BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047M10

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004502879.1|  PREDICTED: UDP-galactose transporter 2-like ...    206   3e-61   
ref|XP_010242229.1|  PREDICTED: UDP-galactose transporter 2-like        202   2e-60   Nelumbo nucifera [Indian lotus]
emb|CBI21537.3|  unnamed protein product                                200   3e-60   Vitis vinifera
ref|XP_002278813.1|  PREDICTED: UDP-galactose transporter 2             200   3e-60   Vitis vinifera
ref|XP_009797956.1|  PREDICTED: UDP-galactose transporter 2-like        199   4e-60   Nicotiana sylvestris
ref|XP_009630891.1|  PREDICTED: UDP-galactose transporter 2-like        199   4e-60   Nicotiana tomentosiformis
ref|XP_006357353.1|  PREDICTED: UDP-galactose transporter 2-like ...    201   5e-60   Solanum tuberosum [potatoes]
ref|XP_008378692.1|  PREDICTED: UDP-galactose transporter 2-like        202   7e-60   
ref|XP_009345238.1|  PREDICTED: UDP-galactose transporter 2-like        202   7e-60   Pyrus x bretschneideri [bai li]
ref|XP_004237478.1|  PREDICTED: UDP-galactose transporter 2             200   8e-60   Solanum lycopersicum
ref|XP_003602507.1|  Membrane protein, putative                         200   2e-59   Medicago truncatula
gb|AES72759.2|  nucleotide/sugar transporter family protein             200   2e-59   Medicago truncatula
gb|ACJ84819.1|  unknown                                                 200   2e-59   Medicago truncatula
ref|XP_010040194.1|  PREDICTED: UDP-galactose transporter 2-like        195   2e-59   
ref|XP_006579458.1|  PREDICTED: uncharacterized protein LOC100814...    201   3e-59   Glycine max [soybeans]
gb|EYU36556.1|  hypothetical protein MIMGU_mgv1a009740mg                201   3e-59   Erythranthe guttata [common monkey flower]
gb|KDP36558.1|  hypothetical protein JCGZ_08325                         200   3e-59   Jatropha curcas
gb|AFK39529.1|  unknown                                                 199   4e-59   Medicago truncatula
ref|XP_008440118.1|  PREDICTED: UDP-galactose transporter 2             201   4e-59   Cucumis melo [Oriental melon]
gb|KJB18356.1|  hypothetical protein B456_003G048300                    197   4e-59   Gossypium raimondii
ref|XP_004157865.1|  PREDICTED: UDP-galactose transporter 2-like        200   5e-59   
ref|XP_004141972.1|  PREDICTED: UDP-galactose transporter 2-like        200   5e-59   Cucumis sativus [cucumbers]
ref|XP_007048169.1|  Nucleotide-sugar transporter family protein ...    199   6e-59   
ref|XP_008232334.1|  PREDICTED: UDP-galactose transporter 2             200   7e-59   Prunus mume [ume]
gb|KJB18355.1|  hypothetical protein B456_003G048300                    197   7e-59   Gossypium raimondii
ref|XP_007205521.1|  hypothetical protein PRUPE_ppa008448mg             199   9e-59   Prunus persica
ref|XP_011100579.1|  PREDICTED: UDP-galactose transporter 2             199   1e-58   Sesamum indicum [beniseed]
ref|XP_007048167.1|  Nucleotide-sugar transporter family protein ...    199   1e-58   Theobroma cacao [chocolate]
ref|XP_009354062.1|  PREDICTED: UDP-galactose transporter 2-like        197   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_002533887.1|  organic anion transporter, putative                199   2e-58   Ricinus communis
emb|CDP11437.1|  unnamed protein product                                195   2e-58   Coffea canephora [robusta coffee]
ref|XP_004252567.1|  PREDICTED: UDP-galactose transporter 2             197   2e-58   Solanum lycopersicum
gb|KHN09562.1|  UDP-galactose transporter 2                             195   2e-58   Glycine soja [wild soybean]
ref|NP_001242035.1|  uncharacterized protein LOC100814890               199   2e-58   Glycine max [soybeans]
ref|XP_007019596.1|  Nucleotide-sugar transporter family protein ...    196   2e-58   
ref|XP_010027747.1|  PREDICTED: UDP-galactose transporter 2             193   2e-58   Eucalyptus grandis [rose gum]
ref|XP_004288090.1|  PREDICTED: UDP-galactose transporter 2             198   2e-58   Fragaria vesca subsp. vesca
gb|KHN29130.1|  UDP-galactose transporter 2                             198   3e-58   Glycine soja [wild soybean]
gb|KJB40431.1|  hypothetical protein B456_007G062900                    198   4e-58   Gossypium raimondii
ref|XP_006464516.1|  PREDICTED: UDP-galactose transporter 2-like ...    195   4e-58   Citrus sinensis [apfelsine]
ref|XP_011100070.1|  PREDICTED: UDP-galactose transporter 2-like        197   4e-58   Sesamum indicum [beniseed]
ref|XP_009345493.1|  PREDICTED: UDP-galactose transporter 2-like        196   4e-58   Pyrus x bretschneideri [bai li]
gb|KJB18357.1|  hypothetical protein B456_003G048300                    197   4e-58   Gossypium raimondii
ref|XP_003523251.1|  PREDICTED: UDP-galactose transporter 2-like ...    196   4e-58   Glycine max [soybeans]
emb|CDP11440.1|  unnamed protein product                                194   5e-58   Coffea canephora [robusta coffee]
ref|XP_010097649.1|  hypothetical protein L484_023789                   192   5e-58   Morus notabilis
ref|XP_011074099.1|  PREDICTED: UDP-galactose transporter 2-like        196   5e-58   Sesamum indicum [beniseed]
ref|XP_010932887.1|  PREDICTED: UDP-galactose transporter 2-like        194   6e-58   
ref|XP_010063828.1|  PREDICTED: UDP-galactose transporter 2-like        197   7e-58   Eucalyptus grandis [rose gum]
gb|KHG07660.1|  UDP-galactose transporter 2 -like protein               197   8e-58   Gossypium arboreum [tree cotton]
ref|XP_006585314.1|  PREDICTED: UDP-galactose transporter 2-like ...    197   8e-58   
ref|XP_009336495.1|  PREDICTED: UDP-galactose transporter 2             194   9e-58   Pyrus x bretschneideri [bai li]
ref|XP_006585315.1|  PREDICTED: UDP-galactose transporter 2-like ...    197   9e-58   Glycine max [soybeans]
gb|KHG12708.1|  UDP-galactose transporter 2 -like protein               197   1e-57   Gossypium arboreum [tree cotton]
ref|XP_008777067.1|  PREDICTED: UDP-galactose transporter 2-like ...    195   1e-57   Phoenix dactylifera
ref|XP_006647512.1|  PREDICTED: UDP-galactose transporter 2-like ...    194   1e-57   Oryza brachyantha
dbj|BAJ99966.1|  predicted protein                                      194   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB18354.1|  hypothetical protein B456_003G048300                    197   1e-57   Gossypium raimondii
ref|XP_009610489.1|  PREDICTED: UDP-galactose transporter 2-like        193   1e-57   Nicotiana tomentosiformis
ref|XP_008456746.1|  PREDICTED: UDP-galactose transporter 2-like        196   1e-57   Cucumis melo [Oriental melon]
ref|XP_006647514.1|  PREDICTED: UDP-galactose transporter 2-like ...    194   2e-57   
ref|XP_008777064.1|  PREDICTED: UDP-galactose transporter 2-like ...    195   2e-57   Phoenix dactylifera
ref|XP_007159783.1|  hypothetical protein PHAVU_002G266800g             196   2e-57   Phaseolus vulgaris [French bean]
ref|XP_008386368.1|  PREDICTED: UDP-galactose transporter 2             194   2e-57   
ref|XP_007019594.1|  Nucleotide-sugar transporter family protein ...    196   2e-57   
ref|XP_009335133.1|  PREDICTED: UDP-galactose transporter 2-like        194   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_009802605.1|  PREDICTED: UDP-galactose transporter 2-like        192   2e-57   Nicotiana sylvestris
ref|XP_006361615.1|  PREDICTED: UDP-galactose transporter 2-like        194   2e-57   Solanum tuberosum [potatoes]
ref|XP_003634527.1|  PREDICTED: UDP-galactose transporter 2             194   2e-57   Vitis vinifera
ref|XP_008812584.1|  PREDICTED: UDP-galactose transporter 2-like        192   2e-57   Phoenix dactylifera
gb|KDP35285.1|  hypothetical protein JCGZ_09444                         196   2e-57   Jatropha curcas
ref|NP_001239895.1|  uncharacterized protein LOC100800306               193   2e-57   Glycine max [soybeans]
ref|XP_007201810.1|  hypothetical protein PRUPE_ppa008384mg             193   3e-57   Prunus persica
dbj|BAL46503.1|  putative transmembrane protein                         192   3e-57   Diospyros kaki [Japanese persimmon]
emb|CDP12866.1|  unnamed protein product                                196   4e-57   Coffea canephora [robusta coffee]
ref|NP_001047426.1|  Os02g0614500                                       194   4e-57   
gb|AAK50365.1|  putative transmembrane protein                          194   4e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73595.1|  hypothetical protein OsI_08063                          194   4e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_003518502.1|  PREDICTED: UDP-galactose transporter 2-like        194   4e-57   Glycine max [soybeans]
ref|NP_568059.1|  nucleotide sugar transporter-KT 1                     195   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190967.1|  nucleotide sugar transporter-KT 1                  195   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|EMT04054.1|  hypothetical protein F775_26901                         192   6e-57   
gb|AAM64952.1|  unknown                                                 195   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300904.2|  transporter-related family protein                 192   6e-57   
ref|XP_006434521.1|  hypothetical protein CICLE_v10001769mg             193   6e-57   
ref|NP_001136797.1|  uncharacterized protein LOC100216942               190   7e-57   
ref|XP_008381856.1|  PREDICTED: UDP-galactose transporter 2-like        194   8e-57   
ref|XP_009416387.1|  PREDICTED: UDP-galactose transporter 2-like        192   8e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010446483.1|  PREDICTED: UDP-galactose transporter 2-like ...    194   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006599473.1|  PREDICTED: UDP-galactose transporter 2-like ...    193   8e-57   Glycine max [soybeans]
ref|XP_011042896.1|  PREDICTED: UDP-galactose transporter 2-like        192   9e-57   Populus euphratica
ref|XP_010906037.1|  PREDICTED: UDP-galactose transporter 2-like        192   1e-56   Elaeis guineensis
gb|KJB59484.1|  hypothetical protein B456_009G258600                    194   1e-56   Gossypium raimondii
gb|ACU24339.1|  unknown                                                 192   1e-56   Glycine max [soybeans]
ref|XP_010538909.1|  PREDICTED: UDP-galactose transporter 2-like        194   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_006284088.1|  hypothetical protein CARUB_v10005218mg             193   1e-56   Capsella rubella
ref|XP_011025571.1|  PREDICTED: UDP-galactose transporter 2             194   1e-56   Populus euphratica
gb|ACN28164.1|  unknown                                                 190   2e-56   Zea mays [maize]
gb|EMS67795.1|  hypothetical protein TRIUR3_18539                       191   2e-56   Triticum urartu
ref|XP_006434522.1|  hypothetical protein CICLE_v10001769mg             194   2e-56   Citrus clementina [clementine]
ref|XP_007137579.1|  hypothetical protein PHAVU_009G138400g             190   2e-56   Phaseolus vulgaris [French bean]
ref|XP_006411742.1|  hypothetical protein EUTSA_v10025667mg             193   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_004140956.1|  PREDICTED: UDP-galactose transporter 2-like        193   2e-56   Cucumis sativus [cucumbers]
ref|XP_010530127.1|  PREDICTED: UDP-galactose transporter 2             192   2e-56   Tarenaya hassleriana [spider flower]
emb|CDY42623.1|  BnaC01g00350D                                          192   2e-56   Brassica napus [oilseed rape]
emb|CDY12142.1|  BnaC03g60580D                                          192   2e-56   Brassica napus [oilseed rape]
gb|ACG35759.1|  integral membrane protein like                          193   3e-56   Zea mays [maize]
ref|XP_006654160.1|  PREDICTED: UDP-galactose transporter 2-like ...    190   3e-56   
ref|XP_010431909.1|  PREDICTED: UDP-galactose transporter 2-like ...    192   3e-56   Camelina sativa [gold-of-pleasure]
emb|CDY15303.1|  BnaC06g07890D                                          193   3e-56   Brassica napus [oilseed rape]
ref|XP_009109471.1|  PREDICTED: UDP-galactose transporter 2             192   3e-56   Brassica rapa
ref|XP_009119734.1|  PREDICTED: UDP-galactose transporter 2-like        192   3e-56   Brassica rapa
ref|XP_009114771.1|  PREDICTED: UDP-galactose transporter 2             193   3e-56   Brassica rapa
emb|CDX93736.1|  BnaA09g23360D                                          193   4e-56   
ref|XP_002307141.1|  transporter-related family protein                 191   4e-56   Populus trichocarpa [western balsam poplar]
emb|CDY28389.1|  BnaA05g18510D                                          193   4e-56   Brassica napus [oilseed rape]
ref|XP_006415048.1|  hypothetical protein EUTSA_v10008144mg             193   4e-56   Eutrema salsugineum [saltwater cress]
ref|NP_001131725.1|  integral membrane protein like protein isofo...    192   5e-56   Zea mays [maize]
ref|XP_003575354.1|  PREDICTED: UDP-galactose transporter 2-like        191   6e-56   Brachypodium distachyon [annual false brome]
ref|XP_010461221.1|  PREDICTED: UDP-galactose transporter 2-like        192   6e-56   Camelina sativa [gold-of-pleasure]
ref|NP_564433.1|  nucleotide-sugar transporter family protein           192   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305303.1|  hypothetical protein CARUB_v10009678mg             192   7e-56   Capsella rubella
ref|XP_002891071.1|  hypothetical protein ARALYDRAFT_473556             192   7e-56   
gb|KJB60019.1|  hypothetical protein B456_009G286100                    191   7e-56   Gossypium raimondii
gb|KHG03706.1|  UDP-galactose transporter 2 -like protein               192   8e-56   Gossypium arboreum [tree cotton]
gb|EEE62758.1|  hypothetical protein OsJ_17561                          188   8e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010555309.1|  PREDICTED: UDP-galactose transporter 2             189   8e-56   Tarenaya hassleriana [spider flower]
ref|XP_007151969.1|  hypothetical protein PHAVU_004G090700g             189   8e-56   Phaseolus vulgaris [French bean]
gb|AAM66068.1|  unknown                                                 192   9e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499941.1|  PREDICTED: UDP-galactose transporter 2             192   9e-56   Camelina sativa [gold-of-pleasure]
gb|KHG20906.1|  UDP-galactose transporter 2 -like protein               191   1e-55   Gossypium arboreum [tree cotton]
ref|XP_010904726.1|  PREDICTED: UDP-galactose transporter 2-like ...    189   1e-55   Elaeis guineensis
ref|XP_010904727.1|  PREDICTED: UDP-galactose transporter 2-like ...    189   1e-55   
ref|XP_010437993.1|  PREDICTED: UDP-galactose transporter 2-like        191   1e-55   Camelina sativa [gold-of-pleasure]
gb|EYU30281.1|  hypothetical protein MIMGU_mgv1a009610mg                188   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_004496438.1|  PREDICTED: UDP-galactose transporter 2-like        187   2e-55   Cicer arietinum [garbanzo]
ref|XP_002310620.1|  transporter-related family protein                 191   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010678762.1|  PREDICTED: UDP-galactose transporter 2-like        191   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004953102.1|  PREDICTED: UDP-galactose transporter 2-like        189   3e-55   Setaria italica
ref|XP_009145156.1|  PREDICTED: UDP-galactose transporter 2-like        191   3e-55   Brassica rapa
ref|XP_006589484.1|  PREDICTED: UDP-galactose transporter 2-like ...    189   4e-55   Glycine max [soybeans]
ref|XP_010262105.1|  PREDICTED: UDP-galactose transporter 2-like ...    187   4e-55   Nelumbo nucifera [Indian lotus]
ref|NP_001149060.1|  integral membrane protein like                     190   5e-55   
tpg|DAA63396.1|  TPA: putative integral membrane protein                189   5e-55   
ref|XP_003630136.1|  Membrane protein, putative                         190   5e-55   Medicago truncatula
ref|XP_011021966.1|  PREDICTED: UDP-galactose transporter 2-like        189   9e-55   Populus euphratica
emb|CAB44674.1|  putative protein                                       187   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683206.1|  PREDICTED: UDP-galactose transporter 2-like        189   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002307514.1|  transporter-related family protein                 189   2e-54   Populus trichocarpa [western balsam poplar]
ref|NP_001054935.1|  Os05g0215800                                       188   2e-54   
ref|NP_192719.1|  Nucleotide-sugar transporter family protein           188   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531423.1|  PREDICTED: UDP-galactose transporter 2-like        186   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_006290034.1|  hypothetical protein CARUB_v10003668mg             188   3e-54   Capsella rubella
ref|XP_009419689.1|  PREDICTED: UDP-galactose transporter 2-like        186   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842618.1|  hypothetical protein AMTR_s00077p00178780          187   4e-54   
ref|XP_002866846.1|  hypothetical protein ARALYDRAFT_327889             185   4e-54   
emb|CDY05079.1|  BnaC03g28770D                                          189   7e-54   
ref|XP_010680321.1|  PREDICTED: UDP-galactose transporter 2             182   7e-54   
ref|XP_011044274.1|  PREDICTED: UDP-galactose transporter 2             187   7e-54   Populus euphratica
ref|XP_007143575.1|  hypothetical protein PHAVU_007G083300g             182   1e-53   Phaseolus vulgaris [French bean]
dbj|BAE98980.1|  hypothetical protein                                   186   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421887.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-galactos...    186   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_003580096.1|  PREDICTED: UDP-galactose transporter 2-like        185   3e-53   Brachypodium distachyon [annual false brome]
ref|XP_009134166.1|  PREDICTED: UDP-galactose transporter 2-like        185   4e-53   Brassica rapa
gb|EYU24057.1|  hypothetical protein MIMGU_mgv1a009794mg                184   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_009406813.1|  PREDICTED: UDP-galactose transporter 2-like        180   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX90737.1|  BnaA03g24170D                                          185   1e-52   
gb|ABR25336.1|  putative transporter                                    179   2e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_006663829.1|  PREDICTED: UDP-galactose transporter 2-like        179   2e-52   Oryza brachyantha
ref|XP_011100915.1|  PREDICTED: UDP-galactose transporter 2-like        182   2e-52   Sesamum indicum [beniseed]
ref|NP_001066187.1|  Os12g0154600                                       179   2e-52   
gb|ABG21891.1|  transporter, putative, expressed                        178   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982861.1|  PREDICTED: UDP-galactose transporter 2-like        178   3e-52   Setaria italica
ref|XP_002450200.1|  hypothetical protein SORBIDRAFT_05g001870          178   3e-52   Sorghum bicolor [broomcorn]
gb|ACF86881.1|  unknown                                                 178   3e-52   Zea mays [maize]
gb|AFW64703.1|  integral membrane protein like protein isoform 1        178   3e-52   
gb|ACF80912.1|  unknown                                                 178   4e-52   Zea mays [maize]
ref|XP_002874590.1|  hypothetical protein ARALYDRAFT_489833             182   4e-52   
gb|AFW64701.1|  hypothetical protein ZEAMMB73_900572                    178   4e-52   
ref|XP_006663828.1|  PREDICTED: UDP-galactose transporter 2-like        177   6e-52   Oryza brachyantha
gb|EMT00653.1|  hypothetical protein F775_29393                         181   7e-52   
dbj|BAJ85267.1|  predicted protein                                      181   8e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN31946.1|  unknown                                                 177   8e-52   Zea mays [maize]
ref|NP_001148538.1|  integral membrane protein like                     177   9e-52   Zea mays [maize]
ref|XP_003592056.1|  Membrane protein, putative                         175   1e-51   
ref|XP_008667952.1|  PREDICTED: integral membrane protein like is...    176   1e-51   Zea mays [maize]
emb|CAN72212.1|  hypothetical protein VITISV_012257                     171   2e-51   Vitis vinifera
ref|NP_001150661.1|  integral membrane protein like                     176   2e-51   Zea mays [maize]
ref|XP_004977451.1|  PREDICTED: UDP-galactose transporter 2-like        179   4e-51   Setaria italica
ref|XP_002441741.1|  hypothetical protein SORBIDRAFT_08g001580          174   5e-51   Sorghum bicolor [broomcorn]
ref|XP_002969143.1|  hypothetical protein SELMODRAFT_170422             176   6e-51   
ref|XP_004504000.1|  PREDICTED: UDP-galactose transporter 2-like        173   1e-50   
gb|EMS68535.1|  hypothetical protein TRIUR3_30184                       181   2e-50   Triticum urartu
ref|XP_004978448.1|  PREDICTED: UDP-galactose transporter 2-like        176   2e-50   Setaria italica
ref|XP_004976151.1|  PREDICTED: UDP-galactose transporter 2-like        176   1e-49   Setaria italica
ref|XP_008646624.1|  PREDICTED: uncharacterized protein LOC103628142    175   2e-49   
gb|ABA95848.2|  transporter, putative, expressed                        163   8e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008672973.1|  PREDICTED: integral membrane protein like is...    165   6e-47   Zea mays [maize]
gb|KCW45407.1|  hypothetical protein EUGRSUZ_L00902                     162   1e-46   Eucalyptus grandis [rose gum]
ref|NP_001150996.1|  integral membrane protein like                     164   2e-46   Zea mays [maize]
ref|XP_002524332.1|  conserved hypothetical protein                     159   5e-46   
ref|NP_001066185.1|  Os12g0154000                                       154   6e-45   
ref|XP_003578985.1|  PREDICTED: UDP-galactose transporter 2-like        149   4e-43   Brachypodium distachyon [annual false brome]
gb|EMT23032.1|  hypothetical protein F775_28662                         149   5e-43   
dbj|BAJ95945.1|  predicted protein                                      150   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW73131.1|  hypothetical protein EUGRSUZ_E01586                     150   5e-42   Eucalyptus grandis [rose gum]
gb|EPS64409.1|  hypothetical protein M569_10371                         147   5e-41   Genlisea aurea
ref|XP_006427931.1|  hypothetical protein CICLE_v10026818mg             145   1e-40   
gb|KDO57103.1|  hypothetical protein CISIN_1g045581mg                   145   1e-40   Citrus sinensis [apfelsine]
emb|CDY43897.1|  BnaA07g01740D                                          155   3e-40   Brassica napus [oilseed rape]
ref|XP_010444889.1|  PREDICTED: UDP-galactose transporter 2             147   2e-39   Camelina sativa [gold-of-pleasure]
gb|AFK44295.1|  unknown                                                 140   9e-39   Medicago truncatula
gb|EYU31110.1|  hypothetical protein MIMGU_mgv1a0096512mg               140   1e-38   Erythranthe guttata [common monkey flower]
ref|XP_002467076.1|  hypothetical protein SORBIDRAFT_01g019245          135   2e-36   
gb|EMS65678.1|  hypothetical protein TRIUR3_32365                       123   3e-35   Triticum urartu
gb|KDO83810.1|  hypothetical protein CISIN_1g045440mg                   128   8e-34   Citrus sinensis [apfelsine]
gb|EYU41229.1|  hypothetical protein MIMGU_mgv1a009117mg                130   7e-33   Erythranthe guttata [common monkey flower]
gb|EPS61546.1|  hypothetical protein M569_13251                         127   3e-31   Genlisea aurea
ref|XP_004139986.1|  PREDICTED: UDP-galactose transporter 2-like        124   1e-30   Cucumis sativus [cucumbers]
ref|XP_004154521.1|  PREDICTED: UDP-galactose transporter 2-like        123   2e-30   
ref|XP_008448146.1|  PREDICTED: UDP-galactose transporter 2-like        122   3e-30   Cucumis melo [Oriental melon]
gb|KJB77442.1|  hypothetical protein B456_012G137400                    119   8e-30   Gossypium raimondii
gb|KJB31920.1|  hypothetical protein B456_005G214900                    119   1e-29   Gossypium raimondii
gb|KJB31917.1|  hypothetical protein B456_005G214900                    119   2e-29   Gossypium raimondii
gb|EPS67006.1|  hypothetical protein M569_07768                         122   2e-29   Genlisea aurea
gb|KJB31919.1|  hypothetical protein B456_005G214900                    119   2e-29   Gossypium raimondii
ref|XP_010061361.1|  PREDICTED: UDP-galactose transporter 2-like        119   3e-29   Eucalyptus grandis [rose gum]
ref|XP_010932187.1|  PREDICTED: UDP-galactose transporter 2             117   3e-29   Elaeis guineensis
ref|XP_008796458.1|  PREDICTED: UDP-galactose transporter 2             118   4e-29   Phoenix dactylifera
gb|KEH27299.1|  nucleotide/sugar transporter family protein             118   7e-29   Medicago truncatula
ref|XP_007043141.1|  Nucleotide-sugar transporter family protein ...    117   7e-29   
ref|XP_010270661.1|  PREDICTED: UDP-galactose transporter 2-like        116   8e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010474368.1|  PREDICTED: UDP-galactose transporter 2-like        119   9e-29   Camelina sativa [gold-of-pleasure]
gb|KHG20996.1|  UDP-galactose transporter 2 -like protein               115   1e-28   Gossypium arboreum [tree cotton]
gb|KHG16230.1|  UDP-galactose transporter 2 -like protein               119   1e-28   Gossypium arboreum [tree cotton]
gb|KJB47139.1|  hypothetical protein B456_008G012200                    116   1e-28   Gossypium raimondii
gb|KHG19793.1|  UDP-galactose transporter 2 -like protein               116   2e-28   Gossypium arboreum [tree cotton]
ref|XP_011034738.1|  PREDICTED: UDP-galactose transporter 2             115   3e-28   Populus euphratica
ref|XP_011074037.1|  PREDICTED: UDP-galactose transporter 2             116   3e-28   Sesamum indicum [beniseed]
ref|XP_008796579.1|  PREDICTED: UDP-galactose transporter 2             114   3e-28   Phoenix dactylifera
ref|XP_002307836.1|  transporter-related family protein                 115   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006429818.1|  hypothetical protein CICLE_v10013865mg             115   4e-28   
ref|XP_002300605.1|  transporter-related family protein                 115   4e-28   Populus trichocarpa [western balsam poplar]
emb|CDP07234.1|  unnamed protein product                                119   5e-28   Coffea canephora [robusta coffee]
ref|XP_011041092.1|  PREDICTED: UDP-galactose transporter 2             114   5e-28   Populus euphratica
ref|XP_010428732.1|  PREDICTED: UDP-galactose transporter 2             118   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010416591.1|  PREDICTED: UDP-galactose transporter 2-like        118   6e-28   Camelina sativa [gold-of-pleasure]
ref|NP_565138.1|  Nucleotide-sugar transporter family protein           118   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008346270.1|  PREDICTED: UDP-galactose transporter 2-like        112   1e-27   
ref|XP_009396888.1|  PREDICTED: UDP-galactose transporter 2-like        117   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927487.1|  PREDICTED: UDP-galactose transporter 2 isofo...    112   1e-27   Elaeis guineensis
ref|XP_001754967.1|  predicted protein                                  112   1e-27   
ref|XP_010529061.1|  PREDICTED: UDP-galactose transporter 2-like        113   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_002889095.1|  hypothetical protein ARALYDRAFT_476826             117   2e-27   
ref|XP_001769568.1|  predicted protein                                  114   2e-27   
ref|XP_009149587.1|  PREDICTED: UDP-galactose transporter 2-like ...    117   2e-27   
ref|XP_011458117.1|  PREDICTED: UDP-galactose transporter 2-like        114   2e-27   Fragaria vesca subsp. vesca
ref|XP_007018603.1|  Nucleotide-sugar transporter family protein        112   2e-27   
gb|EPS70342.1|  hypothetical protein M569_04417                         117   2e-27   Genlisea aurea
ref|XP_010684399.1|  PREDICTED: UDP-galactose transporter 2-like        112   2e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP36706.1|  hypothetical protein JCGZ_07997                         117   2e-27   Jatropha curcas
ref|XP_006302481.1|  hypothetical protein CARUB_v10020575mg             117   3e-27   Capsella rubella
ref|XP_009149586.1|  PREDICTED: UDP-galactose transporter 2-like ...    117   3e-27   Brassica rapa
gb|KEH40271.1|  nucleotide/sugar transporter family protein             113   3e-27   Medicago truncatula
ref|XP_010537259.1|  PREDICTED: UDP-galactose transporter 2             116   4e-27   Tarenaya hassleriana [spider flower]
ref|XP_010094477.1|  hypothetical protein L484_024768                   116   5e-27   Morus notabilis
ref|XP_004150968.1|  PREDICTED: UDP-galactose transporter 2-like        116   5e-27   Cucumis sativus [cucumbers]
ref|XP_010266319.1|  PREDICTED: UDP-galactose transporter 2-like        111   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_008349027.1|  PREDICTED: UDP-galactose transporter 2-like        113   6e-27   
ref|XP_009414762.1|  PREDICTED: UDP-galactose transporter 2-like        114   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY29480.1|  BnaA06g14900D                                          115   7e-27   Brassica napus [oilseed rape]
ref|XP_004511275.1|  PREDICTED: UDP-galactose transporter 2-like ...    115   8e-27   Cicer arietinum [garbanzo]
ref|XP_006342521.1|  PREDICTED: UDP-galactose transporter 2-like        115   8e-27   Solanum tuberosum [potatoes]
ref|XP_008235850.1|  PREDICTED: UDP-galactose transporter 2-like        115   8e-27   Prunus mume [ume]
ref|XP_008453042.1|  PREDICTED: UDP-galactose transporter 2-like        115   8e-27   Cucumis melo [Oriental melon]
ref|XP_010939035.1|  PREDICTED: UDP-galactose transporter 2-like        113   9e-27   Elaeis guineensis
ref|XP_009408432.1|  PREDICTED: UDP-galactose transporter 2-like ...    115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007199951.1|  hypothetical protein PRUPE_ppb006058mg             115   1e-26   
ref|XP_009408433.1|  PREDICTED: UDP-galactose transporter 2-like ...    115   1e-26   
dbj|BAC42299.1|  unknown protein                                        114   1e-26   
ref|XP_009607659.1|  PREDICTED: UDP-galactose transporter 2             114   1e-26   
ref|XP_008235851.1|  PREDICTED: UDP-galactose transporter 2-like        114   1e-26   
ref|NP_564133.1|  nucleotide-sugar transporter-like protein             114   1e-26   
gb|AAM61035.1|  unknown                                                 114   2e-26   
ref|XP_008795633.1|  PREDICTED: UDP-galactose transporter 2-like        114   2e-26   
ref|XP_006492897.1|  PREDICTED: UDP-galactose transporter 2-like        114   2e-26   
ref|XP_006429823.1|  hypothetical protein CICLE_v10012072mg             114   2e-26   
gb|KFK42080.1|  hypothetical protein AALP_AA2G208600                    114   2e-26   
gb|EYU36617.1|  hypothetical protein MIMGU_mgv1a009294mg                114   2e-26   
ref|XP_007200355.1|  hypothetical protein PRUPE_ppa008188mg             114   2e-26   
ref|XP_010943153.1|  PREDICTED: UDP-galactose transporter 2-like        114   2e-26   
ref|NP_001242197.1|  uncharacterized protein LOC100780365               114   3e-26   
gb|KHN12124.1|  UDP-galactose transporter 2                             114   3e-26   
ref|XP_009386154.1|  PREDICTED: UDP-galactose transporter 2-like        113   4e-26   
ref|XP_006416334.1|  hypothetical protein EUTSA_v10008081mg             113   4e-26   
gb|KHN05614.1|  UDP-galactose transporter 2                             113   4e-26   
ref|XP_006590383.1|  PREDICTED: UDP-galactose transporter 2-like        113   4e-26   
ref|XP_008778573.1|  PREDICTED: UDP-galactose transporter 2-like        113   4e-26   
ref|XP_002510764.1|  organic anion transporter, putative                113   5e-26   
gb|KFK44204.1|  hypothetical protein AALP_AA1G228100                    113   5e-26   
ref|XP_006305238.1|  hypothetical protein CARUB_v10009605mg             113   6e-26   
ref|XP_009110198.1|  PREDICTED: UDP-galactose transporter 2-like        113   6e-26   
emb|CDY33666.1|  BnaC08g19660D                                          113   6e-26   
ref|XP_004253110.1|  PREDICTED: UDP-galactose transporter 2             112   7e-26   
ref|XP_006390165.1|  hypothetical protein EUTSA_v10018800mg             112   7e-26   
dbj|BAJ33722.1|  unnamed protein product                                112   7e-26   
ref|XP_010477366.1|  PREDICTED: UDP-galactose transporter 2-like        112   8e-26   
emb|CDX71559.1|  BnaC04g17940D                                          108   9e-26   
ref|XP_008382528.1|  PREDICTED: UDP-galactose transporter 2-like        112   9e-26   
ref|XP_010459808.1|  PREDICTED: UDP-galactose transporter 2-like        112   9e-26   
ref|XP_010498559.1|  PREDICTED: UDP-galactose transporter 2-like        112   9e-26   
ref|XP_002893149.1|  hypothetical protein ARALYDRAFT_889562             112   1e-25   
gb|KDO85328.1|  hypothetical protein CISIN_1g019191mg                   110   1e-25   
ref|XP_010504505.1|  PREDICTED: uncharacterized protein LOC104781...    112   2e-25   
ref|XP_010504506.1|  PREDICTED: uncharacterized protein LOC104781...    112   2e-25   
ref|XP_002514380.1|  organic anion transporter, putative                112   2e-25   
ref|XP_009358925.1|  PREDICTED: UDP-galactose transporter 2-like        111   2e-25   
ref|XP_010504508.1|  PREDICTED: uncharacterized protein LOC104781...    112   2e-25   
ref|XP_010504507.1|  PREDICTED: uncharacterized protein LOC104781...    112   2e-25   
ref|XP_004511276.1|  PREDICTED: UDP-galactose transporter 2-like ...    111   2e-25   
ref|XP_004300063.1|  PREDICTED: UDP-galactose transporter 2-like        111   2e-25   
emb|CAN61451.1|  hypothetical protein VITISV_009021                     108   2e-25   
ref|XP_007157247.1|  hypothetical protein PHAVU_002G054900g             111   3e-25   
ref|XP_010533408.1|  PREDICTED: UDP-galactose transporter 2-like        111   3e-25   
ref|XP_001754835.1|  predicted protein                                  111   3e-25   
ref|XP_006849892.1|  hypothetical protein AMTR_s00022p00090650          104   3e-25   
ref|XP_003562824.2|  PREDICTED: UDP-galactose transporter 2-like        110   4e-25   
ref|XP_005644080.1|  TPT-domain-containing protein                      110   5e-25   
gb|KDD74704.1|  hypothetical protein H632_c1124p1                       110   6e-25   
ref|XP_006435519.1|  hypothetical protein CICLE_v10001709mg             110   6e-25   
ref|XP_001762447.1|  predicted protein                                  110   6e-25   
ref|XP_001760216.1|  predicted protein                                  110   6e-25   
gb|KIZ02346.1|  hypothetical protein MNEG_5616                          108   6e-25   
ref|XP_004958132.1|  PREDICTED: UDP-galactose transporter 2-like        108   7e-25   
ref|XP_010090745.1|  hypothetical protein L484_013767                   110   7e-25   
ref|XP_002865527.1|  hypothetical protein ARALYDRAFT_917531             110   8e-25   
ref|NP_001078689.1|  Nucleotide-sugar transporter family protein        108   1e-24   
ref|NP_001060103.1|  Os07g0581000                                       107   2e-24   
ref|XP_008651781.1|  PREDICTED: uncharacterized protein LOC100384...    107   2e-24   
ref|NP_199057.1|  Nucleotide-sugar transporter family protein           108   2e-24   
gb|KDP47057.1|  hypothetical protein JCGZ_10784                         108   2e-24   
gb|EMS67132.1|  hypothetical protein TRIUR3_26161                       107   2e-24   
ref|XP_006403391.1|  hypothetical protein EUTSA_v10003241mg             108   2e-24   
gb|EMT30396.1|  hypothetical protein F775_27931                         107   2e-24   
ref|XP_006279494.1|  hypothetical protein CARUB_v10026693mg             108   2e-24   
ref|XP_002278064.1|  PREDICTED: UDP-galactose transporter 2             108   2e-24   
ref|XP_010555797.1|  PREDICTED: UDP-galactose transporter 2-like        108   2e-24   
gb|EAZ04474.1|  hypothetical protein OsI_26622                          107   2e-24   
ref|XP_006657883.1|  PREDICTED: UDP-galactose transporter 2-like        106   2e-24   
ref|NP_001241748.1|  integral membrane protein like                     106   2e-24   
ref|NP_001170519.1|  integral membrane protein like protein             106   2e-24   
gb|ACL54282.1|  unknown                                                 106   3e-24   
gb|ACN29131.1|  unknown                                                 106   3e-24   
ref|XP_001762353.1|  predicted protein                                  108   3e-24   
ref|NP_001150491.1|  LOC100284122                                       105   4e-24   
ref|XP_009407105.1|  PREDICTED: uncharacterized protein LOC103989887  81.6    4e-24   
ref|XP_010442167.1|  PREDICTED: UDP-galactose transporter 2-like        107   5e-24   
ref|XP_009113448.1|  PREDICTED: UDP-galactose transporter 2             107   6e-24   
emb|CDX95180.1|  BnaC09g16900D                                          107   6e-24   
emb|CDY52304.1|  BnaA09g16160D                                          107   6e-24   
gb|KFK32924.1|  hypothetical protein AALP_AA6G307000                    107   7e-24   
ref|XP_010494178.1|  PREDICTED: UDP-galactose transporter 2-like        107   7e-24   
ref|XP_010063200.1|  PREDICTED: UDP-galactose transporter 2-like ...    107   8e-24   
emb|CDY04594.1|  BnaC05g16320D                                          103   9e-24   
ref|XP_010063199.1|  PREDICTED: UDP-galactose transporter 2-like ...    107   9e-24   
ref|XP_011395902.1|  UDP-galactose transporter 2                        106   9e-24   
ref|XP_002969958.1|  hypothetical protein SELMODRAFT_92835              103   1e-23   
ref|XP_002463085.1|  hypothetical protein SORBIDRAFT_02g037520          106   2e-23   
ref|XP_010481989.1|  PREDICTED: UDP-galactose transporter 2-like        103   1e-22   
ref|XP_008235920.1|  PREDICTED: UDP-galactose transporter 2-like      99.0    2e-22   
ref|XP_002957142.1|  hypothetical protein VOLCADRAFT_98177              103   2e-22   
emb|CDX87574.1|  BnaA07g32990D                                          102   3e-22   
emb|CDX88307.1|  BnaC06g37510D                                          102   3e-22   
ref|XP_009106334.1|  PREDICTED: UDP-galactose transporter 2             102   3e-22   
ref|XP_005848787.1|  hypothetical protein CHLNCDRAFT_16992              101   4e-22   
ref|XP_001697384.1|  hypothetical protein CHLREDRAFT_120386             101   7e-22   
ref|XP_007200195.1|  hypothetical protein PRUPE_ppa016081mg           97.1    7e-22   
ref|XP_004953165.1|  PREDICTED: uncharacterized membrane protein ...    101   8e-22   
ref|XP_009771257.1|  PREDICTED: uncharacterized membrane protein ...    101   1e-21   
gb|AES67513.2|  nucleotide/sugar transporter family protein           99.4    4e-21   
ref|XP_009594518.1|  PREDICTED: uncharacterized membrane protein ...  99.4    4e-21   
ref|XP_003597262.1|  Membrane protein, putative                       99.4    4e-21   
ref|XP_002500152.1|  hypothetical protein MICPUN_113801               99.0    6e-21   
gb|ACN30572.1|  unknown                                               96.3    9e-21   
gb|EEC80701.1|  hypothetical protein OsI_23132                        97.8    1e-20   
ref|XP_010670628.1|  PREDICTED: uncharacterized membrane protein ...  97.4    2e-20   
ref|XP_004982847.1|  PREDICTED: uncharacterized membrane protein ...  97.8    2e-20   
ref|XP_006656119.1|  PREDICTED: uncharacterized membrane protein ...  97.4    2e-20   
ref|XP_004982846.1|  PREDICTED: uncharacterized membrane protein ...  97.4    2e-20   
ref|XP_010685974.1|  PREDICTED: uncharacterized membrane protein ...  97.4    2e-20   
ref|XP_004982843.1|  PREDICTED: uncharacterized membrane protein ...  97.4    2e-20   
ref|XP_004982842.1|  PREDICTED: uncharacterized membrane protein ...  97.4    3e-20   
gb|AFW72417.1|  hypothetical protein ZEAMMB73_346029                  96.7    3e-20   
ref|XP_004240867.1|  PREDICTED: uncharacterized membrane protein ...  96.7    4e-20   
ref|XP_008644087.1|  PREDICTED: hypothetical protein isoform X1       96.7    4e-20   
ref|NP_001169693.1|  hypothetical protein                             96.3    4e-20   
ref|XP_006358754.1|  PREDICTED: uncharacterized membrane protein ...  96.3    6e-20   
ref|XP_001694868.1|  hypothetical protein CHLREDRAFT_130256           95.9    6e-20   
gb|AFW81416.1|  hypothetical protein ZEAMMB73_467354                  95.1    6e-20   
gb|AFK39471.1|  unknown                                               94.0    6e-20   
ref|XP_008661436.1|  PREDICTED: uncharacterized protein LOC100193...  95.9    6e-20   
ref|NP_001132403.1|  uncharacterized protein LOC100193850             95.9    6e-20   
ref|NP_001131257.1|  hypothetical protein                             95.9    7e-20   
ref|XP_009354787.1|  PREDICTED: uncharacterized membrane protein ...  95.5    9e-20   
gb|AFW81415.1|  hypothetical protein ZEAMMB73_467354                  95.1    9e-20   
ref|XP_009035981.1|  hypothetical protein AURANDRAFT_3854             95.1    1e-19   
gb|ACG46197.1|  integral membrane protein like                        95.5    1e-19   
ref|NP_001054756.1|  Os05g0168700                                     95.5    1e-19   
ref|XP_006846794.1|  hypothetical protein AMTR_s00148p00057680        95.1    1e-19   
ref|XP_003057785.1|  Drug/Metabolite transporter superfamily          95.1    1e-19   
ref|XP_010927488.1|  PREDICTED: UDP-galactose transporter 2 isofo...  85.9    1e-19   
emb|CDP13914.1|  unnamed protein product                              95.1    1e-19   
gb|ABV59990.1|  putative integral membrane protein                    95.1    1e-19   
dbj|BAK03308.1|  predicted protein                                    95.1    1e-19   
ref|XP_004968311.1|  PREDICTED: uncharacterized membrane protein ...  95.1    1e-19   
gb|EMT13991.1|  hypothetical protein F775_09445                       94.7    1e-19   
ref|XP_004968310.1|  PREDICTED: uncharacterized membrane protein ...  95.1    1e-19   
ref|NP_001142171.1|  hypothetical protein                             94.7    2e-19   
ref|NP_001047487.1|  Os02g0628200                                     94.7    2e-19   
ref|NP_001148556.1|  integral membrane protein like                   94.4    2e-19   
dbj|BAJ92504.1|  predicted protein                                    94.7    2e-19   
dbj|BAK03473.1|  predicted protein                                    94.7    2e-19   
ref|XP_004960791.1|  PREDICTED: uncharacterized membrane protein ...  94.7    2e-19   
ref|XP_003568846.1|  PREDICTED: uncharacterized membrane protein ...  94.4    2e-19   
gb|AFW77154.1|  hypothetical protein ZEAMMB73_211701                  94.0    2e-19   
gb|ACN32013.1|  unknown                                               94.4    2e-19   
ref|XP_002440680.1|  hypothetical protein SORBIDRAFT_09g005010        94.4    2e-19   
gb|KEH35570.1|  nucleotide/sugar transporter family protein           94.4    2e-19   
ref|XP_002529937.1|  UDP-glucuronic acid/UDP-N-acetylgalactosamin...  94.4    2e-19   
ref|XP_006655034.1|  PREDICTED: uncharacterized membrane protein ...  94.4    2e-19   
ref|XP_004976248.1|  PREDICTED: uncharacterized membrane protein ...  94.4    2e-19   
ref|XP_002467070.1|  hypothetical protein SORBIDRAFT_01g019150        94.4    3e-19   
ref|XP_003526814.1|  PREDICTED: uncharacterized membrane protein ...  94.4    3e-19   
ref|XP_006661865.1|  PREDICTED: uncharacterized membrane protein ...  94.4    3e-19   
ref|XP_006578827.1|  PREDICTED: uncharacterized membrane protein ...  94.4    3e-19   
ref|XP_006647547.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-19   
gb|EYU46015.1|  hypothetical protein MIMGU_mgv1a009125mg              94.0    3e-19   
ref|XP_006578825.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-19   
gb|AAG13577.1|AC037425_8  putative glucose-6-phosphate/phosphate-...  94.0    3e-19   
ref|XP_003526815.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-19   
ref|XP_011021021.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-19   
ref|NP_001136826.1|  uncharacterized protein LOC100216974             93.6    3e-19   
ref|XP_004502852.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-19   
ref|XP_007048170.1|  Nucleotide-sugar transporter family protein ...  68.6    3e-19   
ref|XP_008242248.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-19   
ref|XP_006350881.1|  PREDICTED: uncharacterized membrane protein ...  94.0    3e-19   
gb|AFW77153.1|  hypothetical protein ZEAMMB73_211701                  93.2    4e-19   
ref|XP_009602100.1|  PREDICTED: uncharacterized membrane protein ...  93.6    4e-19   
gb|EEC67179.1|  hypothetical protein OsI_34047                        94.0    4e-19   
gb|KJB56163.1|  hypothetical protein B456_009G108100                  92.8    4e-19   
dbj|BAB41206.1|  putative glucose-6-phosphate/phosphate-tranlocat or  93.6    4e-19   
ref|NP_001064870.1|  Os10g0479700                                     93.6    4e-19   
gb|AFW77152.1|  hypothetical protein ZEAMMB73_211701                  93.2    5e-19   
ref|XP_006376553.1|  hypothetical protein POPTR_0013s15090g           93.6    5e-19   
ref|NP_001042121.1|  Os01g0167500                                     93.6    5e-19   
ref|XP_011461421.1|  PREDICTED: uncharacterized membrane protein ...  93.2    5e-19   
gb|KHG14117.1|  hypothetical protein F383_19012                       93.2    5e-19   
gb|KHG05327.1|  hypothetical protein F383_31168                       93.2    5e-19   
ref|XP_002446793.1|  hypothetical protein SORBIDRAFT_06g022790        93.2    5e-19   
ref|XP_009791538.1|  PREDICTED: uncharacterized membrane protein ...  93.2    6e-19   
ref|XP_004502851.1|  PREDICTED: uncharacterized membrane protein ...  92.8    6e-19   
ref|XP_006643793.1|  PREDICTED: uncharacterized membrane protein ...  93.2    6e-19   
gb|ACN32180.1|  unknown                                               93.2    6e-19   
gb|KJB20306.1|  hypothetical protein B456_003G142900                  93.2    6e-19   
tpg|DAA49605.1|  TPA: hypothetical protein ZEAMMB73_360241            93.2    6e-19   
ref|XP_008654894.1|  PREDICTED: integral membrane protein like is...  93.2    6e-19   
gb|AFW80122.1|  integral membrane protein like protein                93.2    7e-19   
ref|XP_004242482.1|  PREDICTED: uncharacterized membrane protein ...  92.8    7e-19   
ref|XP_009110971.1|  PREDICTED: uncharacterized membrane protein ...  93.2    7e-19   
ref|XP_011080659.1|  PREDICTED: uncharacterized membrane protein ...  92.8    7e-19   
ref|XP_009118472.1|  PREDICTED: uncharacterized membrane protein ...  92.8    7e-19   
ref|XP_004251146.1|  PREDICTED: uncharacterized membrane protein ...  92.8    8e-19   
ref|XP_004294734.2|  PREDICTED: uncharacterized membrane protein ...  93.2    8e-19   
emb|CDY54885.1|  BnaA10g27970D                                        92.8    8e-19   
gb|KEH35569.1|  nucleotide/sugar transporter family protein           92.8    8e-19   
ref|XP_007207053.1|  hypothetical protein PRUPE_ppa007974mg           92.8    8e-19   
ref|XP_010542588.1|  PREDICTED: uncharacterized membrane protein ...  92.8    8e-19   
ref|NP_001142411.1|  putative integral membrane protein               92.8    8e-19   
ref|XP_011469983.1|  PREDICTED: uncharacterized membrane protein ...  92.8    8e-19   
ref|XP_006397142.1|  hypothetical protein EUTSA_v10029422mg           90.9    8e-19   
ref|XP_011469982.1|  PREDICTED: uncharacterized membrane protein ...  92.8    8e-19   
gb|KDP44037.1|  hypothetical protein JCGZ_05504                       92.8    8e-19   
emb|CDY15591.1|  BnaA08g28750D                                        92.8    9e-19   
emb|CDY10233.1|  BnaC05g04760D                                        92.8    9e-19   
ref|XP_004502850.1|  PREDICTED: uncharacterized membrane protein ...  92.8    9e-19   
ref|XP_006578824.1|  PREDICTED: uncharacterized membrane protein ...  92.8    9e-19   
emb|CDX86511.1|  BnaC08g01920D                                        92.8    9e-19   
ref|XP_009414259.1|  PREDICTED: uncharacterized membrane protein ...  92.8    9e-19   
ref|XP_006340182.1|  PREDICTED: uncharacterized membrane protein ...  92.4    9e-19   
gb|AFK37880.1|  unknown                                               89.4    9e-19   
ref|XP_006410146.1|  hypothetical protein EUTSA_v10016866mg           92.4    9e-19   
ref|XP_002881111.1|  hypothetical protein ARALYDRAFT_320800           92.4    1e-18   
ref|XP_010510642.1|  PREDICTED: uncharacterized membrane protein ...  92.4    1e-18   
ref|XP_007137616.1|  hypothetical protein PHAVU_009G141500g           92.4    1e-18   
ref|NP_001154542.1|  Nucleotide/sugar transporter family protein      92.4    1e-18   
ref|XP_010414550.1|  PREDICTED: uncharacterized membrane protein ...  92.4    1e-18   
ref|XP_010470102.1|  PREDICTED: uncharacterized membrane protein ...  92.4    1e-18   
gb|AFK34423.1|  unknown                                               89.0    1e-18   
ref|NP_001147222.1|  integral membrane protein like                   92.4    1e-18   
gb|ACF09415.1|  At2g28315                                             91.3    1e-18   



