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
            ++ +R +L+NV V+N G+   S    Y   +  R ESVK+IL+G +EF+A +V+ +G+ V
Sbjct  601  EKAARVRLENVSVINKGLKLESPIG-YPAGNFKREESVKIILNGFSEFQAKNVVFKGDQV  659

Query  357  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIM  232
             E+P+GY  K+T    G +++        +D  +W + Y  +
Sbjct  660  IEIPEGY--KVTAFEEGGKIKF---LKEKIDRPSWSYCYHFL  696



>gb|KJB74377.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=757

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQY  541
            EV RQKF GGSIS+GSELQ+EVAEF WR++QLDGS+II+AEN+MGST +++ G   + Y
Sbjct  697  EVTRQKFSGGSISKGSELQVEVAEFLWRNIQLDGSMIIVAENIMGSTRIDDKGVEDVSY  755



>gb|EKE21602.1| hypothetical protein ACD_7C00172G0003, partial [uncultured bacterium]
Length=343

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 70/130 (54%), Gaps = 11/130 (8%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I QK  GG   +GSE+Q+E+AE    ++ L GSLII        T L +N +  +    
Sbjct  211  IICQKIKGGEFFQGSEMQLEIAEVLIENLSLKGSLII-------ETPLIKNSKKDIY---  260

Query  534  RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHVF  355
              S C L NVK+ N GID N + N+YW++ + R +  K+IL  N++F A +V        
Sbjct  261  NTSSCVLTNVKIKNSGIDANYK-NIYWQNKIKRNQFFKIILEENSQFYAANVEFINTQEI  319

Query  354  EVPDGYKMKI  325
             VP  +KM I
Sbjct  320  IVPANHKMFI  329



>gb|ADI37750.1| conserved hypothetical protein [Waddlia chondrophila WSU 86-1044]
 emb|CCB90767.1| putative uncharacterized protein [Waddlia chondrophila 2032/99]
Length=696

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 73/142 (51%), Gaps = 24/142 (17%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I +K  GG IS+ SE+ I++A+    +++L+GSL I  E+                 G+
Sbjct  551  LIAKKIRGGEISDDSEMHIQLADVEIDNLRLEGSLSIRGES-----------------GR  593

Query  534  RCSRCKLKNVKVLNDGID-WNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
              + C+LKNV V N GID   +RD  YWK+D  R E +++   G  EF A  V+  G   
Sbjct  594  --AFCRLKNVAVKNRGIDRQKTRD--YWKNDPVRHELLEIFFEGKGEFIAEQVVFHGQQR  649

Query  357  FEVPDGYKMKITPGNSGFEVQL  292
              +PDG  + +T    G E+ L
Sbjct  650  IVIPDG--VCVTASEEGSEITL  669



>ref|WP_041941704.1| hypothetical protein, partial [Waddlia chondrophila]
Length=641

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 24/143 (17%)
 Frame = -3

Query  714  VIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYGK  535
            +I +K  GG IS+ SE+ I++A+    +++L+GSL I  E+                 G+
Sbjct  496  LIAKKIRGGEISDDSEMHIQLADVEIDNLRLEGSLSIRGES-----------------GR  538

Query  534  RCSRCKLKNVKVLNDGID-WNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  358
              + C+LKNV V N GID   +RD  YWK+D  R E +++   G  EF A  V+  G   
Sbjct  539  --AFCRLKNVAVKNRGIDRQKTRD--YWKNDPVRHELLEIFFEGKGEFIAEQVVFHGQQR  594

Query  357  FEVPDGYKMKITPGNSGFEVQLN  289
              +PDG  + +T    G E+ L 
Sbjct  595  IVIPDG--VCVTASEEGSEITLK  615



>ref|XP_011084882.1| PREDICTED: uncharacterized protein LOC105167026 isoform X3 [Sesamum 
indicum]
Length=725

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  717  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQ  625
            EV RQKF  GSI+ GSELQIEVAEF WR+VQ
Sbjct  695  EVTRQKFRCGSIAMGSELQIEVAEFLWRNVQ  725



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410