>ref|XP_004502879.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502880.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Cicer 
arietinum]
 ref|XP_004502881.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Cicer 
arietinum]
Length=335

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+K V AY Y L+++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLVGPFMDYWLTNKRVDAYDYGLTSILFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+NIQVVLGM IAI GMVWYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLFLGFIFFGKEGLNIQVVLGMAIAIAGMVWYGNASSKPGGKER  309


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSIGSFNLLG  190



>ref|XP_010242229.1| PREDICTED: UDP-galactose transporter 2-like [Nelumbo nucifera]
Length=335

 Score =   202 bits (513),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+K V A+ Y L AV  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPFLDYWLTNKRVDAFDYNLMAVLFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+QVVLGM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNLQVVLGMIIAVVGMIWYGNASSKPGGKER  309


 Score = 57.8 bits (138),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAFVAVWSTSLQQYYVHFLQRKYSLGSFNLLG  190



>emb|CBI21537.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   200 bits (509),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLL+GP  D WLT+K V  Y Y+L +V  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLLGPFLDYWLTNKRVDNYQYSLISVMFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVL LGFLFFGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVIGHMKTILVLILGFLFFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  309


 Score = 59.3 bits (142),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  STALQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAFVAVWSTALQQYYVHFLQRKYSLGSFNLLG  190



>ref|XP_002278813.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
 ref|XP_010652877.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
 ref|XP_010652878.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
Length=337

 Score =   200 bits (509),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLL+GP  D WLT+K V  Y Y+L +V  I+LSCTIA+GTNLSQFICIGR
Sbjct  192  GHTAPVQAASLLLLGPFLDYWLTNKRVDNYQYSLISVMFIILSCTIAVGTNLSQFICIGR  251

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVL LGFLFFGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  252  FTAVSFQVIGHMKTILVLILGFLFFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  311


 Score = 59.3 bits (142),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  STALQQYYVH LQRKYSLGSFNLLG
Sbjct  161  AAFVAVWSTALQQYYVHFLQRKYSLGSFNLLG  192



>ref|XP_009797956.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
Length=338

 Score =   199 bits (506),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QA SLLL GP+ D WLT+K V AY+YT  ++  I+LSCTIAIGTNLSQFICIGR
Sbjct  195  GHTAPIQATSLLLTGPLVDYWLTEKRVDAYNYTSISLFFIILSCTIAIGTNLSQFICIGR  254

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGFLFFGKEG+N+ VV GM IAIVGM+WYGNASS+ GGKER
Sbjct  255  FTAVTFQVLGHMKTILVLILGFLFFGKEGLNLHVVFGMSIAIVGMIWYGNASSQPGGKER  314

Query  202  V  200
            +
Sbjct  315  L  315


 Score = 59.7 bits (143),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  STALQQYYVH LQRKYSLGSFNLLG
Sbjct  164  AAFIAVWSTALQQYYVHFLQRKYSLGSFNLLG  195



>ref|XP_009630891.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana tomentosiformis]
Length=338

 Score =   199 bits (506),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QA SLLL GP+ D WLT+K V AY+YT  ++  I+LSCTIAIGTNLSQFICIGR
Sbjct  195  GHTAPIQATSLLLTGPLVDYWLTEKRVDAYNYTSISLFFIILSCTIAIGTNLSQFICIGR  254

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGFLFFGKEG+N+ VV GM IAIVGM+WYGNASS+ GGKER
Sbjct  255  FTAVTFQVLGHMKTILVLILGFLFFGKEGLNLHVVFGMSIAIVGMIWYGNASSQPGGKER  314

Query  202  V  200
            +
Sbjct  315  L  315


 Score = 59.7 bits (143),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  STALQQYYVH LQRKYSLGSFNLLG
Sbjct  164  AAFIAVWSTALQQYYVHFLQRKYSLGSFNLLG  195



>ref|XP_006357353.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006357354.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Solanum 
tuberosum]
Length=337

 Score =   201 bits (511),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QA SLLL+GP  D WLTDK V AY+YT  ++  IVLSCTIAIGTNLSQFICIGR
Sbjct  195  AHTAPIQATSLLLLGPFCDYWLTDKRVDAYNYTSISLFFIVLSCTIAIGTNLSQFICIGR  254

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGFLFFGKEG+N+ VV GMG+AIVGM+WYGNASS+ GGKER
Sbjct  255  FTAVTFQVLGHMKTILVLILGFLFFGKEGLNLHVVFGMGVAIVGMIWYGNASSQPGGKER  314

Query  202  V  200
            +
Sbjct  315  I  315


 Score = 57.4 bits (137),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AAFIA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  164  AAFIAVWSTALQQYYVHYLQRKYSLGSFNLL  194



>ref|XP_008378692.1| PREDICTED: UDP-galactose transporter 2-like [Malus domestica]
Length=332

 Score =   202 bits (514),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP  D WLT+K V AY Y L ++SLIVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPFLDYWLTNKIVYAYDYHLISLSLIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNLQVVLGMFIAILGMIWYGNASSKPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 55.8 bits (133),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AALVAVWSTALQQHYVHSLQRKYSLGSFNLLG  190



>ref|XP_009345238.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009345239.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
Length=332

 Score =   202 bits (514),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP  D WLT+K V AY Y L ++SLIVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPFLDYWLTNKIVYAYDYHLISMSLIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNLQVVLGMFIAILGMIWYGNASSKPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 55.8 bits (133),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AALVAVWSTALQQHYVHSLQRKYSLGSFNLLG  190



>ref|XP_004237478.1| PREDICTED: UDP-galactose transporter 2 [Solanum lycopersicum]
 ref|XP_010319795.1| PREDICTED: UDP-galactose transporter 2 [Solanum lycopersicum]
Length=337

 Score =   200 bits (509),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QA SLLL+GP  D WLTDK V AY+YT  ++  I+LSCTIAIGTNLSQFICIGR
Sbjct  195  AHTAPIQATSLLLLGPFCDYWLTDKRVDAYNYTSISLFFIILSCTIAIGTNLSQFICIGR  254

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGFLFFGKEG+N+ VV GMG+AI+GM+WYGNASS+ GGKER
Sbjct  255  FTAVTFQVLGHMKTILVLILGFLFFGKEGLNVHVVFGMGVAIIGMIWYGNASSQPGGKER  314

Query  202  V  200
            +
Sbjct  315  I  315


 Score = 57.4 bits (137),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AAFIA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  164  AAFIAVWSTALQQYYVHHLQRKYSLGSFNLL  194



>ref|XP_003602507.1| Membrane protein, putative [Medicago truncatula]
 gb|AES72758.1| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=335

 Score =   200 bits (509),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+K V AY Y L++   I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLVGPFMDYWLTNKRVDAYDYGLTSTLFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF+FFGKEG+N+ VVLGM IAI GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLFMGFIFFGKEGLNLHVVLGMAIAIAGMIWYGNASSKPGGKER  309


 Score = 56.6 bits (135),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  159  AAVIAVCSTALQQYYVHFLQRKYSIGSFNLLG  190



>gb|AES72759.2| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=286

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+K V AY Y L++   I+LSCTIA+GTNLSQFICIGR
Sbjct  141  GHTAPAQAASLLLVGPFMDYWLTNKRVDAYDYGLTSTLFIILSCTIAVGTNLSQFICIGR  200

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF+FFGKEG+N+ VVLGM IAI GM+WYGNASSK GGKER
Sbjct  201  FTAVSFQVLGHMKTILVLFMGFIFFGKEGLNLHVVLGMAIAIAGMIWYGNASSKPGGKER  260


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  110  AAVIAVCSTALQQYYVHFLQRKYSIGSFNLLG  141



>gb|ACJ84819.1| unknown [Medicago truncatula]
Length=335

 Score =   200 bits (508),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+K V AY Y L++   I+LSCTIA+GTNLSQF+CIGR
Sbjct  190  GHTAPAQAASLLLVGPFMDYWLTNKRVDAYDYGLTSTLFIILSCTIAVGTNLSQFVCIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF+FFGKEG+N+ VVLGM IAI GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLFMGFIFFGKEGLNLHVVLGMAIAIAGMIWYGNASSKPGGKER  309


 Score = 56.6 bits (135),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  159  AAVIAVCSTALQQYYVHFLQRKYSIGSFNLLG  190



>ref|XP_010040194.1| PREDICTED: UDP-galactose transporter 2-like, partial [Eucalyptus 
grandis]
Length=150

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D W+T K V AY YT  AV  I+LSCTIA+GTNLSQFICIGR
Sbjct  5    GHTAPAQAGSLLLVGPFLDYWMTSKRVDAYDYTPVAVMFIILSCTIAVGTNLSQFICIGR  64

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FT VSFQV+GHMKTILVL +GFLFFGKEG+N+QVV+GM IA+VGM+WYGNASSK GGKER
Sbjct  65   FTDVSFQVIGHMKTILVLIMGFLFFGKEGLNLQVVIGMIIAVVGMIWYGNASSKPGGKER  124



>ref|XP_006579458.1| PREDICTED: uncharacterized protein LOC100814890 isoform X1 [Glycine 
max]
 ref|XP_006579459.1| PREDICTED: uncharacterized protein LOC100814890 isoform X2 [Glycine 
max]
 ref|XP_006579460.1| PREDICTED: uncharacterized protein LOC100814890 isoform X3 [Glycine 
max]
 ref|XP_006579461.1| PREDICTED: uncharacterized protein LOC100814890 isoform X4 [Glycine 
max]
 gb|KHN34023.1| UDP-galactose transporter 2 [Glycine soja]
Length=337

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V AY+Y  ++   I++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLVGPFLDYWLTNKRVDAYNYGFTSTLFIIISCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+QV+LGM IAI GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLALGFVFFGKEGLNLQVILGMTIAIAGMIWYGNASSKPGGKER  309

Query  202  VQ  197
            + 
Sbjct  310  LS  311


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAAVAVWSTSLQQYYVHFLQRKYSLGSFNLLG  190



>gb|EYU36556.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata]
 gb|EYU36557.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata]
 gb|EYU36558.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata]
Length=333

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+K + AY+++L +   +VLSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPFLDYWLTNKRIDAYNFSLPSAVFLVLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+NIQVV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNIQVVIGMIIAVIGMMWYGNASSKPGGKER  309


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  STA+QQYYV  LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTAMQQYYVSFLQRKYSLSSFNLLG  190



>gb|KDP36558.1| hypothetical protein JCGZ_08325 [Jatropha curcas]
Length=335

 Score =   200 bits (508),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LLLVGP  D WLT++ V  Y+Y +++V  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLLVGPFLDYWLTNRRVYTYNYNITSVMFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFG+EG+N+QVVLGM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFFFFGREGLNLQVVLGMVIAVVGMIWYGNASSKPGGKER  309


 Score = 56.2 bits (134),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFVAVWSTSLQQYYVHYLQRKYSLSSFNLLG  190



>gb|AFK39529.1| unknown [Medicago truncatula]
Length=300

 Score =   199 bits (507),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+K V AY Y L++   I+LSCTIA+GTNLSQF+CIGR
Sbjct  155  GHTAPAQAASLLLVGPFMDYWLTNKRVDAYDYGLTSTLFIILSCTIAVGTNLSQFVCIGR  214

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF+FFGKEG+N+ VVLGM IAI GM+WYGNASSK GGKER
Sbjct  215  FTAVSFQVLGHMKTILVLFMGFIFFGKEGLNLHVVLGMAIAIAGMIWYGNASSKPGGKER  274


 Score = 56.2 bits (134),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  124  AAVIAVCSTALQQYYVHFLQRKYSIGSFNLLG  155



>ref|XP_008440118.1| PREDICTED: UDP-galactose transporter 2 [Cucumis melo]
 ref|XP_008440120.1| PREDICTED: UDP-galactose transporter 2 [Cucumis melo]
Length=334

 Score =   201 bits (510),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLL+GP +D WLT K V AY +T  +++ ++LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLLGPFSDYWLTGKRVDAYGFTFMSLAFLILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVLTLGF+FFGKEG+N+QVV+GM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVTFQVLGHMKTILVLTLGFIFFGKEGLNLQVVIGMAIAILGMIWYGNASSKPGGKER  309


 Score = 55.1 bits (131),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAVVAVWSTSLQQYYVHHLQRKYSLGSFNLLG  190



>gb|KJB18356.1| hypothetical protein B456_003G048300 [Gossypium raimondii]
Length=223

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V AY Y++ ++  +++SCTIA+GTNLSQFICIGR
Sbjct  80   GHTAPVQAASLLLVGPFVDYWLTEKKVYAYDYSVISMFFLIMSCTIAVGTNLSQFICIGR  139

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM IA++GMVWYGNASSK GGKER
Sbjct  140  FTAVSFQVLGHMKTILVLLLGFIFFGKEGLNLHVILGMVIAVLGMVWYGNASSKPGGKER  199


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRK+SLGSF+LLG
Sbjct  49   AAVIAIWSTALQQYYVHFLQRKHSLGSFDLLG  80



>ref|XP_004157865.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis sativus]
Length=334

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLL+GP +D WLT K V AY +T  +++ ++LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLLGPFSDYWLTGKRVDAYGFTFMSLAFLILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVLTLGF+FFGKEG+N+QVV+GM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVTFQVLGHMKTILVLTLGFIFFGKEGLNLQVVIGMAIAILGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A   T+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAVVAVWCTSLQQYYVHHLQRKYSLGSFNLLG  190



>ref|XP_004141972.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis sativus]
 gb|KGN48413.1| hypothetical protein Csa_6G486860 [Cucumis sativus]
Length=334

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLL+GP +D WLT K V AY +T  +++ ++LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLLGPFSDYWLTGKRVDAYGFTFMSLAFLILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVLTLGF+FFGKEG+N+QVV+GM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVTFQVLGHMKTILVLTLGFIFFGKEGLNLQVVIGMAIAILGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A   T+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAVVAVWCTSLQQYYVHHLQRKYSLGSFNLLG  190



>ref|XP_007048169.1| Nucleotide-sugar transporter family protein isoform 3 [Theobroma 
cacao]
 gb|EOX92326.1| Nucleotide-sugar transporter family protein isoform 3 [Theobroma 
cacao]
Length=312

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V AY YT+ +V  I+LSCTIA+GTNLSQFICIGR
Sbjct  167  GHTAPVQAASLLLVGPFVDYWLTEKKVYAYDYTVISVFFIILSCTIAVGTNLSQFICIGR  226

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM IA+ GMVWYGNASSK GGKER
Sbjct  227  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNLHVILGMVIAVGGMVWYGNASSKPGGKER  286



>ref|XP_008232334.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
Length=331

 Score =   200 bits (508),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP  D WLT+K V AY Y L ++SLIVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPFLDYWLTNKIVYAYDYHLISMSLIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N QVV+GM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNHQVVMGMFIAILGMIWYGNASSKPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AALVAVWSTSLQQHYVHSLQRKYSLGSFNLLG  190



>gb|KJB18355.1| hypothetical protein B456_003G048300 [Gossypium raimondii]
Length=242

 Score =   197 bits (500),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V AY Y++ ++  +++SCTIA+GTNLSQFICIGR
Sbjct  99   GHTAPVQAASLLLVGPFVDYWLTEKKVYAYDYSVISMFFLIMSCTIAVGTNLSQFICIGR  158

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM IA++GMVWYGNASSK GGKER
Sbjct  159  FTAVSFQVLGHMKTILVLLLGFIFFGKEGLNLHVILGMVIAVLGMVWYGNASSKPGGKER  218


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRK+SLGSF+LLG
Sbjct  68   AAVIAIWSTALQQYYVHFLQRKHSLGSFDLLG  99



>ref|XP_007205521.1| hypothetical protein PRUPE_ppa008448mg [Prunus persica]
 gb|EMJ06720.1| hypothetical protein PRUPE_ppa008448mg [Prunus persica]
Length=331

 Score =   199 bits (507),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP  D WLT+K V AY Y L ++SLIVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPFLDYWLTNKIVYAYDYHLISMSLIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N QVV+GM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNHQVVIGMFIAILGMIWYGNASSKPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 55.1 bits (131),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AALVAVWSTSLQQHYVHSLQRKYSLGSFNLLG  190



>ref|XP_011100579.1| PREDICTED: UDP-galactose transporter 2 [Sesamum indicum]
 ref|XP_011100585.1| PREDICTED: UDP-galactose transporter 2 [Sesamum indicum]
Length=335

 Score =   199 bits (505),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+K + A+++ + +V  ++LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPFLDYWLTNKRIDAFNFNVPSVIFMILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+N+QVVLGM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNLQVVLGMVIAVVGMIWYGNASSKPGGKER  309


 Score = 55.5 bits (132),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHFLQRKYSLTSFNLLG  190



>ref|XP_007048167.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007048168.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOX92324.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92325.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=335

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V AY YT+ +V  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLVGPFVDYWLTEKKVYAYDYTVISVFFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM IA+ GMVWYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNLHVILGMVIAVGGMVWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRK+SLGSF+LLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKHSLGSFDLLG  190



>ref|XP_009354062.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
Length=332

 Score =   197 bits (502),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP  D WLT+K+V AY Y L + SLIVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPFLDYWLTNKTVYAYDYHLISTSLIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+ FGKEG+N QVV+GM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFILFGKEGLNHQVVIGMFIAILGMIWYGNASSKPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 55.8 bits (133),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AALVAVWSTALQQHYVHSLQRKYSLGSFNLLG  190



>ref|XP_002533887.1| organic anion transporter, putative [Ricinus communis]
 gb|EEF28498.1| organic anion transporter, putative [Ricinus communis]
Length=335

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL+VGP  D WLT K V AY Y+ ++V  IVLSC+IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLVVGPFLDYWLTHKRVDAYAYSFTSVLFIVLSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+QV++GM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNVQVIVGMIIAVVGMIWYGNASSKPGGKER  309


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA +A  ST+LQQYYVH LQR+YSLGSFNLLG           V GP
Sbjct  159  AAVVAVWSTSLQQYYVHFLQRRYSLGSFNLLGHTAPAQAASLLVVGP  205



>emb|CDP11437.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   195 bits (495),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+K + A+++ + ++  IVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLVGPFLDYWLTNKRIDAFNFNVPSLVFIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKE  206
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+N+ VV+GM IA+VGMVWYGNASSK GGKE
Sbjct  250  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNLHVVIGMIIAVVGMVWYGNASSKPGGKE  308


 Score = 58.5 bits (140),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHFLQRKYSLGSFNLLG  190



>ref|XP_004252567.1| PREDICTED: UDP-galactose transporter 2 [Solanum lycopersicum]
Length=327

 Score =   197 bits (500),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QA SLLL+GP+ D WLT+K +  + +T S+ + I+LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPVQAGSLLLLGPLVDYWLTNKRIDHFDFTFSSSAFIILSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVL LGFLFFGKEG+NIQVV+GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVIGHMKTILVLVLGFLFFGKEGLNIQVVVGMLIAVCGMIWYGNASSKPGGKER  309


 Score = 56.2 bits (134),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLSSFNLLG  190



>gb|KHN09562.1| UDP-galactose transporter 2 [Glycine soja]
Length=223

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT K V AY Y L++   I+LSCTIA+GTNLSQFICIGR
Sbjct  80   GHTAPAQAASLLLVGPFMDYWLTGKRVDAYGYGLTSTLFIILSCTIAVGTNLSQFICIGR  139

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGF+FFGKEG+N+ VVLGM IAI GMVWYGNASSK GGKER
Sbjct  140  FTAVTFQVLGHMKTILVLILGFIFFGKEGLNLHVVLGMIIAIAGMVWYGNASSKPGGKER  199


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  49   AAVIAVWSTALQQYYVHFLQRKYSIGSFNLLG  80



>ref|NP_001242035.1| uncharacterized protein LOC100814890 [Glycine max]
 gb|ACU20778.1| unknown [Glycine max]
Length=337

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V A++Y  ++   I++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLVGPFLDYWLTNKRVDAHNYGFTSTLFIIISCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+QV+LGM IAI GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLALGFVFFGKEGLNLQVILGMTIAIAGMIWYGNASSKPGGKER  309

Query  202  VQ  197
            + 
Sbjct  310  LS  311


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAAVAVWSTSLQQYYVHFLQRKYSLGSFNLLG  190



>ref|XP_007019596.1| Nucleotide-sugar transporter family protein isoform 3 [Theobroma 
cacao]
 gb|EOY16821.1| Nucleotide-sugar transporter family protein isoform 3 [Theobroma 
cacao]
Length=266

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA +LLLVGP  D WLT+K V AY Y L++V+ +VLSCTIA+GTNLSQFICIGR
Sbjct  121  GHTAPAQAGTLLLVGPFLDYWLTNKRVDAYSYNLASVTFLVLSCTIAVGTNLSQFICIGR  180

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF  FGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  181  FTAVSFQVLGHMKTILVLIMGFFIFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  240


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQR+Y+L SFNLLG
Sbjct  90   AAFIAVWSTSLQQYYVHHLQRRYNLSSFNLLG  121



>ref|XP_010027747.1| PREDICTED: UDP-galactose transporter 2 [Eucalyptus grandis]
 ref|XP_010027748.1| PREDICTED: UDP-galactose transporter 2 [Eucalyptus grandis]
 ref|XP_010027749.1| PREDICTED: UDP-galactose transporter 2 [Eucalyptus grandis]
 ref|XP_010027750.1| PREDICTED: UDP-galactose transporter 2 [Eucalyptus grandis]
 gb|KCW54336.1| hypothetical protein EUGRSUZ_I00300 [Eucalyptus grandis]
 gb|KCW54337.1| hypothetical protein EUGRSUZ_I00300 [Eucalyptus grandis]
Length=335

 Score =   193 bits (491),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QA SLL+VGP  D   T + V AY Y+ ++V+ +++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQATSLLIVGPFLDYMFTGEKVYAYQYSTTSVAFLIVSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVLTLGF+FFGKEG+N+QVVLGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVIGHMKTILVLTLGFVFFGKEGLNMQVVLGMFVAVIGMIWYGNASSKPGGKER  309

Query  202  V  200
            V
Sbjct  310  V  310


 Score = 59.7 bits (143),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  159  AAFIAVWSTALQQYYVHFLQRKYSIGSFNLLG  190



>ref|XP_004288090.1| PREDICTED: UDP-galactose transporter 2 [Fragaria vesca subsp. 
vesca]
Length=331

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL+VGP  D WLT K+V AY Y   +VSLI+LSC+IA+GTNLSQFICIGR
Sbjct  189  GHTAPVQAASLLIVGPFVDFWLTGKTVYAYDYHFISVSLILLSCSIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  249  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNHQVVLGMFIAIMGMIWYGNASSKPGGKER  308


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA +A  STALQQYYVH LQRKYSL SFNLLG           + GP
Sbjct  158  AASVAVWSTALQQYYVHHLQRKYSLSSFNLLGHTAPVQAASLLIVGP  204



>gb|KHN29130.1| UDP-galactose transporter 2 [Glycine soja]
Length=537

 Score =   198 bits (503),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT K V AY+Y  ++   I++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLVGPFLDYWLTKKRVDAYNYGFTSTLFIIISCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FF KEG+N+QV+LGM IAI GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLALGFVFFRKEGVNLQVILGMTIAIAGMIWYGNASSKPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 54.7 bits (130),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAAVAVWSTSLQQYYVHFLQRKYSLGSFNLLG  190



>gb|KJB40431.1| hypothetical protein B456_007G062900 [Gossypium raimondii]
 gb|KJB40432.1| hypothetical protein B456_007G062900 [Gossypium raimondii]
Length=335

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLL GP  D WLT+K V AY+YT  ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLAGPFVDYWLTEKKVYAYNYTTISMFFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+N+ V+LGM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNLHVILGMVIAVAGMIWYGNASSKPGGKER  309


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  STALQQYYVH LQRK+SLGSF+LLG           + GP
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKHSLGSFDLLGHTAPVQAASLLLAGP  205



>ref|XP_006464516.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006464517.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006464518.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006464519.1| PREDICTED: UDP-galactose transporter 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006464520.1| PREDICTED: UDP-galactose transporter 2-like isoform X5 [Citrus 
sinensis]
 ref|XP_006464521.1| PREDICTED: UDP-galactose transporter 2-like isoform X6 [Citrus 
sinensis]
Length=334

 Score =   195 bits (496),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT K V AY+Y   +V  ++LSC+IA+GTNLSQFICIGR
Sbjct  191  GHTAPAQAASLLLLGPFVDYWLTSKRVDAYNYGFLSVFFMILSCSIAVGTNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGF+FFGKEG+N+QV+LGM IA++GM+WYGNASSK GGKER
Sbjct  251  FTAVTFQVLGHMKTILVLVLGFIFFGKEGLNMQVILGMVIAVLGMIWYGNASSKPGGKER  310


 Score = 57.0 bits (136),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  STA+QQYYVH LQRKY+LGSFNLLG
Sbjct  160  AAFVAVWSTAMQQYYVHYLQRKYNLGSFNLLG  191



>ref|XP_011100070.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011100071.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011100072.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
Length=334

 Score =   197 bits (502),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLTDK V  Y+YT  +V  +VLSC IAIGTNLSQFICIGR
Sbjct  190  GHTAPPQAASLLLVGPFMDYWLTDKRVDNYNYTFMSVMFVVLSCVIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+N+ VV+GM +AIVGM+WYG+ASS+ GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNLHVVVGMMVAIVGMMWYGHASSQPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 54.7 bits (130),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQY+VH LQRKYS+GSF+LLG
Sbjct  159  AAFIAVWSTSLQQYFVHYLQRKYSIGSFDLLG  190



>ref|XP_009345493.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
Length=332

 Score =   196 bits (499),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP  D WLT+++V AY Y L + SLIVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPFLDYWLTNETVYAYDYHLISTSLIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+ FGKEG+N QVV+GM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFILFGKEGLNHQVVIGMFIAILGMIWYGNASSKPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 55.8 bits (133),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AALVAVWSTALQQHYVHSLQRKYSLGSFNLLG  190



>gb|KJB18357.1| hypothetical protein B456_003G048300 [Gossypium raimondii]
Length=296

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V AY Y++ ++  +++SCTIA+GTNLSQFICIGR
Sbjct  153  GHTAPVQAASLLLVGPFVDYWLTEKKVYAYDYSVISMFFLIMSCTIAVGTNLSQFICIGR  212

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM IA++GMVWYGNASSK GGKER
Sbjct  213  FTAVSFQVLGHMKTILVLLLGFIFFGKEGLNLHVILGMVIAVLGMVWYGNASSKPGGKER  272


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRK+SLGSF+LLG
Sbjct  122  AAVIAIWSTALQQYYVHFLQRKHSLGSFDLLG  153



>ref|XP_003523251.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Glycine 
max]
 ref|XP_006578815.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Glycine 
max]
 ref|XP_006578816.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Glycine 
max]
Length=333

 Score =   196 bits (498),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT K V AY Y L++   I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLVGPFMDYWLTGKRVDAYGYGLTSTLFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGF+FFGKEG+N+ VVLGM IAI GMVWYGNASSK GGKER
Sbjct  250  FTAVTFQVLGHMKTILVLILGFIFFGKEGLNLHVVLGMIIAIAGMVWYGNASSKPGGKER  309


 Score = 56.2 bits (134),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSIGSFNLLG  190



>emb|CDP11440.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+K + A+++ + ++  IVLSCTIA+GTNLSQFICIGR
Sbjct  80   GHTAPAQAASLLLVGPFLDYWLTNKRIDAFNFNVPSLVFIVLSCTIAVGTNLSQFICIGR  139

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKE  206
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+N+ VV+GM IA+VGMVWYGNASSK GGKE
Sbjct  140  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNLHVVIGMIIAVVGMVWYGNASSKPGGKE  198


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  49   AAFIAVWSTSLQQYYVHFLQRKYSLSSFNLLG  80



>ref|XP_010097649.1| hypothetical protein L484_023789 [Morus notabilis]
 gb|EXB70604.1| hypothetical protein L484_023789 [Morus notabilis]
Length=332

 Score =   192 bits (489),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V AY+Y L+++  I LSC+IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFLDYWLTNKRVDAYNYNLASLMFIFLSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL +GF FFG+EG+ +QVV GM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVTFQVLGHMKTILVLIMGFFFFGREGLTLQVVFGMVIAVVGMIWYGNASSKPGGKER  309


 Score = 59.3 bits (142),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHFLQRKYSLGSFNLLG  190



>ref|XP_011074099.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011074100.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011074101.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
 ref|XP_011074102.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
Length=335

 Score =   196 bits (498),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+K + A+ +T+ +V  +VLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPFLDYWLTNKRIDAFDFTIPSVVFMVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKE  206
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+NIQVV+GM IA+ GM+WYGNASSK GGKE
Sbjct  250  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNIQVVIGMIIAVFGMIWYGNASSKPGGKE  308


 Score = 55.8 bits (133),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHFLQRKYSLSSFNLLG  190



>ref|XP_010932887.1| PREDICTED: UDP-galactose transporter 2-like [Elaeis guineensis]
 ref|XP_010932888.1| PREDICTED: UDP-galactose transporter 2-like [Elaeis guineensis]
Length=336

 Score =   194 bits (492),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL++GP  D WLT K V A+ Y +SAV  I++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAAALLILGPFLDYWLTRKRVDAFDYNVSAVFFIIMSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ VVLGM +A+VGM+WYG+ASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFIFFGKEGLNLHVVLGMILAVVGMIWYGSASSKPGGKER  309


 Score = 58.2 bits (139),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAMIAVWSTALQQYYVHFLQRKYSLGSFNLLG  190



>ref|XP_010063828.1| PREDICTED: UDP-galactose transporter 2-like [Eucalyptus grandis]
 ref|XP_010063829.1| PREDICTED: UDP-galactose transporter 2-like [Eucalyptus grandis]
 gb|KCW71092.1| hypothetical protein EUGRSUZ_F04190 [Eucalyptus grandis]
Length=335

 Score =   197 bits (500),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D W+T K V  Y YT  AV  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFLDYWMTSKRVDGYDYTPVAVMFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVL +GFLFFGKEG+N+QVV+GM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVIGHMKTILVLIMGFLFFGKEGLNLQVVIGMIIAVVGMIWYGNASSKPGGKER  309


 Score = 54.7 bits (130),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AALIAVWSTALQQYYVHYLQRKYSLSSFNLLG  190



>gb|KHG07660.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=335

 Score =   197 bits (501),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASL+L GP  D WLT+K V AY+YT  +   I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLVLAGPFVDYWLTEKKVYAYNYTTVSTFFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+N+ V+LGM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNLHVILGMVIAVAGMIWYGNASSKPGGKER  309


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  STALQQYYVH LQRK+SLGSF+LLG           + GP
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKHSLGSFDLLGHTAPVQAASLVLAGP  205



>ref|XP_006585314.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Glycine 
max]
Length=356

 Score =   197 bits (500),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT K V AY+Y  ++   I++SCTIA+GTNLSQFICIGR
Sbjct  210  GHTAPVQAASLLLVGPFLDYWLTKKRVDAYNYGFTSTLFIIISCTIAVGTNLSQFICIGR  269

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FF KEG+N+QV+LGM IAI GM+WYGNASSK GGKER
Sbjct  270  FTAVSFQVLGHMKTILVLALGFVFFRKEGVNLQVILGMTIAIAGMIWYGNASSKPGGKER  329

Query  202  V  200
            +
Sbjct  330  L  330


 Score = 54.7 bits (130),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  179  AAAVAVWSTSLQQYYVHFLQRKYSLGSFNLLG  210



>ref|XP_009336495.1| PREDICTED: UDP-galactose transporter 2 [Pyrus x bretschneideri]
Length=334

 Score =   194 bits (492),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+K V AY Y   ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAGSLLLLGPFLDYWLTNKRVDAYDYNFGSLMFIILSCTIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  249  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  308


 Score = 57.4 bits (137),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  STALQQYYVH LQRKYSLGSF+LLG
Sbjct  158  AAFIAVWSTALQQYYVHFLQRKYSLGSFSLLG  189



>ref|XP_006585315.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Glycine 
max]
Length=336

 Score =   197 bits (500),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT K V AY+Y  ++   I++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLVGPFLDYWLTKKRVDAYNYGFTSTLFIIISCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FF KEG+N+QV+LGM IAI GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLALGFVFFRKEGVNLQVILGMTIAIAGMIWYGNASSKPGGKER  309

Query  202  V  200
            +
Sbjct  310  L  310


 Score = 54.3 bits (129),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAAVAVWSTSLQQYYVHFLQRKYSLGSFNLLG  190



>gb|KHG12708.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=333

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V AY +++ ++  +++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLVGPFVDYWLTEKKVYAYDFSVISMFFLIMSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM IA+VGMVWYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLLLGFIFFGKEGLNLHVILGMVIAVVGMVWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRK+SLGSF+LLG
Sbjct  159  AAVIAIWSTALQQYYVHFLQRKHSLGSFDLLG  190



>ref|XP_008777067.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Phoenix 
dactylifera]
Length=279

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL++GP  D WLT+K V A+ Y +SAV  I+LSCTIA+GTNLSQFICIGR
Sbjct  133  GHTAPAQAAALLILGPFLDYWLTNKRVDAFDYNVSAVFFIILSCTIAVGTNLSQFICIGR  192

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ VVLGM +A+VGM+WYG+ASSK GGKER
Sbjct  193  FTAVSFQVLGHMKTILVLVLGFIFFGKEGLNLHVVLGMILAVVGMIWYGSASSKPGGKER  252


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQR YSLGSFNLLG
Sbjct  102  AAMIAVWSTSLQQYYVHFLQRNYSLGSFNLLG  133



>ref|XP_006647512.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647513.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Oryza 
brachyantha]
Length=335

 Score =   194 bits (494),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT++ V  ++YT      IVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDLWLTNRRVDTFNYTTIVTFFIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGFLFFGKEG+N  VVLGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLTLGFLFFGKEGLNFHVVLGMILAVIGMIWYGNASSKPGGKER  309


 Score = 56.6 bits (135),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AAIIAVWSTALQQHYVHLLQRKYSLGSFNLLG  190



>dbj|BAJ99966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   194 bits (494),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL+ GP  D WLTDK V  + YT+     IVLSC IA+GTNLSQFICIGR
Sbjct  192  GHTAPAQAASLLIFGPFVDLWLTDKRVDTFDYTMVVTFFIVLSCIIAVGTNLSQFICIGR  251

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGF FFGKEG+N+ V LGM IA++GM+WYGNASSK GGKER
Sbjct  252  FTAVSFQVLGHMKTILVLTLGFFFFGKEGLNLHVALGMTIAVIGMIWYGNASSKPGGKER  311


 Score = 56.2 bits (134),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  161  AAIIAVWSTALQQHYVHHLQRKYSLGSFNLLG  192



>gb|KJB18354.1| hypothetical protein B456_003G048300 [Gossypium raimondii]
Length=333

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V AY Y++ ++  +++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLVGPFVDYWLTEKKVYAYDYSVISMFFLIMSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM IA++GMVWYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLLLGFIFFGKEGLNLHVILGMVIAVLGMVWYGNASSKPGGKER  309


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRK+SLGSF+LLG
Sbjct  159  AAVIAIWSTALQQYYVHFLQRKHSLGSFDLLG  190



>ref|XP_009610489.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana tomentosiformis]
 ref|XP_009610490.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana tomentosiformis]
 ref|XP_009610491.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana tomentosiformis]
Length=327

 Score =   193 bits (491),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP+ D WLT+K +  + +   ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPLVDYWLTNKRIDHFAFNFPSLVFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVL LGFLFFGKEG+NIQVV+GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVIGHMKTILVLILGFLFFGKEGLNIQVVVGMIIAVFGMIWYGNASSKPGGKER  309


 Score = 57.4 bits (137),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLSSFNLLG  190



>ref|XP_008456746.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis melo]
Length=335

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D WLT+K V  Y Y L+++  I+LSC+IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFLDYWLTNKRVDRYDYNLASIIFIILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+QVVLGM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNMQVVLGMIIAVIGMIWYGNASSKPGGKER  309


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTSLQQYYVHFLQRKYSLSSFNLLG  190



>ref|XP_006647514.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Oryza 
brachyantha]
Length=295

 Score =   194 bits (493),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT++ V  ++YT      IVLSCTIA+GTNLSQFICIGR
Sbjct  150  GHTAPAQAASLLILGPFVDLWLTNRRVDTFNYTTIVTFFIVLSCTIAVGTNLSQFICIGR  209

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGFLFFGKEG+N  VVLGM +A++GM+WYGNASSK GGKER
Sbjct  210  FTAVSFQVLGHMKTILVLTLGFLFFGKEGLNFHVVLGMILAVIGMIWYGNASSKPGGKER  269


 Score = 56.2 bits (134),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  119  AAIIAVWSTALQQHYVHLLQRKYSLGSFNLLG  150



>ref|XP_008777064.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008777065.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Phoenix 
dactylifera]
Length=336

 Score =   195 bits (496),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL++GP  D WLT+K V A+ Y +SAV  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAAALLILGPFLDYWLTNKRVDAFDYNVSAVFFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ VVLGM +A+VGM+WYG+ASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFIFFGKEGLNLHVVLGMILAVVGMIWYGSASSKPGGKER  309


 Score = 55.1 bits (131),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQR YSLGSFNLLG
Sbjct  159  AAMIAVWSTSLQQYYVHFLQRNYSLGSFNLLG  190



>ref|XP_007159783.1| hypothetical protein PHAVU_002G266800g [Phaseolus vulgaris]
 gb|ESW31777.1| hypothetical protein PHAVU_002G266800g [Phaseolus vulgaris]
Length=334

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLLLVGP  D WLT+K V  Y+Y L++  LI++SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLLVGPFVDYWLTNKRVDHYNYGLTSTVLIIISCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL+LGF+FFGKEG+N+QV+LGM IAI GM+WYGNASSK  GKE 
Sbjct  250  FTAVTFQVLGHMKTILVLSLGFVFFGKEGLNLQVILGMLIAIAGMIWYGNASSKPEGKEY  309

Query  202  VQ  197
            V 
Sbjct  310  VS  311


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAAVAVWSTSLQQYYVHFLQRKYSLRSFNLLG  190



>ref|XP_008386368.1| PREDICTED: UDP-galactose transporter 2 [Malus domestica]
 ref|XP_008386369.1| PREDICTED: UDP-galactose transporter 2 [Malus domestica]
 ref|XP_008386370.1| PREDICTED: UDP-galactose transporter 2 [Malus domestica]
 ref|XP_008386372.1| PREDICTED: UDP-galactose transporter 2 [Malus domestica]
Length=334

 Score =   194 bits (493),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+K V AY Y   ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAGSLLLLGPFLDYWLTNKRVDAYDYNFGSLMFIILSCTIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  249  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  308


 Score = 56.2 bits (134),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSLGSF+LLG
Sbjct  158  AAFIAVWSTSLQQYYVHFLQRKYSLGSFSLLG  189



>ref|XP_007019594.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007019595.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16819.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16820.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
Length=335

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA +LLLVGP  D WLT+K V AY Y L++V+ +VLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGTLLLVGPFLDYWLTNKRVDAYSYNLASVTFLVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF  FGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFIFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQR+Y+L SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHHLQRRYNLSSFNLLG  190



>ref|XP_009335133.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335134.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335135.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335136.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335137.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
 ref|XP_009335138.1| PREDICTED: UDP-galactose transporter 2-like [Pyrus x bretschneideri]
Length=334

 Score =   194 bits (493),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+K V AY Y   ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAGSLLLLGPFLDYWLTNKRVDAYDYNFGSLMFIILSCTIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  249  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  308


 Score = 56.2 bits (134),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSLGSF+LLG
Sbjct  158  AAFIAVWSTSLQQYYVHFLQRKYSLGSFSLLG  189



>ref|XP_009802605.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
 ref|XP_009802606.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
 ref|XP_009802607.1| PREDICTED: UDP-galactose transporter 2-like [Nicotiana sylvestris]
Length=327

 Score =   192 bits (489),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP  D WLT+K +  + +   ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPFVDYWLTNKRIDHFAFNFPSLVFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVL LGFLFFGKEG+NIQVV+GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVIGHMKTILVLILGFLFFGKEGLNIQVVVGMIIAVFGMIWYGNASSKPGGKER  309


 Score = 57.4 bits (137),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLSSFNLLG  190



>ref|XP_006361615.1| PREDICTED: UDP-galactose transporter 2-like [Solanum tuberosum]
Length=327

 Score =   194 bits (492),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QA SLLL+GP+ D WLT+K +  + +T  ++  I+LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPVQAGSLLLLGPLVDYWLTNKRIDHFDFTFPSLVFIILSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVL LGFLFFGKEG+N+QVV+GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVIGHMKTILVLILGFLFFGKEGLNMQVVVGMLIAVCGMIWYGNASSKPGGKER  309


 Score = 56.2 bits (134),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLSSFNLLG  190



>ref|XP_003634527.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
 ref|XP_010665174.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera]
 emb|CBI18242.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   194 bits (493),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+K V  Y Y  +++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLLGPFLDYWLTNKRVDMYQYNTASLIFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+QVVLGM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLQVVLGMIIAVVGMMWYGNASSKPGGKER  309


 Score = 55.8 bits (133),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHFLQRKYSLSSFNLLG  190



>ref|XP_008812584.1| PREDICTED: UDP-galactose transporter 2-like [Phoenix dactylifera]
Length=335

 Score =   192 bits (487),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D W+T K V  + Y ++AV  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFLDYWMTSKRVDKFDYNVTAVFFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ VVLGM +AIVGM+WYG++SSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFIFFGKEGLNLHVVLGMILAIVGMIWYGSSSSKPGGKER  309


 Score = 58.2 bits (139),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAMIAVWSTALQQYYVHFLQRKYSLGSFNLLG  190



>gb|KDP35285.1| hypothetical protein JCGZ_09444 [Jatropha curcas]
Length=335

 Score =   196 bits (497),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+K V  Y Y  ++V  I+LSC+IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLVGPFLDYWLTNKRVDEYAYGFTSVLFIILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+QV++GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNVQVIVGMLIAVAGMMWYGNASSKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  ST+LQQYYVH LQR+YSLGSFNLLG
Sbjct  159  AAVVAVWSTSLQQYYVHYLQRRYSLGSFNLLG  190



>ref|NP_001239895.1| uncharacterized protein LOC100800306 [Glycine max]
 gb|ACU23308.1| unknown [Glycine max]
Length=333

 Score =   193 bits (491),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT K V AY Y L++   I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLVGPFMDYWLTGKRVDAYGYGLTSTLFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGF+FFGKEG+N+ VVLGM IAI GMVWYG+ASSK GGKER
Sbjct  250  FTAVTFQVLGHMKTILVLILGFIFFGKEGLNLHVVLGMIIAIAGMVWYGSASSKPGGKER  309


 Score = 56.2 bits (134),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSIGSFNLLG  190



>ref|XP_007201810.1| hypothetical protein PRUPE_ppa008384mg [Prunus persica]
 ref|XP_008237484.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
 ref|XP_008237485.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
 ref|XP_008237486.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
 ref|XP_008237487.1| PREDICTED: UDP-galactose transporter 2 [Prunus mume]
 gb|EMJ03009.1| hypothetical protein PRUPE_ppa008384mg [Prunus persica]
Length=334

 Score =   193 bits (491),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT K V AY Y  +++  I LSCTIA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAGSLLLLGPFLDYWLTSKRVDAYDYNFTSLMFIFLSCTIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  249  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  308


 Score = 56.2 bits (134),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSLGSF+LLG
Sbjct  158  AAFIAVWSTSLQQYYVHFLQRKYSLGSFSLLG  189



>dbj|BAL46503.1| putative transmembrane protein [Diospyros kaki]
Length=338

 Score =   192 bits (488),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LLL+GP  D WLT++ + A+ ++++++  IVLSCTIA+GTNLSQFICIGR
Sbjct  192  GHTAPAQAATLLLLGPFVDYWLTNRRIDAFDFSIASLVFIVLSCTIAVGTNLSQFICIGR  251

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVL HMKTILVL LGFLFFGKEG+N+ VVLGM IA+VGMVWYG+ASSK GGKER
Sbjct  252  FTAVSFQVLEHMKTILVLILGFLFFGKEGLNLHVVLGMVIAVVGMVWYGSASSKPGGKER  311


 Score = 57.0 bits (136),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  161  AAFIAVWSTALQQYYVHFLQRKYSLSSFNLLG  192



>emb|CDP12866.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAPLQAASLLL GP  D WLT K V  ++YTL+++  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPLQAASLLLCGPFVDYWLTGKRVDGFNYTLASLLFIALSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVL LGFLFFGKEG+N+ VVLGM IAI+GM+WYGN SS  GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLVLGFLFFGKEGLNLHVVLGMIIAILGMIWYGNVSSLPGGKER  309

Query  202  V  200
            V
Sbjct  310  V  310


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQ+KYSLGSFNLLG
Sbjct  159  AASIAVWSTSLQQYYVHSLQQKYSLGSFNLLG  190



>ref|NP_001047426.1| Os02g0614500 [Oryza sativa Japonica Group]
 dbj|BAD19452.1| transmembrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD19727.1| transmembrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF09340.1| Os02g0614500 [Oryza sativa Japonica Group]
 dbj|BAG93009.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57369.1| hypothetical protein OsJ_07519 [Oryza sativa Japonica Group]
Length=331

 Score =   194 bits (494),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT++ V  ++YT      IVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDFWLTNRRVDTFNYTTIVTFFIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGFLFFGKEG+N  VVLGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLTLGFLFFGKEGLNFHVVLGMMLAVIGMIWYGNASSKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQ+KYSLGSFNLLG
Sbjct  159  AAVIAVWSTALQQHYVHHLQKKYSLGSFNLLG  190



>gb|AAK50365.1| putative transmembrane protein [Oryza sativa Japonica Group]
Length=331

 Score =   194 bits (494),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT++ V  ++YT      IVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDFWLTNRRVDTFNYTTIVTFFIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGFLFFGKEG+N  VVLGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLTLGFLFFGKEGLNFHVVLGMMLAVIGMIWYGNASSKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQ+KYSLGSFNLLG
Sbjct  159  AAVIAVWSTALQQHYVHHLQKKYSLGSFNLLG  190



>gb|EEC73595.1| hypothetical protein OsI_08063 [Oryza sativa Indica Group]
Length=331

 Score =   194 bits (494),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT++ V  ++YT      IVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDFWLTNRRVDTFNYTTIVTFFIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGFLFFGKEG+N  VVLGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLTLGFLFFGKEGLNFHVVLGMMLAVIGMIWYGNASSKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQ+KYSLGSFNLLG
Sbjct  159  AAVIAVWSTALQQHYVHHLQKKYSLGSFNLLG  190



>ref|XP_003518502.1| PREDICTED: UDP-galactose transporter 2-like [Glycine max]
 gb|KHN00738.1| UDP-galactose transporter 2 [Glycine soja]
Length=322

 Score =   194 bits (492),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+K V  Y Y  +++  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPFLDYWLTNKRVDRYDYNTASLIFIFLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+QVV GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLQVVFGMIIAVAGMIWYGNASSKPGGKER  309


 Score = 55.1 bits (131),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST++QQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSMQQYYVHFLQRKYSLSSFNLLG  190



>ref|NP_568059.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 ref|NP_849527.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 gb|AAM13878.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13117.1| unknown protein [Arabidopsis thaliana]
 gb|AEE87066.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 gb|AEE87067.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 gb|AIJ01998.1| bi-functional UDP-rhamnose/UDP-galactose transporter, partial 
[Arabidopsis thaliana]
Length=337

 Score =   195 bits (495),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V AY+++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  195  AHTAPVQAASLLLVGPFLDYWLTNQRVDAYNFSFVSLFFLILSCSIAVGTNLSQFICIGR  254

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  255  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNASSKPGGKER  314


 Score = 53.5 bits (127),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  164  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  194



>ref|NP_001190967.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
 gb|AEE87068.1| nucleotide sugar transporter-KT 1 [Arabidopsis thaliana]
Length=333

 Score =   195 bits (495),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V AY+++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  191  AHTAPVQAASLLLVGPFLDYWLTNQRVDAYNFSFVSLFFLILSCSIAVGTNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  251  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNASSKPGGKER  310


 Score = 53.5 bits (127),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  160  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  190



>gb|EMT04054.1| hypothetical protein F775_26901 [Aegilops tauschii]
Length=337

 Score =   192 bits (488),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLL+ GP  D WLTDK V  + YT+     IVLSC IA+GTNLSQFICIGR
Sbjct  192  GHTAPAQAVSLLIFGPFVDLWLTDKRVDTFDYTMVVTFFIVLSCIIAVGTNLSQFICIGR  251

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGF FFGKEG+N  V LGM IA++GM+WYGNASSK GGKER
Sbjct  252  FTAVSFQVLGHMKTILVLTLGFFFFGKEGLNFHVALGMTIAVIGMIWYGNASSKPGGKER  311


 Score = 56.2 bits (134),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  161  AAIIAVWSTALQQHYVHHLQRKYSLGSFNLLG  192



>gb|AAM64952.1| unknown [Arabidopsis thaliana]
Length=333

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V AY+++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  191  AHTAPVQAASLLLVGPFLDYWLTNQRVDAYNFSFVSLFFLILSCSIAVGTNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  251  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNASSKPGGKER  310


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKY+LGSFNLL
Sbjct  160  AAAIAVWSTALQQYYVHYLQRKYALGSFNLL  190



>ref|XP_002300904.2| transporter-related family protein [Populus trichocarpa]
 gb|EEE80177.2| transporter-related family protein [Populus trichocarpa]
Length=336

 Score =   192 bits (489),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LLL+GP  D WLT+K +  Y Y+  +V  IV+SCTIA+GTNLSQFICIGR
Sbjct  191  GHTAPAQAATLLLLGPFLDYWLTNKRIDTYDYSAVSVMFIVISCTIAVGTNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGK+G+N+ VVLGM IA+VGMVWYGNASSK GGKER
Sbjct  251  FTAVSFQVLGHMKTILVLIMGFFFFGKDGLNLHVVLGMIIAVVGMVWYGNASSKPGGKER  310


 Score = 55.8 bits (133),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  160  AAFIAVWSTSLQQYYVHYLQRKYSLSSFNLLG  191



>ref|XP_006434521.1| hypothetical protein CICLE_v10001769mg [Citrus clementina]
 gb|ESR47761.1| hypothetical protein CICLE_v10001769mg [Citrus clementina]
Length=285

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL++GP  D WLTDK + AY Y +++V  ++LSCTIA+GTNLSQFICIGR
Sbjct  141  GHTAPAQAATLLVIGPFLDNWLTDKRIYAYDYNIASVIFLILSCTIAVGTNLSQFICIGR  200

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GFLFFGKEG+N+ VVLGM IA+ GM+WY NAS+K GGKER
Sbjct  201  FTAVSFQVLGHMKTILVLIMGFLFFGKEGLNLHVVLGMIIAVFGMIWYSNASTKPGGKER  260


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  ST++QQYYVH LQRKYSL SFNLLG           V GP
Sbjct  110  AALIAVWSTSIQQYYVHHLQRKYSLTSFNLLGHTAPAQAATLLVIGP  156



>ref|NP_001136797.1| uncharacterized protein LOC100216942 [Zea mays]
 gb|ACF82656.1| unknown [Zea mays]
Length=184

 Score =   190 bits (482),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V A++YT      IVLSC IA+GTNLSQFICIGR
Sbjct  39   GHTAPAQAASLLVLGPFVDFWLTNKRVDAFNYTSIVTFFIVLSCIIAVGTNLSQFICIGR  98

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGF FFGKEG+N  V LGM +A++GM+WYGNASSK GGKER
Sbjct  99   FTAVSFQVLGHMKTVLVLTLGFFFFGKEGLNFHVALGMFLAVIGMIWYGNASSKPGGKER  158



>ref|XP_008381856.1| PREDICTED: UDP-galactose transporter 2-like [Malus domestica]
 ref|XP_008381857.1| PREDICTED: UDP-galactose transporter 2-like [Malus domestica]
Length=334

 Score =   194 bits (492),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+K V AY Y   ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAGSLLLLGPFLDYWLTNKRVDAYDYNYGSLMFIILSCTIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  249  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  308


 Score = 54.3 bits (129),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSLGSF+LLG
Sbjct  158  AAXIAVWSTALQQYYVHFLQRKYSLGSFSLLG  189



>ref|XP_009416387.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score =   192 bits (489),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAASLL++GP  D WLT+K V  + Y+++AV  IVLSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAASLLILGPFVDYWLTNKRVDKFDYSVTAVFFIVLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGF  FG+EG+N+ V+ GM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLTLGFFLFGREGLNLHVISGMILAVLGMIWYGNASSKPGGKER  309


 Score = 55.5 bits (132),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQ+KYSLGSFNLLG
Sbjct  159  AATIAVWSTALQQYYVHFLQKKYSLGSFNLLG  190



>ref|XP_010446483.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010446484.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010446485.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Camelina 
sativa]
Length=332

 Score =   194 bits (493),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V A++++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  190  AHTAPVQAASLLLVGPFLDYWLTNQRVDAFNFSFVSLFFLILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+NIQVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNIQVVLGMLIAILGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  159  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  189



>ref|XP_006599473.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Glycine 
max]
 ref|XP_006599474.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Glycine 
max]
 ref|XP_006599475.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Glycine 
max]
 ref|XP_006599476.1| PREDICTED: UDP-galactose transporter 2-like isoform X4 [Glycine 
max]
 gb|KHN41307.1| UDP-galactose transporter 2 [Glycine soja]
Length=322

 Score =   193 bits (490),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+K V  Y Y  +++  I LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPFLDYWLTNKRVDRYDYNTASLIFIFLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+QVV GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLQVVFGMIIAVAGMIWYGNASSKPGGKER  309


 Score = 54.7 bits (130),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  ST++QQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFVAVWSTSMQQYYVHFLQRKYSLSSFNLLG  190



>ref|XP_011042896.1| PREDICTED: UDP-galactose transporter 2-like [Populus euphratica]
Length=336

 Score =   192 bits (488),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LLL+GP  D WLT+K +  Y Y+  +V  IV+SCTIA+GTNLSQFICIGR
Sbjct  191  GHTAPAQAATLLLLGPFLDYWLTNKRIDTYDYSAVSVMFIVISCTIAVGTNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGK+G+N+ VVLGM IA+VGM+WYGNASSK GGKER
Sbjct  251  FTAVSFQVLGHMKTILVLIMGFFFFGKDGLNLHVVLGMIIAVVGMIWYGNASSKPGGKER  310


 Score = 55.8 bits (133),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  160  AAFIAVWSTSLQQYYVHYLQRKYSLSSFNLLG  191



>ref|XP_010906037.1| PREDICTED: UDP-galactose transporter 2-like [Elaeis guineensis]
 ref|XP_010906038.1| PREDICTED: UDP-galactose transporter 2-like [Elaeis guineensis]
Length=335

 Score =   192 bits (488),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D W+T+K V  + Y ++AV  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFLDYWMTNKRVDKFDYNVTAVFFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ VVLGM +A+VGM+WYG++SSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFIFFGKEGLNLHVVLGMILAVVGMIWYGSSSSKPGGKER  309


 Score = 55.5 bits (132),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AAAIAVWSTSLQQYYVHFLQRKYSLGSFNLLG  190



>gb|KJB59484.1| hypothetical protein B456_009G258600 [Gossypium raimondii]
 gb|KJB59486.1| hypothetical protein B456_009G258600 [Gossypium raimondii]
 gb|KJB59487.1| hypothetical protein B456_009G258600 [Gossypium raimondii]
Length=335

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            G+TAP QAA+LLL+GP  D WLT+K V AY+Y L ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GYTAPAQAATLLLLGPFLDYWLTNKRVDAYNYNLVSLMFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVAGMIWYGNASSKPGGKER  309



>gb|ACU24339.1| unknown [Glycine max]
Length=322

 Score =   192 bits (488),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+K V  Y Y  +++  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPFLDYWLTNKRVDRYDYNTASLIFIFLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTA SFQVLGHMKTILVL +GF FFGKEG+N+QVV GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAASFQVLGHMKTILVLIMGFFFFGKEGLNLQVVFGMIIAVAGMIWYGNASSKPGGKER  309


 Score = 55.1 bits (131),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST++QQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSMQQYYVHFLQRKYSLSSFNLLG  190



>ref|XP_010538909.1| PREDICTED: UDP-galactose transporter 2-like [Tarenaya hassleriana]
Length=336

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGPI D WLT+K V  Y Y + +V  IVLSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLIVGPILDYWLTNKRVDKYDYDIVSVMFIVLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG++G+N+ VVLGM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGRDGLNLHVVLGMVIAVLGMIWYGNASSKPGGKER  309


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAFIA  ST+LQQYYVH LQRKY+L SFNLLG           + GP
Sbjct  159  AAFIAVWSTSLQQYYVHYLQRKYALSSFNLLGHTAPAQAATLLIVGP  205



>ref|XP_006284088.1| hypothetical protein CARUB_v10005218mg [Capsella rubella]
 gb|EOA16986.1| hypothetical protein CARUB_v10005218mg [Capsella rubella]
Length=332

 Score =   193 bits (491),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V A++++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  190  AHTAPVQAASLLLVGPFLDYWLTNQRVDAFNFSFVSLFFLILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  159  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  189



>ref|XP_011025571.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
 ref|XP_011025572.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
 ref|XP_011025573.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
 ref|XP_011025574.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
Length=334

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL+VGP  D WLT+  V AY YTL++   IV+SC+IA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAASLLVVGPFLDYWLTNNRVDAYAYTLTSTLFIVVSCSIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ VV+GM IA+ GM+WYGNASSK GGKER
Sbjct  249  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNLHVVVGMIIAVAGMIWYGNASSKPGGKER  308


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  STALQQYYVH LQR+YSLGSFNLLG           V GP
Sbjct  158  AAVIAVWSTALQQYYVHYLQRRYSLGSFNLLGHTAPAQAASLLVVGP  204



>gb|ACN28164.1| unknown [Zea mays]
 tpg|DAA63392.1| TPA: hypothetical protein ZEAMMB73_444488 [Zea mays]
Length=215

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V A++YT      IVLSC IA+GTNLSQFICIGR
Sbjct  70   GHTAPAQAASLLVLGPFVDFWLTNKRVDAFNYTSIVTFFIVLSCIIAVGTNLSQFICIGR  129

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGF FFGKEG+N  V LGM +A++GM+WYGNASSK GGKER
Sbjct  130  FTAVSFQVLGHMKTVLVLTLGFFFFGKEGLNFHVALGMFLAVIGMIWYGNASSKPGGKER  189


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  STALQQ+YVH LQ KYSLGSFNLLG           V GP
Sbjct  39   AAVIAVWSTALQQHYVHHLQWKYSLGSFNLLGHTAPAQAASLLVLGP  85



>gb|EMS67795.1| hypothetical protein TRIUR3_18539 [Triticum urartu]
Length=337

 Score =   191 bits (484),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL+ GP  D WLTDK V  + YT+     IVLSC IA+GTNLSQFICIGR
Sbjct  192  GHTAPAQAASLLIFGPFVDLWLTDKRVDTFDYTMVVTFFIVLSCIIAVGTNLSQFICIGR  251

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGF FFGKEG+N  V LGM IA++GM+WYG ASSK GGKER
Sbjct  252  FTAVSFQVLGHMKTILVLTLGFFFFGKEGLNFHVALGMTIAVIGMIWYGYASSKPGGKER  311


 Score = 55.8 bits (133),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  161  AAIIAVWSTALQQHYVHHLQRKYSLGSFNLLG  192



>ref|XP_006434522.1| hypothetical protein CICLE_v10001769mg [Citrus clementina]
 ref|XP_006473110.1| PREDICTED: UDP-galactose transporter 2-like [Citrus sinensis]
 gb|ESR47762.1| hypothetical protein CICLE_v10001769mg [Citrus clementina]
Length=336

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL++GP  D WLTDK + AY Y +++V  ++LSCTIA+GTNLSQFICIGR
Sbjct  192  GHTAPAQAATLLVIGPFLDNWLTDKRIYAYDYNIASVIFLILSCTIAVGTNLSQFICIGR  251

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GFLFFGKEG+N+ VVLGM IA+ GM+WY NAS+K GGKER
Sbjct  252  FTAVSFQVLGHMKTILVLIMGFLFFGKEGLNLHVVLGMIIAVFGMIWYSNASTKPGGKER  311


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  ST++QQYYVH LQRKYSL SFNLLG           V GP
Sbjct  161  AALIAVWSTSIQQYYVHHLQRKYSLTSFNLLGHTAPAQAATLLVIGP  207



>ref|XP_007137579.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 ref|XP_007137580.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 ref|XP_007137581.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 gb|ESW09573.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 gb|ESW09574.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
 gb|ESW09575.1| hypothetical protein PHAVU_009G138400g [Phaseolus vulgaris]
Length=333

 Score =   190 bits (483),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D WLT K V AY Y L++   I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFLDYWLTGKRVDAYGYGLTSTLFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQVLGHMKTILVL LGF+ FGKEG+N+ VVLGM +AI GMVWYGNASSK GGKER
Sbjct  250  FTAVTFQVLGHMKTILVLILGFILFGKEGLNLHVVLGMIVAIAGMVWYGNASSKPGGKER  309


 Score = 56.2 bits (134),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  159  AALIAVWSTALQQYYVHYLQRKYSIGSFNLLG  190



>ref|XP_006411742.1| hypothetical protein EUTSA_v10025667mg [Eutrema salsugineum]
 gb|ESQ53195.1| hypothetical protein EUTSA_v10025667mg [Eutrema salsugineum]
Length=335

 Score =   193 bits (490),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V A++++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  190  AHTAPVQAASLLLVGPFLDYWLTNQRVDAFNFSFISLFFLILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  159  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  189



>ref|XP_004140956.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis sativus]
 gb|KGN46117.1| hypothetical protein Csa_6G055380 [Cucumis sativus]
Length=335

 Score =   193 bits (490),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLL+VGP  D WLT K V  Y Y L++   I+LSC+IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLVVGPFLDYWLTTKRVDQYDYNLASTIFIILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+QVVLGM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNMQVVLGMIIAVIGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAIIAVWSTSLQQYYVHFLQRKYSLSSFNLLG  190



>ref|XP_010530127.1| PREDICTED: UDP-galactose transporter 2 [Tarenaya hassleriana]
 ref|XP_010530128.1| PREDICTED: UDP-galactose transporter 2 [Tarenaya hassleriana]
Length=336

 Score =   192 bits (488),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA +LL+VGPI D WLT+K V  Y Y L +   +VLSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAGTLLIVGPILDYWLTNKRVDKYDYNLVSTMFVVLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVIGMVIAVLGMIWYGNASSKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKY+L SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHYLQRKYALSSFNLLG  190



>emb|CDY42623.1| BnaC01g00350D [Brassica napus]
Length=356

 Score =   192 bits (489),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V A++++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  211  AHTAPVQAASLLLVGPFLDYWLTNQRVDAFNFSFVSLFFLILSCSIAVGTNLSQFICIGR  270

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  271  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNMQVVLGMLIAILGMIWYGNASSKPGGKER  330


 Score = 53.5 bits (127),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  180  AAAIAVWSTALQQYYVHHLQRKYSLGSFNLL  210



>emb|CDY12142.1| BnaC03g60580D [Brassica napus]
Length=335

 Score =   192 bits (489),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V A++++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  190  AHTAPVQAASLLLVGPFLDYWLTNQRVDAFNFSFISLFFLILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNMQVVLGMLIAILGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  159  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  189



>gb|ACG35759.1| integral membrane protein like [Zea mays]
Length=335

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL+VGP  D WLT+K V A++YT      IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLIVGPFVDFWLTNKRVDAFNYTSIVTXFIVLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGFLFFGKEG+N  V LGM +A++GM+WYGNASSK+GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLTLGFLFFGKEGLNFHVALGMLLAVIGMIWYGNASSKSGGKER  309


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQ KYSLGSFNLLG
Sbjct  159  AAVIAVWSTALQQHYVHHLQWKYSLGSFNLLG  190



>ref|XP_006654160.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006654161.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Oryza 
brachyantha]
Length=335

 Score =   190 bits (483),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V  ++YT      IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDFWLTNKRVDTFNYTAIVTFFIVLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGFLFFGKEG+N  V LGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLTLGFLFFGKEGLNFHVALGMILAVIGMIWYGNASSKPGGKER  309


 Score = 56.2 bits (134),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AAIIAVWSTALQQHYVHHLQRKYSLGSFNLLG  190



>ref|XP_010431909.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010431910.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Camelina 
sativa]
Length=332

 Score =   192 bits (489),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V A++++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  190  AHTAPVQAASLLLVGPFLDYWLTNQRVDAFNFSFVSLFFLILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+NIQVVLGM IAI+GM+WYGN SSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNIQVVLGMLIAILGMIWYGNVSSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  159  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  189



>emb|CDY15303.1| BnaC06g07890D [Brassica napus]
Length=335

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFGREGLNLHVVIGMVIAVLGMIWYGNASSKPGGKER  309


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTSLQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLVVGP  205



>ref|XP_009109471.1| PREDICTED: UDP-galactose transporter 2 [Brassica rapa]
 emb|CDX90331.1| BnaA08g16530D [Brassica napus]
Length=335

 Score =   192 bits (489),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V A++++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  190  AHTAPVQAASLLLVGPFLDYWLTNQRVDAFNFSFISLFFLILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNMQVVLGMLIAILGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  159  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  189



>ref|XP_009119734.1| PREDICTED: UDP-galactose transporter 2-like [Brassica rapa]
 emb|CDY41976.1| BnaA01g05480D [Brassica napus]
Length=335

 Score =   192 bits (489),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D WLT++ V A++++  ++  ++LSC+IA+GTNLSQFICIGR
Sbjct  190  AHTAPVQAASLLLVGPFLDYWLTNQRVDAFNFSFVSLFFLILSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNMQVVLGMLIAILGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  159  AAAIAVWSTALQQYYVHHLQRKYSLGSFNLL  189



>ref|XP_009114771.1| PREDICTED: UDP-galactose transporter 2 [Brassica rapa]
Length=335

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFGREGLNLHVVIGMVIAVLGMIWYGNASSKPGGKER  309


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTSLQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLVVGP  205



>emb|CDX93736.1| BnaA09g23360D [Brassica napus]
Length=335

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFGREGLNLHVVIGMVIAVLGMIWYGNASSKPGGKER  309


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTSLQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLVVGP  205



>ref|XP_002307141.1| transporter-related family protein [Populus trichocarpa]
 gb|ABK92883.1| unknown [Populus trichocarpa]
 gb|EEE94137.1| transporter-related family protein [Populus trichocarpa]
Length=334

 Score =   191 bits (484),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLLVGP  D WLT+  V +Y Y+++++  I+LSC+IA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAASLLLVGPFLDYWLTNNRVDSYAYSITSILFILLSCSIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKTILVL LGF+ FGKEG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  249  FSAVSFQVLGHMKTILVLILGFILFGKEGLNLHVVIGMIIAVIGMIWYGNASSKPGGKER  308


 Score = 55.1 bits (131),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQR+YSLGSFNLLG
Sbjct  158  AAVIAVWSTSLQQYYVHFLQRRYSLGSFNLLG  189



>emb|CDY28389.1| BnaA05g18510D [Brassica napus]
Length=335

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFGREGLNLHVVIGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTSLQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLVVGP  205



>ref|XP_006415048.1| hypothetical protein EUTSA_v10008144mg [Eutrema salsugineum]
 gb|ESQ33401.1| hypothetical protein EUTSA_v10008144mg [Eutrema salsugineum]
Length=335

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVIGMVIAVLGMIWYGNASSKPGGKER  309


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTSLQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLVVGP  205



>ref|NP_001131725.1| integral membrane protein like protein isoform 1 [Zea mays]
 ref|XP_008667139.1| PREDICTED: integral membrane protein like protein isoform 1 isoform 
X1 [Zea mays]
 gb|ACF80257.1| unknown [Zea mays]
 gb|ACF87135.1| unknown [Zea mays]
 tpg|DAA41282.1| TPA: integral membrane protein like protein isoform 1 [Zea mays]
 tpg|DAA41283.1| TPA: integral membrane protein like protein isoform 2 [Zea mays]
Length=335

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL+VGP  D WLT+K V A++YT      IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLIVGPFVDFWLTNKRVDAFNYTSIVTFFIVLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGFLFFGKEG+N  V LGM +A++GM+WYGNASSK+GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLTLGFLFFGKEGLNFHVALGMLLAVIGMIWYGNASSKSGGKER  309


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQ KYSLGSFNLLG
Sbjct  159  AAVIAVWSTALQQHYVHHLQWKYSLGSFNLLG  190



>ref|XP_003575354.1| PREDICTED: UDP-galactose transporter 2-like [Brachypodium distachyon]
 ref|XP_010235698.1| PREDICTED: UDP-galactose transporter 2-like [Brachypodium distachyon]
Length=335

 Score =   191 bits (484),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V  ++YT+     IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDLWLTNKRVDTFNYTVVVTFFIVLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGF FFGKEG+N  V LGM +A++ MVWYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLTLGFFFFGKEGLNFHVALGMTLAVIAMVWYGNASSKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSF+LLG
Sbjct  159  AAIIAVWSTALQQHYVHHLQRKYSLGSFDLLG  190



>ref|XP_010461221.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
 ref|XP_010478820.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=335

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA +A  STALQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAVVAVWSTALQQYYVHYLQRKYSLNSFNLLGHTAPAQAATLLVVGP  205



>ref|NP_564433.1| nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 gb|AAG12540.1|AC015446_21 Unknown protein [Arabidopsis thaliana]
 gb|AAG12852.1|AC079286_9 unknown protein; 21747-23353 [Arabidopsis thaliana]
 gb|ACF20469.1| At1g34020 [Arabidopsis thaliana]
 gb|AEE31658.1| nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 gb|AIJ02000.1| bi-functional UDP-rhamnose/UDP-galactose transporter, partial 
[Arabidopsis thaliana]
Length=335

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLNSFNLLGHTAPAQAATLLVVGP  205



>ref|XP_006305303.1| hypothetical protein CARUB_v10009678mg [Capsella rubella]
 gb|EOA38201.1| hypothetical protein CARUB_v10009678mg [Capsella rubella]
Length=335

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLNSFNLLGHTAPAQAATLLVVGP  205



>ref|XP_002891071.1| hypothetical protein ARALYDRAFT_473556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67330.1| hypothetical protein ARALYDRAFT_473556 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLNSFNLLGHTAPAQAATLLVVGP  205



>gb|KJB60019.1| hypothetical protein B456_009G286100 [Gossypium raimondii]
 gb|KJB60020.1| hypothetical protein B456_009G286100 [Gossypium raimondii]
 gb|KJB60021.1| hypothetical protein B456_009G286100 [Gossypium raimondii]
 gb|KJB60022.1| hypothetical protein B456_009G286100 [Gossypium raimondii]
Length=335

 Score =   191 bits (485),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA +LLL+GP  D WLT + V AY+Y + ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGTLLLLGPFLDYWLTSQRVDAYNYNIVSIMFILLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVAGMIWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQR+Y+L SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHHLQRRYNLSSFNLLG  190



>gb|KHG03706.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=335

 Score =   192 bits (488),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA +LLL+GP  D WL +K V AY+Y L ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGTLLLLGPFLDYWLANKRVDAYNYNLVSLMFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVAGMIWYGNASSKPGGKER  309



>gb|EEE62758.1| hypothetical protein OsJ_17561 [Oryza sativa Japonica Group]
Length=332

 Score =   188 bits (478),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V  ++YT      I+LSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLVLGPFVDFWLTNKRVDTFNYTAIVTFFIILSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGFLFFGKEG+N  V +GM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLTLGFLFFGKEGLNFHVAIGMILAVIGMIWYGNASSKPGGKER  309


 Score = 56.2 bits (134),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AAIIAVWSTALQQHYVHHLQRKYSLGSFNLLG  190



>ref|XP_010555309.1| PREDICTED: UDP-galactose transporter 2 [Tarenaya hassleriana]
 ref|XP_010555310.1| PREDICTED: UDP-galactose transporter 2 [Tarenaya hassleriana]
Length=337

 Score =   189 bits (480),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             H AP+QAASLLLVGP  D WLT++ V A+++T  ++  +VLSC+IA+GTNLSQFICIGR
Sbjct  190  AHMAPVQAASLLLVGPFLDYWLTNQRVDAFNFTFMSLFFLVLSCSIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF FFGKEG+N+Q+V+GM IA++GMVWYGNASSK GGKE+
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFTFFGKEGLNVQMVVGMVIAVLGMVWYGNASSKPGGKEQ  309


 Score = 55.5 bits (132),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLGSFNLL  189



>ref|XP_007151969.1| hypothetical protein PHAVU_004G090700g [Phaseolus vulgaris]
 ref|XP_007151970.1| hypothetical protein PHAVU_004G090700g [Phaseolus vulgaris]
 gb|ESW23963.1| hypothetical protein PHAVU_004G090700g [Phaseolus vulgaris]
 gb|ESW23964.1| hypothetical protein PHAVU_004G090700g [Phaseolus vulgaris]
Length=321

 Score =   189 bits (481),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+  V  Y Y  +++  I +SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPFLDYWLTNARVDRYDYKTASLIFIFMSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VV GM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVFGMVIAVVGMIWYGNASSKPGGKER  309


 Score = 55.1 bits (131),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST++QQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSMQQYYVHYLQRKYSLSSFNLLG  190



>gb|AAM66068.1| unknown [Arabidopsis thaliana]
Length=335

 Score =   192 bits (487),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL++GP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVIGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLNSFNLLGHTAPAQAATLLVIGP  205



>ref|XP_010499941.1| PREDICTED: UDP-galactose transporter 2 [Camelina sativa]
Length=335

 Score =   192 bits (487),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA +A  STALQQYYVH LQRKYSL SFNLLG           V GP
Sbjct  159  AAVVAVWSTALQQYYVHYLQRKYSLNSFNLLGHTAPAQAATLLVVGP  205



>gb|KHG20906.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=303

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA +LLL+GP  D WLT + V AY+Y + ++  I+LSCTIA+GTNLSQFICIGR
Sbjct  158  GHTAPAQAGTLLLLGPFLDYWLTSQRVDAYNYNIVSIMFILLSCTIAVGTNLSQFICIGR  217

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+ VVLGM IA+ GM+WYGNASSK GGKER
Sbjct  218  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVLGMIIAVAGMIWYGNASSKPGGKER  277


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQR+Y+L SFNLLG
Sbjct  127  AAFIAVWSTSLQQYYVHHLQRRYNLSSFNLLG  158



>ref|XP_010904726.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Elaeis 
guineensis]
Length=335

 Score =   189 bits (479),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+K V A+ Y+ +AV  I+LSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLLGPFLDFWLTNKRVDAFAYSAAAVFFIILSCLIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM +A+ GM+WYGNASSK GGKER
Sbjct  250  FSAVSFQVLGHMKTILVLILGFIFFGKEGLNLHVILGMILAVTGMIWYGNASSKPGGKER  309


 Score = 55.1 bits (131),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  159  AATIAVCSTSLQQYYVHFLQRKYSLGSFNLLG  190



>ref|XP_010904727.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Elaeis 
guineensis]
Length=313

 Score =   189 bits (479),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+K V A+ Y+ +AV  I+LSC IA+GTNLSQFICIGR
Sbjct  168  GHTAPAQAGSLLLLGPFLDFWLTNKRVDAFAYSAAAVFFIILSCLIAVGTNLSQFICIGR  227

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKTILVL LGF+FFGKEG+N+ V+LGM +A+ GM+WYGNASSK GGKER
Sbjct  228  FSAVSFQVLGHMKTILVLILGFIFFGKEGLNLHVILGMILAVTGMIWYGNASSKPGGKER  287


 Score = 55.1 bits (131),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQRKYSLGSFNLLG
Sbjct  137  AATIAVCSTSLQQYYVHFLQRKYSLGSFNLLG  168



>ref|XP_010437993.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
 ref|XP_010438001.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=335

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLTDK V  Y Y   +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLIVGPFLDYWLTDKRVDMYDYNFVSVMFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FF ++G+N+ V+LGM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFDRDGLNLHVILGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           + GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLIVGP  205



>gb|EYU30281.1| hypothetical protein MIMGU_mgv1a009610mg [Erythranthe guttata]
Length=337

 Score =   188 bits (478),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D  LT+K   A+ +   ++  ++LSCTIA+GTNLSQFICIGR
Sbjct  194  GHTAPAQAASLLLIGPFLDYLLTNKKKDAHTFHTPSLVFMILSCTIAVGTNLSQFICIGR  253

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGFLFFGKEG+NIQVV+GM IA++GM+WYGNASSK GGKER
Sbjct  254  FTAVSFQVLGHMKTILVLILGFLFFGKEGLNIQVVIGMVIAVIGMIWYGNASSKPGGKER  313


 Score = 55.5 bits (132),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  163  AAFIAVWSTSLQQYYVHYLQRKYSLTSFNLLG  194



>ref|XP_004496438.1| PREDICTED: UDP-galactose transporter 2-like [Cicer arietinum]
Length=322

 Score =   187 bits (476),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+  V  Y Y   +++ I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLLGPFLDYWLTNNRVDQYAYDAGSLTFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVVGMMWYGNASSKPGGKER  309


 Score = 55.8 bits (133),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHYLQRKYSLSSFNLLG  190



>ref|XP_002310620.1| transporter-related family protein [Populus trichocarpa]
 gb|ABK93556.1| unknown [Populus trichocarpa]
 gb|EEE91070.1| transporter-related family protein [Populus trichocarpa]
Length=334

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL+VGP  D WLT+  V AY YT  +   IV+SC+IA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAASLLVVGPFLDYWLTNNRVDAYAYTFISTLFIVVSCSIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N+ VV+GM IA+ GM+WYGNASSK GGKER
Sbjct  249  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNLHVVVGMIIAVAGMIWYGNASSKPGGKER  308


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  STALQQYYVH LQR+YSLGSFNLLG           V GP
Sbjct  158  AAVIAVWSTALQQYYVHYLQRRYSLGSFNLLGHTAPAQAASLLVVGP  204



>ref|XP_010678762.1| PREDICTED: UDP-galactose transporter 2-like [Beta vulgaris subsp. 
vulgaris]
Length=330

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA +LLLVGP  D WLT+K + A+ YT  ++ LI+LSC IAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAGTLLLVGPFLDYWLTNKRIDAFDYTTPSIMLIILSCIIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+ FGKEG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFVLFGKEGLNLHVVVGMMIAVLGMIWYGNASSKPGGKER  309



>ref|XP_004953102.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=335

 Score =   189 bits (479),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V  ++YT      IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPGQAASLLVLGPFVDFWLTNKRVDTFNYTSIVTFFIVLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGFLFFGKEG+N  V LGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLTLGFLFFGKEGLNFHVALGMLLAVIGMIWYGNASSKPGGKER  309


 Score = 53.9 bits (128),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG
Sbjct  159  AAAIAVWSTALQQHYVHHLQRKYSLGSFNLLG  190



>ref|XP_009145156.1| PREDICTED: UDP-galactose transporter 2-like [Brassica rapa]
Length=335

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+ GP+ D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLVGGPVLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFGREGLNLHVVIGMIIAVLGMIWYGNASSKPGGKER  309


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG           VGGP
Sbjct  159  AAFVAVWSTSLQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLVGGP  205



>ref|XP_006589484.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Glycine 
max]
 ref|XP_006589485.1| PREDICTED: UDP-galactose transporter 2-like isoform X2 [Glycine 
max]
 ref|XP_006589486.1| PREDICTED: UDP-galactose transporter 2-like isoform X3 [Glycine 
max]
 ref|XP_006589487.1| PREDICTED: UDP-galactose transporter 2-like isoform X4 [Glycine 
max]
 gb|KHN17037.1| UDP-galactose transporter 2 [Glycine soja]
Length=322

 Score =   189 bits (480),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP+ D WLT+  V  Y Y   ++  I +SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLLLGPVLDYWLTNNRVDRYAYNAGSLIFIFMSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VVLGM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNVHVVLGMVIAVFGMIWYGNASSKPGGKER  309

Query  202  VQ  197
            + 
Sbjct  310  LN  311


 Score = 53.1 bits (126),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            +AF+A  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  SAFMAVWSTSLQQYYVHFLQRKYSLSSFNLLG  190



>ref|XP_010262105.1| PREDICTED: UDP-galactose transporter 2-like isoform X1 [Nelumbo 
nucifera]
Length=340

 Score =   187 bits (474),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LLL+GP  D WL +K V  + Y+L +V  I+LSCTIA+GTNLSQFICIGR
Sbjct  195  GHTAPAQAATLLLIGPFLDFWLANKRVDTFDYSLMSVLFIILSCTIAVGTNLSQFICIGR  254

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF  FGKEG+++QVV+GM IA+VGM+WYG+ASSK GGKER
Sbjct  255  FTAVSFQVLGHMKTILVLILGFFCFGKEGLSLQVVVGMIIAVVGMIWYGSASSKPGGKER  314


 Score = 55.1 bits (131),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  164  AAFVAVWSTSLQQYYVHFLQRKYSLSSFNLLG  195



>ref|NP_001149060.1| integral membrane protein like [Zea mays]
 gb|ACG34037.1| integral membrane protein like [Zea mays]
 gb|ACR38715.1| unknown [Zea mays]
 tpg|DAA63393.1| TPA: putative integral membrane protein [Zea mays]
Length=335

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V A++YT      IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLVLGPFVDFWLTNKRVDAFNYTSIVTFFIVLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGF FFGKEG+N  V LGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLTLGFFFFGKEGLNFHVALGMFLAVIGMIWYGNASSKPGGKER  309


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  STALQQ+YVH LQ KYSLGSFNLLG           V GP
Sbjct  159  AAVIAVWSTALQQHYVHHLQWKYSLGSFNLLGHTAPAQAASLLVLGP  205



>tpg|DAA63396.1| TPA: putative integral membrane protein [Zea mays]
Length=372

 Score =   189 bits (481),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V A++YT      IVLSC IA+GTNLSQFICIGR
Sbjct  227  GHTAPAQAASLLVLGPFVDFWLTNKRVDAFNYTSIVTFFIVLSCIIAVGTNLSQFICIGR  286

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGF FFGKEG+N  V LGM +A++GM+WYGNASSK GGKER
Sbjct  287  FTAVSFQVLGHMKTVLVLTLGFFFFGKEGLNFHVALGMFLAVIGMIWYGNASSKPGGKER  346


 Score = 52.4 bits (124),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQ+YVH LQ KYSLGSFNLLG
Sbjct  196  AAVIAVWSTALQQHYVHHLQWKYSLGSFNLLG  227



>ref|XP_003630136.1| Membrane protein, putative [Medicago truncatula]
 gb|AET04612.1| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=342

 Score =   190 bits (483),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GH AP+QA SLL+VGP  D WLT K V AY+Y L++   I LSCTIA+GTNLSQFICIGR
Sbjct  190  GHIAPIQATSLLVVGPFLDYWLTRKRVDAYNYGLTSTLFIALSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKE  206
            FTAVSFQVLGHMKTILVLTLGF+ FG+EG+N+QV++GM IAI+GM+WYGNASSK GGKE
Sbjct  250  FTAVSFQVLGHMKTILVLTLGFILFGREGLNLQVIVGMIIAIMGMIWYGNASSKPGGKE  308


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA +A  STALQQYYVH LQ+KYSLGSFNLLG           V GP
Sbjct  159  AAAVAVWSTALQQYYVHFLQKKYSLGSFNLLGHIAPIQATSLLVVGP  205



>ref|XP_011021966.1| PREDICTED: UDP-galactose transporter 2-like [Populus euphratica]
Length=334

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL+VGP  D WLT+  V +Y Y+++++  I+LSC+IA+GTNLSQFICIGR
Sbjct  189  GHTAPAQAASLLVVGPFLDYWLTNNRVDSYAYSITSILFILLSCSIAVGTNLSQFICIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKTILVL LGF+ FGKEG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct  249  FSAVSFQVLGHMKTILVLILGFILFGKEGLNLHVVIGMIIAVIGMIWYGNASSKPGGKER  308


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  ST+LQQYYVH LQR+YSLGSFNLLG           V GP
Sbjct  158  AAVIAVWSTSLQQYYVHFLQRRYSLGSFNLLGHTAPAQAASLLVVGP  204



>emb|CAB44674.1| putative protein [Arabidopsis thaliana]
 emb|CAB80602.1| putative protein [Arabidopsis thaliana]
Length=342

 Score =   187 bits (475),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 106/129 (82%), Gaps = 9/129 (7%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAV---------SLIVLSCTIAIGTN  410
             HTAP+QAASLLLVGP  D WLT++ V AY+++  ++           ++LSC+IA+GTN
Sbjct  191  AHTAPVQAASLLLVGPFLDYWLTNQRVDAYNFSFVSLLYLTQFFGQFFLILSCSIAVGTN  250

Query  409  LSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA  230
            LSQFICIGRFTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNA
Sbjct  251  LSQFICIGRFTAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNA  310

Query  229  SSKAGGKER  203
            SSK GGKER
Sbjct  311  SSKPGGKER  319


 Score = 53.5 bits (127),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  160  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  190



>ref|XP_010683206.1| PREDICTED: UDP-galactose transporter 2-like [Beta vulgaris subsp. 
vulgaris]
Length=331

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QA SLL++GP  D WLT + + ++ YTL AV  I LSC+IAIGTNLSQFICIGR
Sbjct  190  GHTAPVQAGSLLVLGPFVDYWLTGQRIDSFDYTLPAVIFITLSCSIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF+FFGKEG+N  VV+GM IA+ GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFIFFGKEGLNSHVVVGMIIAVAGMIWYGNASSKPGGKER  309



>ref|XP_002307514.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE94510.1| transporter-related family protein [Populus trichocarpa]
Length=335

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LLL+GP  D WLT+K +  Y Y   +V  IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPSQAATLLLLGPFLDYWLTNKRIDTYDYNAVSVMFIVLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVL +GF FFGK+G+N+ VVLGM IA+VGM+WY NASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLIMGFFFFGKDGLNLHVVLGMTIAVVGMIWYSNASSKPGGKER  309


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG    +      + GP
Sbjct  159  AAFIAVWSTSLQQYYVHYLQRKYSLSSFNLLGHTAPSQAATLLLLGP  205



>ref|NP_001054935.1| Os05g0215800 [Oryza sativa Japonica Group]
 gb|AAT47018.1| putative transmembrane protein [Oryza sativa Japonica Group]
 dbj|BAF16849.1| Os05g0215800 [Oryza sativa Japonica Group]
 dbj|BAG89240.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78725.1| hypothetical protein OsI_18907 [Oryza sativa Indica Group]
Length=335

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V  ++YT      I+LSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLVLGPFVDFWLTNKRVDTFNYTAIVTFFIILSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVLTLGFLFFGKEG+N  V +GM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLTLGFLFFGKEGLNFHVAIGMILAVIGMIWYGNASSKPGGKER  309


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  STALQQ+YVH LQRKYSLGSFNLLG           V GP
Sbjct  159  AAIIAVWSTALQQHYVHHLQRKYSLGSFNLLGHTAPAQAASLLVLGP  205



>ref|NP_192719.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 emb|CAB39648.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78104.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAR24728.1| At4g09810 [Arabidopsis thaliana]
 gb|AEE82801.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 gb|AIJ01999.1| bi-functional UDP-rhamnose/UDP-galactose transporter, partial 
[Arabidopsis thaliana]
Length=335

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLTDK V  Y Y   +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLIVGPFLDYWLTDKRVDMYDYNSVSVMFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FF ++G+N+ V+LGM IA++GM+WYGNASSK GGKE+
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFDRDGLNLHVILGMIIAVLGMIWYGNASSKPGGKEK  309


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           + GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLIVGP  205



>ref|XP_010531423.1| PREDICTED: UDP-galactose transporter 2-like [Tarenaya hassleriana]
 ref|XP_010531424.1| PREDICTED: UDP-galactose transporter 2-like [Tarenaya hassleriana]
 ref|XP_010531425.1| PREDICTED: UDP-galactose transporter 2-like [Tarenaya hassleriana]
Length=334

 Score =   186 bits (472),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP+QAASLLLVGP  D  LT++ V A+++T  ++  +VLSC+IA+GTNLSQFICIGR
Sbjct  192  AHTAPVQAASLLLVGPFLDYLLTNQRVDAFNFTFMSLFFLVLSCSIAVGTNLSQFICIGR  251

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+QVV+GM IA++GMVWYGNASSK GGKE 
Sbjct  252  FTAVSFQVLGHMKTILVLVMGFSFFGKEGLNVQVVVGMLIAVLGMVWYGNASSKPGGKEH  311


 Score = 53.9 bits (128),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  161  AAAIAVCSTALQQYYVHFLQRKYSLGSFNLL  191



>ref|XP_006290034.1| hypothetical protein CARUB_v10003668mg [Capsella rubella]
 gb|EOA22932.1| hypothetical protein CARUB_v10003668mg [Capsella rubella]
Length=335

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y   +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLIVGPFLDYWLTEKRVDMYDYNFVSVMFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FF ++G+N+ VVLGM IA++GM+WYGNASSK GGKE+
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFDRDGLNLHVVLGMIIAVLGMIWYGNASSKPGGKEK  309


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQ+KY L SFNL+G           + GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQQKYKLSSFNLIGHTAPAQAATLLIVGP  205



>ref|XP_009419689.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score =   186 bits (471),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLL++GP  D WLT K V A+ Y ++ V  I LSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAMSLLMLGPFVDYWLTSKRVDAFDYNVTVVFFIFLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF  FG+EG+N+QV+ GM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVLGFFLFGREGLNLQVIFGMILAVIGMLWYGNASSKPGGKER  309


 Score = 53.5 bits (127),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQ+KYSLGSFNL+G
Sbjct  159  AATIAVWSTSLQQYYVHSLQKKYSLGSFNLIG  190



>ref|XP_006842618.1| hypothetical protein AMTR_s00077p00178780 [Amborella trichopoda]
 gb|ERN04293.1| hypothetical protein AMTR_s00077p00178780 [Amborella trichopoda]
Length=333

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QAA+LL++GP  D WLT+K V  +++ +++V  I LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPVQAATLLVLGPFFDYWLTNKRVDTFNFNVASVFFISLSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL LGF  FGKEG+N+ VVLGM +A++GM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLILGFFIFGKEGLNLHVVLGMVLAVMGMIWYGNASSKPGGKER  309


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AA IA  ST+LQQYYVH LQRKYS+GSFNLLG           V GP
Sbjct  159  AAVIAVWSTSLQQYYVHFLQRKYSMGSFNLLGHTAPVQAATLLVLGP  205



>ref|XP_002866846.1| hypothetical protein ARALYDRAFT_327889 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43105.1| hypothetical protein ARALYDRAFT_327889 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   185 bits (470),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 9/129 (7%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAV---------SLIVLSCTIAIGTN  410
             HTAP+QAASLLLVGP  D WLT++ V AY+++  ++           ++LSC+IA+GTN
Sbjct  191  AHTAPVQAASLLLVGPFLDYWLTNQRVDAYNFSFVSLLYLTQSFGQFFLILSCSIAVGTN  250

Query  409  LSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA  230
            LSQFICIGRFTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNA
Sbjct  251  LSQFICIGRFTAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNA  310

Query  229  SSKAGGKER  203
            SSK G KER
Sbjct  311  SSKPGSKER  319


 Score = 53.5 bits (127),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STALQQYYVH LQRKYSLGSFNLL
Sbjct  160  AAAIAVWSTALQQYYVHYLQRKYSLGSFNLL  190



>emb|CDY05079.1| BnaC03g28770D [Brassica napus]
Length=396

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y + ++  I LSCTIAIGTNLSQFICIGR
Sbjct  252  GHTAPAQAATLLIVGPFLDFWLTEKRVDMYDYNVVSLMFITLSCTIAIGTNLSQFICIGR  311

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLT+GF FF ++G+N+ VVLGM IA++GM+WYGNASSK GGKE+
Sbjct  312  FTAVSFQVLGHMKTILVLTMGFFFFDRDGLNLHVVLGMIIAVLGMIWYGNASSKPGGKEK  371


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           + GP
Sbjct  221  AAFVAVWSTALQQYYVHYLQRKYSLTSFNLLGHTAPAQAATLLIVGP  267



>ref|XP_010680321.1| PREDICTED: UDP-galactose transporter 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680322.1| PREDICTED: UDP-galactose transporter 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680323.1| PREDICTED: UDP-galactose transporter 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680325.1| PREDICTED: UDP-galactose transporter 2 [Beta vulgaris subsp. 
vulgaris]
Length=337

 Score =   182 bits (463),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            G TAP+QAASLLLVGP  D WLT   V AY YT  ++  I+LSCTIAIGTNLSQFICIGR
Sbjct  190  GRTAPVQAASLLLVGPFVDYWLTGLRVDAYAYTSVSLFFIILSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AV+FQVLGHMKTI VL +GF FFGK+G+N  VVLGM IAI GM+WYGNASSK GGKER
Sbjct  250  FSAVTFQVLGHMKTIFVLVMGFAFFGKDGLNWHVVLGMIIAIFGMMWYGNASSKPGGKER  309


 Score = 55.5 bits (132),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            +A +A  STALQQYYVH LQRKYS+GSFNLLG
Sbjct  159  SALVAVWSTALQQYYVHHLQRKYSIGSFNLLG  190



>ref|XP_011044274.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
Length=335

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LLL+GP  D WLT+K +  Y Y   +V  IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPSQAATLLLLGPFLDYWLTNKRIDTYDYNAVSVMFIVLSCIIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT+LVL +GF FFGK+G+N+ VVLGM IA+ GM+WY NASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTVLVLIMGFFFFGKDGLNLHVVLGMTIAVAGMIWYSNASSKPGGKER  309


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG    +      + GP
Sbjct  159  AAFIAVWSTSLQQYYVHYLQRKYSLSSFNLLGHTAPSQAATLLLLGP  205



>ref|XP_007143575.1| hypothetical protein PHAVU_007G083300g [Phaseolus vulgaris]
 gb|ESW15569.1| hypothetical protein PHAVU_007G083300g [Phaseolus vulgaris]
Length=322

 Score =   182 bits (462),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D WLT+  V  + Y   ++  I +SCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFLDYWLTNNRVDRFAYNSGSLMFIFMSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+NI VV+GM IA+ GM+WYGN S+K GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLVMGFFFFGREGLNIHVVIGMLIAVCGMIWYGNVSTKPGGKER  309

Query  202  VQ  197
            + 
Sbjct  310  LN  311


 Score = 55.1 bits (131),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF+A  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFVAVWSTSLQQYYVHFLQRKYSLSSFNLLG  190



>dbj|BAE98980.1| hypothetical protein [Arabidopsis thaliana]
Length=335

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLTDK V  Y Y   +V  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLIVGPFLDYWLTDKRVDMYDYNSVSVMFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKT LVL +GF FF ++G+N+ V+LGM IA++GM+WYGNASSK GGKE+
Sbjct  250  FTAVSFQVLGHMKTTLVLVMGFFFFDRDGLNLHVILGMIIAVLGMIWYGNASSKPGGKEK  309


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           + GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLIVGP  205



>ref|XP_010421887.1| PREDICTED: LOW QUALITY PROTEIN: UDP-galactose transporter 2 [Camelina 
sativa]
Length=336

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIV-LSCTIAIGTNLSQFICIG  386
            GHTAP QAA+LL+VGP  D WLTDK V  Y Y   +V  I+ LSCTIAIGTNLSQFICIG
Sbjct  190  GHTAPAQAATLLIVGPFLDFWLTDKRVDMYDYNFVSVMFIITLSCTIAIGTNLSQFICIG  249

Query  385  RFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKE  206
            RFTAVSFQVLGHMKTILVL +GF FF ++G+N+ V+LGM IA++GM+WYGNASSK GGKE
Sbjct  250  RFTAVSFQVLGHMKTILVLVMGFFFFDRDGLNLHVILGMIIAVLGMIWYGNASSKPGGKE  309

Query  205  R  203
            +
Sbjct  310  K  310


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           + GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLSSFNLLGHTAPAQAATLLIVGP  205



>ref|XP_003580096.1| PREDICTED: UDP-galactose transporter 2-like [Brachypodium distachyon]
Length=329

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT   + ++HYT +    IVLSC IA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDFWLTRNRIDSFHYTSTVTFFIVLSCLIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQV+GHMKTILVLTLGFLFFGKEG+N  V +GM +A+VGM+WY +ASSK GGKER
Sbjct  250  FTAVTFQVIGHMKTILVLTLGFLFFGKEGLNFHVAIGMILAVVGMIWYSSASSKPGGKER  309



>ref|XP_009134166.1| PREDICTED: UDP-galactose transporter 2-like [Brassica rapa]
Length=334

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y + ++  I LSCTIAIGTNLSQFICIGR
Sbjct  190  GHTAPAQAATLLIVGPFLDFWLTEKRVDMYDYNVVSLMFITLSCTIAIGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FF ++G+N+ VV+GM IA++GM+WYGNASSK GGKE+
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFDRDGLNLHVVIGMIIAVLGMIWYGNASSKPGGKEK  309


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           + GP
Sbjct  159  AAFVAVWSTALQQYYVHYLQRKYSLTSFNLLGHTAPAQAATLLIVGP  205



>gb|EYU24057.1| hypothetical protein MIMGU_mgv1a009794mg [Erythranthe guttata]
Length=331

 Score =   184 bits (467),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             +TAP QAASLL++GP  D WLT+K V A++YT ++V LI LSC IAIGTNLSQFICIGR
Sbjct  187  ANTAPPQAASLLILGPFMDYWLTEKRVDAFNYTFTSVMLITLSCAIAIGTNLSQFICIGR  246

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVLTLGF+FF K G+N+ V++GM  A+ GM+WYG+ASS+ GGKE+
Sbjct  247  FTAVSFQVLGHMKTILVLTLGFVFFAKNGLNVNVIVGMVFAVAGMIWYGHASSQPGGKEK  306

Query  202  VQ  197
             Q
Sbjct  307  SQ  308


 Score = 51.2 bits (121),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AAFIA  ST++QQYYVH LQRK+S+GSF+LL
Sbjct  156  AAFIAVWSTSMQQYYVHFLQRKHSIGSFDLL  186



>ref|XP_009406813.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406814.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406815.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406816.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406817.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score =   180 bits (456),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT+K V  + Y  + V  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDYWLTNKRVDRFDYNATVVLFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQV+GHMKTILVL LGF  FG+EG+N  V+ GM +A++GM+WYG+A+SK GGKER
Sbjct  250  FTAVSFQVIGHMKTILVLILGFFLFGREGLNSHVIFGMILAVLGMMWYGSATSKPGGKER  309


 Score = 55.5 bits (132),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  ST+LQQYYVH LQ+KYSLGSFNLLG
Sbjct  159  AAIIAVWSTSLQQYYVHFLQKKYSLGSFNLLG  190



>emb|CDX90737.1| BnaA03g24170D [Brassica napus]
Length=385

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLT+K V  Y Y + ++  I LSCTIAIGTNLSQFICIGR
Sbjct  241  GHTAPAQAATLLIVGPFLDFWLTEKRVDMYDYNVVSLMFITLSCTIAIGTNLSQFICIGR  300

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FF ++G+N+ VV+GM IA++GM+WYGNASSK GGKE+
Sbjct  301  FTAVSFQVLGHMKTILVLIMGFFFFDRDGLNLHVVIGMIIAVLGMIWYGNASSKPGGKEK  360


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLGAYCTTTGCISAVGGP  516
            AAF+A  STALQQYYVH LQRKYSL SFNLLG           + GP
Sbjct  210  AAFVAVWSTALQQYYVHYLQRKYSLTSFNLLGHTAPAQAATLLIVGP  256



>gb|ABR25336.1| putative transporter [Oryza sativa Indica Group]
Length=184

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + +T  A+  + LSC IAIG NLSQFICIGR
Sbjct  42   GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFGFTSIALFFLTLSCVIAIGVNLSQFICIGR  101

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N QVVLGM +A+VGM+WYGNAS+K GGKER
Sbjct  102  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNFQVVLGMILAVVGMIWYGNASAKPGGKER  161


 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  11   AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  42



>ref|XP_006663829.1| PREDICTED: UDP-galactose transporter 2-like [Oryza brachyantha]
Length=332

 Score =   179 bits (454),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + +T  AV  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFGFTSLAVFFLTLSCVIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGF+FFGKEG+N QVVLGM +A+VGM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFIFFGKEGLNFQVVLGMILAVVGMIWYGNASAKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  190



>ref|XP_011100915.1| PREDICTED: UDP-galactose transporter 2-like [Sesamum indicum]
Length=339

 Score =   182 bits (463),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP QAASLL++GP+ D WLTDK V +Y YT ++   I+LSC IA+GTNLSQFICIGR
Sbjct  199  AHTAPPQAASLLILGPLMDYWLTDKRVDSYGYTFTSTMFIILSCAIAVGTNLSQFICIGR  258

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSF VLGHMKTILVL LGF+FFGK+ +N  VV+GM +A++GM+WYG+ASS+ GGKER
Sbjct  259  FTAVSFLVLGHMKTILVLILGFVFFGKDVLNPHVVVGMFVAVMGMIWYGHASSQPGGKER  318

Query  202  VQ  197
             Q
Sbjct  319  SQ  320


 Score = 50.8 bits (120),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA +A  ST LQQYYVH LQRK+S+GSFNLL
Sbjct  168  AALVAVWSTTLQQYYVHSLQRKHSIGSFNLL  198



>ref|NP_001066187.1| Os12g0154600 [Oryza sativa Japonica Group]
 gb|ABA95853.1| transporter, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29206.1| Os12g0154600 [Oryza sativa Japonica Group]
 gb|EAY82305.1| hypothetical protein OsI_37515 [Oryza sativa Indica Group]
 gb|EAZ19687.1| hypothetical protein OsJ_35262 [Oryza sativa Japonica Group]
 dbj|BAG93243.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   179 bits (453),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + +T  A+  + LSC IAIG NLSQFICIGR
Sbjct  191  GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFGFTSIALFFLTLSCVIAIGVNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N QVVLGM +A+VGM+WYGNAS+K GGKER
Sbjct  251  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNFQVVLGMILAVVGMIWYGNASAKPGGKER  310


 Score = 54.3 bits (129),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  160  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  191



>gb|ABG21891.1| transporter, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG95016.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68875.1| hypothetical protein OsI_37497 [Oryza sativa Indica Group]
 gb|EEE52788.1| hypothetical protein OsJ_35260 [Oryza sativa Japonica Group]
Length=333

 Score =   178 bits (452),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + +T  A+  + LSC IAIG NLSQFICIGR
Sbjct  191  GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFGFTSIALFFLTLSCVIAIGVNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N QVVLGM +A+VGM+WYGNAS+K GGKER
Sbjct  251  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNFQVVLGMILAVVGMIWYGNASAKPGGKER  310


 Score = 54.3 bits (129),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  160  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  191



>ref|XP_004982861.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=332

 Score =   178 bits (452),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  ++++  A+  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFNFSSLALFFLTLSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  190



>ref|XP_002450200.1| hypothetical protein SORBIDRAFT_05g001870 [Sorghum bicolor]
 gb|EES09188.1| hypothetical protein SORBIDRAFT_05g001870 [Sorghum bicolor]
Length=332

 Score =   178 bits (451),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDYLLTGKRVDHFSFSSLALFFLALSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  190



>gb|ACF86881.1| unknown [Zea mays]
Length=332

 Score =   178 bits (452),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFADYLLTGKRVDHFSFSSLALFFLALSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  190



>gb|AFW64703.1| integral membrane protein like protein isoform 1 [Zea mays]
 gb|AFW64704.1| integral membrane protein like protein isoform 2 [Zea mays]
Length=332

 Score =   178 bits (452),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFADYLLTGKRVDHFSFSSLALFFLALSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  190



>gb|ACF80912.1| unknown [Zea mays]
 gb|AFW64702.1| hypothetical protein ZEAMMB73_900572 [Zea mays]
Length=235

 Score =   178 bits (452),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  93   GHTAPAQAGSLLLVGPFADYLLTGKRVDHFSFSSLALFFLALSCFIAIGVNLSQFICIGR  152

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  153  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  212


 Score = 53.9 bits (128),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  62   AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  93



>ref|XP_002874590.1| hypothetical protein ARALYDRAFT_489833 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50849.1| hypothetical protein ARALYDRAFT_489833 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAA+LL+VGP  D WLTDK V  Y Y   ++  I L CTIAIGT LSQFICIGR
Sbjct  182  GHTAPAQAATLLIVGPFLDYWLTDKRVDMYDYNFVSLMFITLLCTIAIGTILSQFICIGR  241

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FF ++G+N+ VVLGM IA++GM+WYGNASSK GGKE+
Sbjct  242  FTAVSFQVLGHMKTILVLVMGFFFFDRDGLNLHVVLGMIIAVLGMIWYGNASSKPGGKEK  301



>gb|AFW64701.1| hypothetical protein ZEAMMB73_900572 [Zea mays]
Length=222

 Score =   178 bits (452),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  80   GHTAPAQAGSLLLVGPFADYLLTGKRVDHFSFSSLALFFLALSCFIAIGVNLSQFICIGR  139

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  140  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  199


 Score = 53.9 bits (128),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  49   AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  80



>ref|XP_006663828.1| PREDICTED: UDP-galactose transporter 2-like [Oryza brachyantha]
Length=332

 Score =   177 bits (450),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + +T  A   + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDYLLTGKRVDHFGFTSLATFFLTLSCVIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNFQVVLGMILAVLGMIWYGNASAKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  190



>gb|EMT00653.1| hypothetical protein F775_29393 [Aegilops tauschii]
Length=329

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT   +  +HYT +    IVLSC I++GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDFWLTRNRIDTFHYTSTVTFFIVLSCVISVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQV+GHMKTILVLTLGFL FGKEG+N  V  GM +AIVGM+WY +ASSK GGKER
Sbjct  250  FTAVTFQVIGHMKTILVLTLGFLLFGKEGLNFHVAFGMILAIVGMIWYSSASSKPGGKER  309



>dbj|BAJ85267.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT   +  +HYT +    IVLSC I++GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDFWLTRNRIDTFHYTSTVTFFIVLSCVISVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQV+GHMKTILVLTLGFL FGKEG+N  V  GM +AIVGM+WY +ASSK GGKER
Sbjct  250  FTAVTFQVIGHMKTILVLTLGFLLFGKEGLNFHVAFGMILAIVGMIWYSSASSKPGGKER  309



>gb|ACN31946.1| unknown [Zea mays]
 gb|ACN35704.1| unknown [Zea mays]
 tpg|DAA39271.1| TPA: hypothetical protein ZEAMMB73_483784 [Zea mays]
Length=222

 Score =   177 bits (449),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  +  +  A+  + LSC IAIG NLSQFICIGR
Sbjct  80   GHTAPAQAGSLLLVGPFADYLLTGKRVDQFSLSSLALFFLALSCFIAIGVNLSQFICIGR  139

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  140  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  199


 Score = 53.9 bits (128),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  49   AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  80



>ref|NP_001148538.1| integral membrane protein like [Zea mays]
 gb|ACG31895.1| integral membrane protein like [Zea mays]
 gb|ACL53944.1| unknown [Zea mays]
 gb|ACN32141.1| unknown [Zea mays]
 tpg|DAA39269.1| TPA: putative integral membrane protein isoform 1 [Zea mays]
 tpg|DAA39270.1| TPA: putative integral membrane protein isoform 2 [Zea mays]
Length=332

 Score =   177 bits (448),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  +  +  A+  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFADYLLTGKRVDQFSLSSLALFFLALSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  190



>ref|XP_003592056.1| Membrane protein, putative [Medicago truncatula]
 gb|AES62307.1| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=320

 Score =   175 bits (443),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP+ D WLT+K V  Y Y  ++   ++LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLLGPLLDYWLTNKRVDQYSYDAASSMFLILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA+VGM+WYGNASSK GGKER
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVIGMIIAVVGMMWYGNASSKPGGKER  309


 Score = 55.8 bits (133),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHYLQRKYSLSSFNLLG  190



>ref|XP_008667952.1| PREDICTED: integral membrane protein like isoform X1 [Zea mays]
Length=275

 Score =   176 bits (447),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  +  +  A+  + LSC IAIG NLSQFICIGR
Sbjct  133  GHTAPAQAGSLLLVGPFADYLLTGKRVDQFSLSSLALFFLALSCFIAIGVNLSQFICIGR  192

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  193  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  252


 Score = 54.3 bits (129),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  102  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  133



>emb|CAN72212.1| hypothetical protein VITISV_012257 [Vitis vinifera]
Length=1102

 Score =   171 bits (433),  Expect(2) = 2e-51, Method: Composition-based stats.
 Identities = 78/106 (74%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL+GP  D WLT+K V  Y Y  +++  I+LSCTIA+GTNLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLLGPFLDYWLTNKRVDMYQYNTASLIFIILSCTIAVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMV  245
            FTAVSFQVLGHMKTILVL +GF FFGKEG+N+QVVLGM IA+VGM+
Sbjct  250  FTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLQVVLGMIIAVVGMM  295


 Score = 58.9 bits (141),  Expect(2) = 2e-51, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAFIA  ST+LQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAFIAVWSTSLQQYYVHFLQRKYSLSSFNLLG  190



>ref|NP_001150661.1| integral membrane protein like [Zea mays]
 gb|ACG39923.1| integral membrane protein like [Zea mays]
Length=332

 Score =   176 bits (445),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFADYLLTGKRVDHFSFSSLALFFLALSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFL FGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLLFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  309


 Score = 54.3 bits (129),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  190



>ref|XP_004977451.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=332

 Score =   179 bits (453),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  ++++  A+  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDYLLTGKRVDHFNFSSLALFFLTLSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  309


 Score = 50.1 bits (118),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STA QQYYVH LQ+KY+L SFNLLG
Sbjct  159  AAVIAVWSTAFQQYYVHFLQKKYALNSFNLLG  190



>ref|XP_002441741.1| hypothetical protein SORBIDRAFT_08g001580 [Sorghum bicolor]
 gb|EES15579.1| hypothetical protein SORBIDRAFT_08g001580 [Sorghum bicolor]
Length=336

 Score =   174 bits (441),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL GP  D  LT + V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  194  GHTAPAQAGSLLLAGPFVDYLLTGQRVDHFSFSSLALFFLTLSCFIAIGVNLSQFICIGR  253

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVV+GM +A++GM+WYGNAS+K GGKER
Sbjct  254  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVIGMVLAVLGMIWYGNASAKPGGKER  313


 Score = 54.3 bits (129),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  163  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  194



>ref|XP_002969143.1| hypothetical protein SELMODRAFT_170422 [Selaginella moellendorffii]
 ref|XP_002973919.1| hypothetical protein SELMODRAFT_100527 [Selaginella moellendorffii]
 gb|EFJ24874.1| hypothetical protein SELMODRAFT_100527 [Selaginella moellendorffii]
 gb|EFJ30259.1| hypothetical protein SELMODRAFT_170422 [Selaginella moellendorffii]
Length=338

 Score =   176 bits (447),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 101/122 (83%), Gaps = 2/122 (2%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVS--LIVLSCTIAIGTNLSQFICI  389
            GHTAP+QA SL+L GPI D WLT   V  + ++  ++    I+LSC+IA+GTNLSQFICI
Sbjct  190  GHTAPVQAGSLILCGPIIDYWLTGLRVDLFQFSFPSLVSFFIILSCSIAVGTNLSQFICI  249

Query  388  GRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGK  209
            GRFTAVSFQVLGHMKT+LVL LGF  FG++G+N+QVVLGM +A+VGMVWYGNASSK GGK
Sbjct  250  GRFTAVSFQVLGHMKTVLVLVLGFFLFGRQGLNLQVVLGMLMAVVGMVWYGNASSKPGGK  309

Query  208  ER  203
            E+
Sbjct  310  EK  311


 Score = 52.0 bits (123),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQ+KY+LGSF+LLG
Sbjct  159  AAAIAVWSTALQQYYVHFLQKKYALGSFDLLG  190



>ref|XP_004504000.1| PREDICTED: UDP-galactose transporter 2-like [Cicer arietinum]
Length=362

 Score =   173 bits (438),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP+QA SLLLVGP  D WLT+K V AY+Y L+++  I LSC+IA+GTNLSQFICIGR
Sbjct  215  GHTAPIQATSLLLVGPFLDYWLTNKRVDAYNYGLTSILFIALSCSIAVGTNLSQFICIGR  274

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGG  212
            FTAVSFQVLGHMKTILVLTLGF+ FGKEG+N+QV++GM IAI+GM+WYGNASSK GG
Sbjct  275  FTAVSFQVLGHMKTILVLTLGFILFGKEGLNLQVIIGMIIAIMGMIWYGNASSKPGG  331


 Score = 54.3 bits (129),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  STALQQYYVH LQ+KYSLGSFNLLG
Sbjct  184  AAAVAVWSTALQQYYVHFLQKKYSLGSFNLLG  215



>gb|EMS68535.1| hypothetical protein TRIUR3_30184 [Triticum urartu]
Length=472

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLL++GP  D WLT   +  +HYT +    IVLSC I++GTNLSQFICIGR
Sbjct  190  GHTAPAQAASLLILGPFVDFWLTRNRIDTFHYTSTVTFFIVLSCVISVGTNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTAV+FQV+GHMKTILVLTLGFL FGKEG+N  V  GM +AIVGM+WY +ASSK GGKER
Sbjct  250  FTAVTFQVIGHMKTILVLTLGFLLFGKEGLNFHVAFGMILAIVGMIWYSSASSKPGGKER  309



>ref|XP_004978448.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=332

 Score =   176 bits (447),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  ++++  A+  + LSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDYLLTGKRVDHFNFSSLALFFLTLSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+++QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLSLQVVLGMVLAVLGMIWYGNASAKPGGKER  309


 Score = 50.1 bits (118),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STA QQYYVH LQ+KY+L SFNLLG
Sbjct  159  AAVIAVWSTAFQQYYVHFLQKKYALNSFNLLG  190



>ref|XP_004976151.1| PREDICTED: UDP-galactose transporter 2-like [Setaria italica]
Length=337

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QAASLLL+GP  D WLT+  V  YHY       I LS  IAIGTNLSQFICIGR
Sbjct  192  GHTAPAQAASLLLLGPFVDLWLTNNRVDTYHYNNVVTFFIALSSVIAIGTNLSQFICIGR  251

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKE  206
            FTAVSFQVLGHMKTILVLTLGF+ FG+EG+N+ V  GM +AIVGM+WY +ASS+ GGKE
Sbjct  252  FTAVSFQVLGHMKTILVLTLGFILFGREGLNVHVAFGMILAIVGMIWYNHASSRPGGKE  310



>ref|XP_008646624.1| PREDICTED: uncharacterized protein LOC103628142 [Zea mays]
Length=315

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  +  +  A+  + LSC IAIG NLSQFICIGR
Sbjct  173  GHTAPAQAGSLLLVGPFADYLLTGKRVDQFSLSSLALFFLALSCFIAIGVNLSQFICIGR  232

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM +A++GM+WYGNAS+K GGKER
Sbjct  233  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNASAKPGGKER  292



>gb|ABA95848.2| transporter, putative, expressed [Oryza sativa Japonica Group]
Length=333

 Score =   163 bits (413),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + +T  A+  + LSC IAIG NLSQFICIGR
Sbjct  191  GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFGFTSIALFFLTLSCVIAIGVNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNAS  227
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N QVVLGM +A+VGM+WYGNAS
Sbjct  251  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNFQVVLGMILAVVGMIWYGNAS  302


 Score = 54.3 bits (129),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  160  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  191



>ref|XP_008672973.1| PREDICTED: integral membrane protein like isoform X1 [Zea mays]
 gb|ACF84710.1| unknown [Zea mays]
 tpg|DAA59205.1| TPA: integral membrane protein like protein [Zea mays]
Length=337

 Score =   165 bits (417),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL GP  D  LT + V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  200  GHTAPAQAGSLLLAGPFVDYLLTGQRVDHFSFSSLALLFLALSCFIAIGVNLSQFICIGR  259

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+++QVVLGM +A++GMVWYGNAS+K GGKER
Sbjct  260  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLSLQVVLGMALAVLGMVWYGNASAKPGGKER  319


 Score = 49.7 bits (117),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  STALQQYYVH LQRK+SL SF+LLG
Sbjct  169  AAVVAVWSTALQQYYVHFLQRKHSLNSFSLLG  200



>gb|KCW45407.1| hypothetical protein EUGRSUZ_L00902 [Eucalyptus grandis]
Length=125

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -1

Query  499  LTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLG  320
            +T K V AY YT  AV  I+LSCTIA+GTNLSQFICIGRFT VSFQV+GHMKTILVL +G
Sbjct  1    MTSKRVDAYDYTPVAVMFIILSCTIAVGTNLSQFICIGRFTDVSFQVIGHMKTILVLIMG  60

Query  319  FLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FLFFGKEG+N+QVV+GM IA+VGM+WYGNASSK GGKER
Sbjct  61   FLFFGKEGLNLQVVIGMIIAVVGMIWYGNASSKPGGKER  99



>ref|NP_001150996.1| integral membrane protein like [Zea mays]
 gb|ACG41208.1| integral membrane protein like [Zea mays]
Length=337

 Score =   164 bits (414),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLL GP  D  LT + V  + ++  A+  + LSC IAIG NLSQFICIGR
Sbjct  200  GHTAPAQAGSLLLAGPFVDYLLTGQRVDHFSFSSLALLFLALSCFIAIGVNLSQFICIGR  259

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+++QVV+GM +A++GMVWYGNAS+K GGKER
Sbjct  260  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLSLQVVVGMALAVLGMVWYGNASAKPGGKER  319


 Score = 49.7 bits (117),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA +A  STALQQYYVH LQRK+SL SF+LLG
Sbjct  169  AAVVAVWSTALQQYYVHFLQRKHSLNSFSLLG  200



>ref|XP_002524332.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38072.1| conserved hypothetical protein [Ricinus communis]
Length=291

 Score =   159 bits (401),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTA  QAA+LL VGP  D WLT+K + AY Y+ ++V  I LSCTIA+GTNLSQFICIGR
Sbjct  145  GHTAAAQAATLLFVGPFLDYWLTNKRIYAYEYSAASVMFITLSCTIAVGTNLSQFICIGR  204

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FTA+SFQVLGHMKTILVL LG  FFG+EG  + VVLGM +A+VGM+WYGNAS K GGKER
Sbjct  205  FTAMSFQVLGHMKTILVLILGLFFFGREGFTLHVVLGMVVAVVGMIWYGNASCKPGGKER  264


 Score = 53.1 bits (126),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AAF++  ST++QQYYVH LQRKYSL SFNLLG
Sbjct  114  AAFVSVWSTSMQQYYVHHLQRKYSLSSFNLLG  145



>ref|NP_001066185.1| Os12g0154000 [Oryza sativa Japonica Group]
 dbj|BAF29204.1| Os12g0154000 [Oryza sativa Japonica Group]
Length=334

 Score =   154 bits (388),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  + +T  A+  + LSC IAIG NLSQFICIGR
Sbjct  191  GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFGFTSIALFFLTLSCVIAIGVNLSQFICIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSK  221
            F+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N QVVLGM +A+VGM+W    + K
Sbjct  251  FSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNFQVVLGMILAVVGMIWMAVRNKK  304


 Score = 54.7 bits (130),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STALQQYYVH LQRKYSL SFNLLG
Sbjct  160  AAVIAVWSTALQQYYVHFLQRKYSLNSFNLLG  191



>ref|XP_003578985.1| PREDICTED: UDP-galactose transporter 2-like [Brachypodium distachyon]
Length=332

 Score =   149 bits (377),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  ++++  ++  +VLSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFNFSSLSLFFLVLSCFIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL LGFLFFGKEG+N+ VVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLFLGFLFFGKEGLNLHVVLGMILAVLGMMWYGNASAKPGGKER  309


 Score = 52.8 bits (125),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STA QQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTAFQQYYVHYLQRKYSLNSFNLLG  190



>gb|EMT23032.1| hypothetical protein F775_28662 [Aegilops tauschii]
Length=385

 Score =   149 bits (376),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  +++T  ++  +VLSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDYLLTGKRVDHFNFTSLSLLFVVLSCIIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL LGFLFFGKEG+N+ VVLGM +A++GM+WYGNAS+K GGKE 
Sbjct  250  FSAVSFQVLGHMKTVLVLFLGFLFFGKEGLNLHVVLGMILAVLGMMWYGNASAKPGGKEA  309

Query  202  V  200
            +
Sbjct  310  I  310


 Score = 52.4 bits (124),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STA QQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTAFQQYYVHYLQRKYSLNSFNLLG  190



>dbj|BAJ95945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   150 bits (379),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
             HTAP QA SLLLVGP  D  LT K V  +++T  ++  IVLSC IAIG NLSQFICIGR
Sbjct  190  AHTAPAQAGSLLLVGPFVDFLLTGKRVDHFNFTSLSLLFIVLSCIIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            F+AVSFQVLGHMKT+LVL LGFLFFGKEG+N+ VVLGM +A++GM+WYGNAS+K GGKER
Sbjct  250  FSAVSFQVLGHMKTVLVLFLGFLFFGKEGLNLHVVLGMILAVLGMMWYGNASAKPGGKER  309


 Score = 50.1 bits (118),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
            AA IA  STA QQYYVH LQRKYSL SFNLL
Sbjct  159  AAVIAVWSTAFQQYYVHYLQRKYSLNSFNLL  189



>gb|KCW73131.1| hypothetical protein EUGRSUZ_E01586 [Eucalyptus grandis]
Length=125

 Score =   150 bits (378),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  499  LTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLG  320
            +T K V AY Y   AV  I+LS TIA+GTNLSQFI IGRFT VSFQV+GH+KTILVL +G
Sbjct  1    MTSKRVDAYDYIPVAVMFIILSYTIAVGTNLSQFIYIGRFTVVSFQVIGHVKTILVLIMG  60

Query  319  FLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            FLFFGKEG+N+QVV+GM IA+VGM+WYGNASSK GGKER
Sbjct  61   FLFFGKEGLNLQVVIGMIIAVVGMIWYGNASSKPGGKER  99



>gb|EPS64409.1| hypothetical protein M569_10371, partial [Genlisea aurea]
Length=120

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -1

Query  544  QAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFTAVSF  365
            +AASLLL+GP  D WLT+K +  Y + + +   I+LSCTIA+GTNLSQFICIGRFTAVSF
Sbjct  21   RAASLLLIGPFLDYWLTNKRIDNYGFNILSTVFIILSCTIAVGTNLSQFICIGRFTAVSF  80

Query  364  QVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMV  245
            QVLGHMKTILVL LGF+FFG EG+N+QVV GM IA+ GMV
Sbjct  81   QVLGHMKTILVLVLGFIFFGNEGLNLQVVFGMLIAVFGMV  120



>ref|XP_006427931.1| hypothetical protein CICLE_v10026818mg [Citrus clementina]
 gb|ESR41171.1| hypothetical protein CICLE_v10026818mg [Citrus clementina]
Length=105

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  445  IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG  266
            ++LSC+IA+GTNLSQFICIGRFTAV+FQVLGHMKTILVL LGF+FFGKEG+N+QV+LGM 
Sbjct  1    MILSCSIAVGTNLSQFICIGRFTAVTFQVLGHMKTILVLVLGFIFFGKEGLNMQVILGMV  60

Query  265  IAIVGMVWYGNASSKAGGKER  203
            IA++GM+WYGNASSK GGKER
Sbjct  61   IAVLGMIWYGNASSKPGGKER  81



>gb|KDO57103.1| hypothetical protein CISIN_1g045581mg, partial [Citrus sinensis]
Length=107

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  448  LIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGM  269
             ++LSC+IA+GTNLSQFICIGRFTAV+FQVLGHMKTILVL LGF+FFGKEG+N+QV+LGM
Sbjct  2    FMILSCSIAVGTNLSQFICIGRFTAVTFQVLGHMKTILVLVLGFIFFGKEGLNMQVILGM  61

Query  268  GIAIVGMVWYGNASSKAGGKER  203
             IA++GM+WYGNASSK GGKER
Sbjct  62   VIAVLGMIWYGNASSKPGGKER  83



>emb|CDY43897.1| BnaA07g01740D [Brassica napus]
Length=582

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 97/137 (71%), Gaps = 21/137 (15%)
 Frame = -1

Query  613  MXTXFNGSTH*DLSIYWGHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLS  434
            M   + G+    LSIYW    PLQ                   V A++++  ++  ++LS
Sbjct  441  MYIIYRGNIRLVLSIYW--RIPLQ-------------------VDAFNFSFVSLFFLILS  479

Query  433  CTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIV  254
            C+IA+GTNLSQFICIGRFTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+
Sbjct  480  CSIAVGTNLSQFICIGRFTAVSFQVLGHMKTILVLVLGFTFFGKEGLNMQVVLGMLIAIL  539

Query  253  GMVWYGNASSKAGGKER  203
            GM+WYGNASSK GGKER
Sbjct  540  GMIWYGNASSKPGGKER  556



>ref|XP_010444889.1| PREDICTED: UDP-galactose transporter 2 [Camelina sativa]
Length=278

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  487  SVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFF  308
            ++  +   L     ++LSC+IA+GTNLSQFICIGRFTAVSFQVLGHMKTILVL LGF FF
Sbjct  161  AIAVWSTALQQYFFLILSCSIAVGTNLSQFICIGRFTAVSFQVLGHMKTILVLVLGFTFF  220

Query  307  GKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER  203
            GKEG+NIQVVLGM IAI+GM+WYGN SSK GGKER
Sbjct  221  GKEGLNIQVVLGMLIAILGMIWYGNVSSKPGGKER  255



>gb|AFK44295.1| unknown [Medicago truncatula]
Length=94

 Score =   140 bits (353),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -1

Query  448  LIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGM  269
             ++LSCTIA+GTN SQFICIGRFTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM
Sbjct  2    FLILSCTIAVGTNFSQFICIGRFTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVIGM  61

Query  268  GIAIVGMVWYGNASSKAGGKER  203
             IA+VGM+WYGNASSK GGKER
Sbjct  62   IIAVVGMMWYGNASSKPGGKER  83



>gb|EYU31110.1| hypothetical protein MIMGU_mgv1a0096512mg, partial [Erythranthe 
guttata]
Length=108

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  448  LIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGM  269
             +VLSC IAIGTNLSQ ICIGRFT VSFQVLGHMKTILVL LGFLFFGKEG+N+ VV+GM
Sbjct  2    FVVLSCAIAIGTNLSQVICIGRFTPVSFQVLGHMKTILVLILGFLFFGKEGLNLHVVVGM  61

Query  268  GIAIVGMVWYGNASSKAGGKER  203
             +AIVGMVWYG+ASS+ GGKER
Sbjct  62   MVAIVGMVWYGHASSRPGGKER  83



>ref|XP_002467076.1| hypothetical protein SORBIDRAFT_01g019245 [Sorghum bicolor]
 gb|EER94074.1| hypothetical protein SORBIDRAFT_01g019245 [Sorghum bicolor]
Length=106

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  448  LIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGM  269
             + L C IAIG NLSQFICIGRF+AVSFQVLGHMKT+LVL+LGFLFFGKEG+N+QVVLGM
Sbjct  2    FLTLLCFIAIGVNLSQFICIGRFSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGM  61

Query  268  GIAIVGMVWYGNASSKAGGKE  206
             +A++GMVWYGNAS K GGKE
Sbjct  62   VLAVLGMVWYGNASGKPGGKE  82



>gb|EMS65678.1| hypothetical protein TRIUR3_32365 [Triticum urartu]
Length=333

 Score =   123 bits (308),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
            GHTAP QA SLLLVGP  D  LT K V  +++T  ++  +VLSC IAIG NLSQFICIGR
Sbjct  190  GHTAPAQAGSLLLVGPFVDFLLTGKRVDHFNFTSLSLLFVVLSCIIAIGVNLSQFICIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMV  245
            F+AVSFQVLGHMKT+LVL LGFLFFGKEG+N+ VVLGM +A++GM+
Sbjct  250  FSAVSFQVLGHMKTVLVLFLGFLFFGKEGLNLHVVLGMILAVLGMM  295


 Score = 52.8 bits (125),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLLG  561
            AA IA  STA QQYYVH LQRKYSL SFNLLG
Sbjct  159  AAVIAVWSTAFQQYYVHYLQRKYSLNSFNLLG  190



>gb|KDO83810.1| hypothetical protein CISIN_1g045440mg, partial [Citrus sinensis]
Length=98

 Score =   128 bits (321),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  421  IGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVW  242
            +GTNLSQFICIGRFTAVSFQVLGHMKTILVL +GFLFFGKEG+N+ VVLGM IA+ GM+W
Sbjct  1    VGTNLSQFICIGRFTAVSFQVLGHMKTILVLIMGFLFFGKEGLNLHVVLGMIIAVFGMIW  60

Query  241  YGNASSKAGGKER  203
            Y NAS+K GGKER
Sbjct  61   YSNASTKPGGKER  73



>gb|EYU41229.1| hypothetical protein MIMGU_mgv1a009117mg [Erythranthe guttata]
Length=352

 Score =   130 bits (328),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLLL+GPI D +L+D  V  Y +T  AVS IVLSC++A+  N+SQ++CIGRF+
Sbjct  192  TAPIQAVSLLLLGPIVDYYLSDNLVLDYKFTSGAVSFIVLSCSLAVFCNVSQYLCIGRFS  251

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            AVSFQVLGHMKT+ VLTLG+L F  E + ++ ++GMG+A++GMV Y 
Sbjct  252  AVSFQVLGHMKTVCVLTLGWLLFDSE-LTLKNIMGMGVAVIGMVIYS  297


 Score = 37.0 bits (84),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  159  CACVAVFSTSLQQISIGSLQKKYSVGSFELL  189



>gb|EPS61546.1| hypothetical protein M569_13251, partial [Genlisea aurea]
Length=340

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL++GP+ D +L++ SV  Y +T  ++  I+LSC++A+  N+SQ++CIGR
Sbjct  190  SRTAPIQACSLLVLGPMIDFYLSNNSVFEYRFTPGSLIFIILSCSLAVFCNMSQYLCIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA--SSKAGGK  209
            F+AVSFQVLGHMKT+ VLTLG+L F  E + ++ ++GM +A+ GMV Y  A  S K GG 
Sbjct  250  FSAVSFQVLGHMKTVCVLTLGWLLFDSE-LTVKNIMGMLVAVAGMVIYSQAVESEKKGGI  308

Query  208  ERV  200
             RV
Sbjct  309  ARV  311



>ref|XP_004139986.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis sativus]
 gb|KGN46629.1| hypothetical protein Csa_6G115640 [Cucumis sativus]
Length=377

 Score =   124 bits (310),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL VGP  D  LT KS+  Y+YTL A   I+LSC++A+  N+SQ++CIGR
Sbjct  222  SKTAPIQALSLLTVGPFVDYCLTSKSLLKYNYTLGAFCFILLSCSLAVFCNISQYLCIGR  281

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+AVSFQVLGHMKT+ VL LG+L F  E M ++ + GM +AIVGMV Y 
Sbjct  282  FSAVSFQVLGHMKTVCVLMLGWLLFDSE-MTLKNISGMVLAIVGMVVYS  329


 Score = 36.6 bits (83),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A   T+LQQ  +  LQ+KYS+GSF LL
Sbjct  191  CALVAILCTSLQQISIGSLQKKYSIGSFELL  221



>ref|XP_004154521.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis sativus]
Length=345

 Score =   123 bits (309),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL VGP  D  LT KS+  Y+YTL A   I+LSC++A+  N+SQ++CIGR
Sbjct  190  SKTAPIQALSLLTVGPFVDYCLTSKSLLKYNYTLGAFCFILLSCSLAVFCNISQYLCIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA  230
            F+AVSFQVLGHMKT+ VL LG+L F  E M ++ + GM +AIVGMV Y  A
Sbjct  250  FSAVSFQVLGHMKTVCVLMLGWLLFDSE-MTLKNISGMVLAIVGMVVYSWA  299


 Score = 36.6 bits (83),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A   T+LQQ  +  LQ+KYS+GSF LL
Sbjct  159  CALVAILCTSLQQISIGSLQKKYSIGSFELL  189



>ref|XP_008448146.1| PREDICTED: UDP-galactose transporter 2-like [Cucumis melo]
Length=377

 Score =   122 bits (306),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL VGP  D  LT KS+  Y+YT  A   I+LSC++A+  N+SQ++CIGR
Sbjct  222  SKTAPIQALSLLTVGPFVDYCLTSKSLLKYNYTFGAFCFILLSCSLAVFCNISQYLCIGR  281

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+AVSFQVLGHMKT+ VL LG+L F  E M ++ + GM +AIVGMV Y 
Sbjct  282  FSAVSFQVLGHMKTVCVLMLGWLLFDSE-MTLKNISGMVLAIVGMVVYS  329


 Score = 36.6 bits (83),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A   T+LQQ  +  LQ+KYS+GSF LL
Sbjct  191  CALVAILCTSLQQISIGSLQKKYSIGSFELL  221



>gb|KJB77442.1| hypothetical protein B456_012G137400 [Gossypium raimondii]
 gb|KJB77443.1| hypothetical protein B456_012G137400 [Gossypium raimondii]
Length=345

 Score =   119 bits (298),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = -1

Query  559  HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF  380
             TAP+QA SLLL+GP  D +LT   +  YH + +A   I++SC++A+  N+SQ++CIGRF
Sbjct  192  QTAPIQAVSLLLLGPFVDYFLTGNLLPTYHLSSAAFFFILVSCSLAVFCNISQYLCIGRF  251

Query  379  TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA  230
            +AVSFQVLGHMKT+ VLTLG+L F  E +  + +LGM IA++GMV Y  A
Sbjct  252  SAVSFQVLGHMKTVCVLTLGWLLFDSE-LTFKNILGMAIAVLGMVLYSWA  300


 Score = 38.5 bits (88),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             AF+A  ST+LQQ  +  LQ+KY++GSF LL
Sbjct  160  CAFVAVLSTSLQQISIGSLQKKYAIGSFELL  190



>gb|KJB31920.1| hypothetical protein B456_005G214900 [Gossypium raimondii]
Length=293

 Score =   119 bits (299),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLLL GP  D +LT K + +Y ++ +A   I+LSC++A+  N+SQ++CIGR
Sbjct  137  SQTAPIQALSLLLFGPFVDYYLTGKLLASYKFSSAAFFFILLSCSLAVFCNISQYLCIGR  196

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+A SFQVLGHMKT+ VL LG+L F  E + ++ +LGM IAI+GMV Y 
Sbjct  197  FSATSFQVLGHMKTVCVLILGWLLFDSE-LTLKNILGMAIAILGMVVYS  244


 Score = 37.4 bits (85),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  106  CACVAVLSTSLQQISIGSLQKKYSIGSFELL  136



>gb|KJB31917.1| hypothetical protein B456_005G214900 [Gossypium raimondii]
Length=347

 Score =   119 bits (298),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLLL GP  D +LT K + +Y ++ +A   I+LSC++A+  N+SQ++CIGR
Sbjct  191  SQTAPIQALSLLLFGPFVDYYLTGKLLASYKFSSAAFFFILLSCSLAVFCNISQYLCIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+A SFQVLGHMKT+ VL LG+L F  E + ++ +LGM IAI+GMV Y 
Sbjct  251  FSATSFQVLGHMKTVCVLILGWLLFDSE-LTLKNILGMAIAILGMVVYS  298


 Score = 37.4 bits (85),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  160  CACVAVLSTSLQQISIGSLQKKYSIGSFELL  190



>gb|EPS67006.1| hypothetical protein M569_07768, partial [Genlisea aurea]
Length=338

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLL++GP+ D  L+ KS+  Y +T+ A+  IVLSC++A+  N+SQ++CIGRF+
Sbjct  191  TAPIQACSLLMLGPMIDYSLSHKSIIHYRFTVGAMLFIVLSCSLAVFCNVSQYLCIGRFS  250

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY  239
            AVSFQVLGHMKT+ VLTLG+L F  E +  + ++GM +AIVGM+ Y
Sbjct  251  AVSFQVLGHMKTVCVLTLGWLLFDSE-LTFKNIMGMTVAIVGMIIY  295



>gb|KJB31919.1| hypothetical protein B456_005G214900 [Gossypium raimondii]
Length=344

 Score =   119 bits (297),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLLL GP  D +LT K + +Y ++ +A   I+LSC++A+  N+SQ++CIGR
Sbjct  188  SQTAPIQALSLLLFGPFVDYYLTGKLLASYKFSSAAFFFILLSCSLAVFCNISQYLCIGR  247

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA  230
            F+A SFQVLGHMKT+ VL LG+L F  E + ++ +LGM IAI+GMV Y  A
Sbjct  248  FSATSFQVLGHMKTVCVLILGWLLFDSE-LTLKNILGMAIAILGMVVYSWA  297


 Score = 37.0 bits (84),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  157  CACVAVLSTSLQQISIGSLQKKYSIGSFELL  187



>ref|XP_010061361.1| PREDICTED: UDP-galactose transporter 2-like [Eucalyptus grandis]
 gb|KCW68296.1| hypothetical protein EUGRSUZ_F01961 [Eucalyptus grandis]
Length=349

 Score =   119 bits (298),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL +GP  D +L  KS+  Y  +  A+  I LSCT+A+  N+SQ++CIGR
Sbjct  190  SKTAPIQALSLLFLGPFVDYFLNSKSLRDYKMSYGALLFIFLSCTLAVFCNMSQYLCIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMV---WYGNASSKAGG  212
            F+AVSFQVLGHMKT+ VLTLG+L F  + + ++ ++GM IA+VGMV   W   A  ++  
Sbjct  250  FSAVSFQVLGHMKTVCVLTLGWLLFDSQ-LTLKNIMGMVIAVVGMVMYSWAVEAEKRSSA  308

Query  211  KERV  200
            K  V
Sbjct  309  KPTV  312


 Score = 36.6 bits (83),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  159  CACLAVLSTSLQQISIGSLQKKYSIGSFELL  189



>ref|XP_010932187.1| PREDICTED: UDP-galactose transporter 2 [Elaeis guineensis]
Length=343

 Score =   117 bits (294),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLLL+GP+ D +L  KS+  Y+++  A   I+LSC +A+  N+SQ++CIGRF+
Sbjct  191  TAPIQAISLLLLGPVIDYYLNGKSIINYNFSSGATFFILLSCALAVFCNMSQYLCIGRFS  250

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY  239
            A SFQVLGHMKT+ VL LG+L F    + ++ ++GMGIAIVGMV Y
Sbjct  251  ATSFQVLGHMKTVCVLMLGWLLFDSL-LTLKNIMGMGIAIVGMVIY  295


 Score = 38.1 bits (87),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A IA  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  158  CACIAVLSTSLQQISIGSLQKKYSIGSFELL  188



>ref|XP_008796458.1| PREDICTED: UDP-galactose transporter 2 [Phoenix dactylifera]
Length=327

 Score =   118 bits (295),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLLL+GP+ D +L  KS+  Y+++  A+  I+LSC +A+  N+SQ++CIGR
Sbjct  173  SKTAPIQAISLLLLGPLIDYYLNGKSIIKYNFSSGAIFFILLSCALAVFCNMSQYLCIGR  232

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+A SFQVLGHMKTI VL LG+L F  + + ++ ++GM IAIVGMV Y 
Sbjct  233  FSATSFQVLGHMKTICVLMLGWLLFDSQ-LTLKNIMGMVIAIVGMVIYS  280


 Score = 37.4 bits (85),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  142  CACVAVLSTSLQQISIGSLQKKYSIGSFELL  172



>gb|KEH27299.1| nucleotide/sugar transporter family protein [Medicago truncatula]
Length=355

 Score =   118 bits (296),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 83/119 (70%), Gaps = 4/119 (3%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+Q+  LL +GP  D +L+ K +  Y  +  A   I+LSC++A+  N+SQ++CIGRF+
Sbjct  195  TAPIQSLFLLTIGPFVDYYLSGKLITNYKMSFGAFLCILLSCSLAVFCNVSQYLCIGRFS  254

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMV---WYGNASSKAGGK  209
            AVSFQVLGHMKT+ VLTLG+L F  E +N + ++GMG+A++GM+   W   A  K+  K
Sbjct  255  AVSFQVLGHMKTVCVLTLGWLLFDSE-LNFKNIMGMGVAVIGMIIYSWAAEAEKKSNEK  312


 Score = 36.2 bits (82),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  162  CACLAVFSTSLQQISIGSLQKKYSIGSFELL  192



>ref|XP_007043141.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
 gb|EOX98972.1| Nucleotide-sugar transporter family protein isoform 1 [Theobroma 
cacao]
Length=347

 Score =   117 bits (293),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLLL+GP  D +++ K + +Y ++  A+  I+LSC +A+  N+SQ++CIGR
Sbjct  191  SQTAPIQALSLLLLGPFIDYYISGKLLASYKFSSPAIFFILLSCFLAVFCNISQYLCIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA  230
            F+AVSFQVLGHMKT+ VL LG+L F  E + ++ +LGM IA++GMV Y  A
Sbjct  251  FSAVSFQVLGHMKTVCVLMLGWLLFDSE-LTLKNILGMAIAVLGMVVYSWA  300


 Score = 37.0 bits (84),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  160  CACVAVLSTSLQQISIGSLQKKYSIGSFELL  190



>ref|XP_010270661.1| PREDICTED: UDP-galactose transporter 2-like [Nelumbo nucifera]
Length=347

 Score =   116 bits (291),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLLL+GP  D +L  + +  Y  +  A+  I+LSC++A+  N+SQ++CIGRF+
Sbjct  192  TAPIQALSLLLLGPFIDYYLNGQFIANYKVSSGAIFFILLSCSLAVFCNVSQYLCIGRFS  251

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            AVSFQVLGHMKT+ VLTLG+L F  E + ++ +LGM +A++GMV Y 
Sbjct  252  AVSFQVLGHMKTVCVLTLGWLLFDSE-LTLKNILGMALAVLGMVVYS  297


 Score = 38.1 bits (87),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A IA  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  159  CACIAVLSTSLQQITIGSLQKKYSIGSFELL  189



>ref|XP_010474368.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=250

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 81/125 (65%), Gaps = 10/125 (8%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLL+ GP  D +L+ K +  Y  T  A+  I+LSC +A+  N+SQ++CIGRF+
Sbjct  97   TAPIQAISLLIFGPFVDYFLSGKFISTYKMTYGAIFCILLSCALAVFCNISQYLCIGRFS  156

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG---------NASS  224
            A SFQVLGHMKT+ VLTLG+L F  E M  + + GM IAIVGMV Y          NA S
Sbjct  157  ATSFQVLGHMKTVCVLTLGWLLFDSE-MTFKNIAGMAIAIVGMVIYSWAVDVEKQRNAKS  215

Query  223  KAGGK  209
               GK
Sbjct  216  TPHGK  220



>gb|KHG20996.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=345

 Score =   115 bits (287),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = -1

Query  559  HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF  380
             TAP+QA SLLL+GP  D +LT   +  YH + +A   I++SC++A+  N+SQ++CIGRF
Sbjct  192  QTAPIQALSLLLLGPFVDYFLTGNLLPTYHLSSAAFFFILVSCSLAVFCNISQYLCIGRF  251

Query  379  TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA  230
            +AVSFQVLGHMKT+ VL LG+L F  E +  + +LGM IA++GM+ Y  A
Sbjct  252  SAVSFQVLGHMKTVCVLILGWLLFDSE-LTFKNILGMAIAVLGMLLYSWA  300


 Score = 38.9 bits (89),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             AF+A  ST+LQQ  +  LQ+KY++GSF LL
Sbjct  160  CAFVAVLSTSLQQISIGSLQKKYAIGSFELL  190



>gb|KHG16230.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=280

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLLL GP  D +LT K + +Y ++ +A   I+LSC++A+  N+SQ++CIGR
Sbjct  124  SQTAPIQALSLLLFGPFVDYYLTGKLLASYKFSSAAFFFILLSCSLAVFCNISQYLCIGR  183

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+A SFQVLGHMKT+ VL LG+L F  E + ++ +LGM IAI+GMV Y 
Sbjct  184  FSATSFQVLGHMKTVCVLILGWLLFDSE-LTLKNILGMAIAILGMVVYS  231



>gb|KJB47139.1| hypothetical protein B456_008G012200 [Gossypium raimondii]
Length=340

 Score =   116 bits (291),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLLL+GP  D +LT K + +Y  + +A   IVLSC++A+  N+SQ++CIGR
Sbjct  191  SQTAPIQALSLLLLGPFVDYFLTGKLLASYKISSAAFFFIVLSCSLAVFCNISQYLCIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+AVSFQVLGHMKT+ VL LG++ F  E + ++ +LGM IA+ GM+ Y 
Sbjct  251  FSAVSFQVLGHMKTVCVLILGWMLFDSE-LTLKNILGMSIAVNGMIIYS  298


 Score = 37.4 bits (85),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  160  CACVAVLSTSLQQISIGSLQKKYSIGSFELL  190



>gb|KHG19793.1| UDP-galactose transporter 2 -like protein [Gossypium arboreum]
Length=340

 Score =   116 bits (290),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLLL+GP  D +LT K + +Y  + +A   IVLSC++A+  N+SQ++CIGR
Sbjct  191  SQTAPIQALSLLLLGPFVDYFLTGKLLASYKISSAAFFFIVLSCSLAVFCNISQYLCIGR  250

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+AVSFQVLGHMKT+ VL LG++ F  E + ++ +LGM IA+ GM+ Y 
Sbjct  251  FSAVSFQVLGHMKTVCVLILGWMLFDSE-LTLKNILGMSIAVNGMIIYS  298


 Score = 37.0 bits (84),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  160  CACVAVLSTSLQQISIGSLQKKYSIGSFELL  190



>ref|XP_011034738.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
Length=345

 Score =   115 bits (289),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 82/121 (68%), Gaps = 4/121 (3%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL++GP  D +L  K +  Y  +  A+  I+LSC++A+  N+SQ++CIGR
Sbjct  190  SRTAPIQAISLLILGPFIDYYLNGKFITNYKLSSGAILFIILSCSLAVFCNVSQYLCIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMV---WYGNASSKAGG  212
            F+A SFQVLGHMKTI VLTLG+L F  E +  + ++GM IA++GMV   W   A  ++  
Sbjct  250  FSATSFQVLGHMKTICVLTLGWLLFDSE-LTFKNIMGMFIAVLGMVVYSWAVEAEKRSNA  308

Query  211  K  209
            K
Sbjct  309  K  309


 Score = 37.0 bits (84),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  159  CACLAVLSTSLQQITIGSLQKKYSIGSFELL  189



>ref|XP_011074037.1| PREDICTED: UDP-galactose transporter 2 [Sesamum indicum]
Length=345

 Score =   116 bits (290),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -1

Query  559  HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF  380
             TAP+QA SLL++GPI D +L+ K +  Y +   A+  I+LSC++A+  N+SQ++CIGRF
Sbjct  191  RTAPIQAGSLLVLGPIIDYYLSGKLILDYQFGSGAILFILLSCSLAVFCNVSQYLCIGRF  250

Query  379  TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY  239
            +AVSFQVLGHMKT+ VLTLG+L F  E +  + ++GM +A+VGM+ Y
Sbjct  251  SAVSFQVLGHMKTVCVLTLGWLLFDSE-LTFKNIMGMVVAVVGMIIY  296


 Score = 36.2 bits (82),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A IA  ST+ QQ  +  LQ+KYS+GSF LL
Sbjct  159  CACIAVLSTSFQQISIGSLQKKYSIGSFELL  189



>ref|XP_008796579.1| PREDICTED: UDP-galactose transporter 2 [Phoenix dactylifera]
Length=343

 Score =   114 bits (285),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL +GP  D +L  KS+  Y+++  A+  I+LSC +A+  N+SQ++CIGR
Sbjct  189  SKTAPIQALSLLFLGPFIDYYLNGKSLIKYNFSSGAIFFILLSCVLAVFCNMSQYLCIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+A SFQVLGHMKT+ VL LG+L F  + + ++ ++GM IAIVGMV Y 
Sbjct  249  FSATSFQVLGHMKTVCVLMLGWLLFDSQ-LTLKNIMGMVIAIVGMVVYS  296


 Score = 38.1 bits (87),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A IA  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  158  CACIAVLSTSLQQISIGSLQKKYSIGSFELL  188



>ref|XP_002307836.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE94832.1| transporter-related family protein [Populus trichocarpa]
Length=345

 Score =   115 bits (288),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL++GP  D +L  K +  Y  +  A+  I+LSC++A+  N+SQ++CIGR
Sbjct  190  SRTAPIQALSLLILGPFIDYYLNGKFITHYKISSGAILFIILSCSLAVFCNVSQYLCIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+A SFQVLGHMKTI VLTLG+L F  E +  + ++GM IA+VGMV Y 
Sbjct  250  FSATSFQVLGHMKTICVLTLGWLLFDSE-LTFKNIMGMVIAVVGMVVYS  297


 Score = 37.0 bits (84),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  159  CACLAVLSTSLQQITIGSLQKKYSIGSFELL  189



>ref|XP_006429818.1| hypothetical protein CICLE_v10013865mg, partial [Citrus clementina]
 gb|ESR43058.1| hypothetical protein CICLE_v10013865mg, partial [Citrus clementina]
Length=173

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLL+ GP  D +L+ K +  Y ++ SA   I+LSC++A+  N+SQ++CIGRF+
Sbjct  20   TAPIQAVSLLVFGPFIDYYLSGKLLSNYRFSSSAFLFILLSCSLAVFCNVSQYLCIGRFS  79

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            AV+FQVLGHMKT+ +LTLG+L F  + + ++ +LGM +A++GM+ Y 
Sbjct  80   AVTFQVLGHMKTVCILTLGWLLFDSQ-LTVKNILGMTVAVLGMIVYS  125



>ref|XP_002300605.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE79878.1| transporter-related family protein [Populus trichocarpa]
Length=345

 Score =   115 bits (287),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL++GP  D +L  K +  Y  +  A+  I+LSC++A+  N+SQ++CIGR
Sbjct  190  SRTAPIQAVSLLILGPFIDYYLNGKFITNYKLSSGAILFIILSCSLAVFCNVSQYLCIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+A SFQVLGHMKTI VLTLG+L F  E +  + ++GM IA++GMV Y 
Sbjct  250  FSATSFQVLGHMKTICVLTLGWLLFDSE-LTFKNIMGMFIAVLGMVVYS  297


 Score = 37.0 bits (84),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  159  CACLAVLSTSLQQITIGSLQKKYSIGSFELL  189



>emb|CDP07234.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QAASLL++GP  D +L  K +  Y Y+  A   I+LSC++A+  N+SQ++CIGR
Sbjct  189  SKTAPIQAASLLVLGPFIDYYLCGKFILEYKYSSGAFLFILLSCSLAVFCNVSQYLCIGR  248

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+AVSFQVLGHMKT+ VLTLG+L F  E +  + ++GM IA+VGMV Y 
Sbjct  249  FSAVSFQVLGHMKTVCVLTLGWLLFDSE-LTFKNIMGMLIAVVGMVVYS  296



>ref|XP_011041092.1| PREDICTED: UDP-galactose transporter 2 [Populus euphratica]
Length=345

 Score =   114 bits (286),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = -1

Query  562  GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR  383
              TAP+QA SLL++GP  D +L  K +  Y  +  A+  I+LSC++A+  N+SQ++CIGR
Sbjct  190  SRTAPIQALSLLILGPFIDYYLNGKFITHYKISSGAILFIILSCSLAVFCNVSQYLCIGR  249

Query  382  FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            F+A SFQVLGHMKTI VLTLG+L F  E +  + ++GM IA+VGMV Y 
Sbjct  250  FSATSFQVLGHMKTICVLTLGWLLFDSE-LTFKNMMGMVIAVVGMVVYS  297


 Score = 37.0 bits (84),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             A +A  ST+LQQ  +  LQ+KYS+GSF LL
Sbjct  159  CACLAVLSTSLQQITIGSLQKKYSIGSFELL  189



>ref|XP_010428732.1| PREDICTED: UDP-galactose transporter 2 [Camelina sativa]
Length=347

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 82/128 (64%), Gaps = 10/128 (8%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLL+ GP  D +L+ K +  Y  T  A+  I+LSC +A+  N+SQ++CIGRF+
Sbjct  194  TAPIQAISLLIFGPFVDYFLSGKFISTYKMTYGAIFCILLSCALAVFCNISQYLCIGRFS  253

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG---------NASS  224
            A SFQVLGHMKT+ VLTLG+L F  E M  + + GM IAIVGMV Y          NA S
Sbjct  254  ATSFQVLGHMKTVCVLTLGWLLFDSE-MTFKNIAGMAIAIVGMVIYSWAVDVEKQRNAKS  312

Query  223  KAGGKERV  200
               GK  +
Sbjct  313  TPHGKNSM  320



>ref|XP_010416591.1| PREDICTED: UDP-galactose transporter 2-like [Camelina sativa]
Length=347

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 82/128 (64%), Gaps = 10/128 (8%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLL+ GP  D +L+ K +  Y  T  A+  I+LSC +A+  N+SQ++CIGRF+
Sbjct  194  TAPIQAISLLIFGPFVDYFLSGKFISTYKMTYGAIFCILLSCALAVFCNISQYLCIGRFS  253

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG---------NASS  224
            A SFQVLGHMKT+ VLTLG+L F  E M  + + GM IAIVGMV Y          NA S
Sbjct  254  ATSFQVLGHMKTVCVLTLGWLLFDSE-MTFKNIAGMAIAIVGMVIYSWAVDVEKQRNAKS  312

Query  223  KAGGKERV  200
               GK  +
Sbjct  313  TPHGKNSM  320



>ref|NP_565138.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 sp|Q9SRE4.1|UGAL2_ARATH RecName: Full=UDP-galactose transporter 2; Short=At-UDP-GalT2 
[Arabidopsis thaliana]
 gb|AAF04433.1|AC010718_2 unknown protein; 11341-9662 [Arabidopsis thaliana]
 gb|AAK64150.1| unknown protein [Arabidopsis thaliana]
 gb|AAL24196.1| At1g76670/F28O16_4 [Arabidopsis thaliana]
 gb|AAL69500.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18125.1| At1g76670/F28O16_4 [Arabidopsis thaliana]
 emb|CAG18177.1| UDP-galactose transporter [Arabidopsis thaliana]
 gb|AEE35873.1| Nucleotide-sugar transporter family protein [Arabidopsis thaliana]
 gb|AIJ01996.1| bi-functional UDP-rhamnose/UDP-galactose transporter, partial 
[Arabidopsis thaliana]
Length=347

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 81/128 (63%), Gaps = 10/128 (8%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLL+ GP  D  L+ K +  Y  T  A+  I+LSC +A+  N+SQ++CIGRF+
Sbjct  194  TAPIQAISLLICGPFVDYLLSGKFISTYQMTYGAIFCILLSCALAVFCNISQYLCIGRFS  253

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG---------NASS  224
            A SFQVLGHMKT+ VLTLG+L F  E M  + + GM IAIVGMV Y          NA S
Sbjct  254  ATSFQVLGHMKTVCVLTLGWLLFDSE-MTFKNIAGMAIAIVGMVIYSWAVDIEKQRNAKS  312

Query  223  KAGGKERV  200
               GK  +
Sbjct  313  TPHGKHSM  320



>ref|XP_008346270.1| PREDICTED: UDP-galactose transporter 2-like [Malus domestica]
Length=339

 Score =   112 bits (279),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLL++GP  D +LT K +  Y  +  A   I+LSC++A+  N+SQ++CIGRF+
Sbjct  191  TAPIQALSLLILGPFVDYFLTGKLLTDYKLSTGAFFFILLSCSLAVFCNISQYLCIGRFS  250

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA  230
            AVSFQVLGHMKT+ VLTLG+L F  + +  + +LGM +A++GM+ Y  A
Sbjct  251  AVSFQVLGHMKTVCVLTLGWLLFDSQ-LTFKNLLGMALAVLGMIVYSWA  298


 Score = 38.5 bits (88),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  656  AAFIAXXSTALQQYYVHXLQRKYSLGSFNLL  564
             AF+A   T+LQQ  +  LQ+KYS+GSF LL
Sbjct  158  CAFVAILCTSLQQISIGSLQKKYSIGSFELL  188



>ref|XP_009396888.1| PREDICTED: UDP-galactose transporter 2-like [Musa acuminata subsp. 
malaccensis]
Length=341

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = -1

Query  556  TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT  377
            TAP+QA SLLL GP  D +L   S+  YHY++ A S I+LSC +A+  N SQ++CIGRF+
Sbjct  192  TAPIQAISLLLFGPFADYYLNGHSLLTYHYSMGATSFILLSCILAVFCNTSQYLCIGRFS  251

Query  376  AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG  236
            A SFQVLGHMKT+ VL LG+L F    + ++ +LGM +A+VGMV Y 
Sbjct  252  ATSFQVLGHMKTVCVLVLGWLLF-DSALTLKNILGMLLAVVGMVVYS  297



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500