BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047L17

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011098408.1|  PREDICTED: proteasome subunit alpha type-6         370   4e-126   Sesamum indicum [beniseed]
gb|EYU19318.1|  hypothetical protein MIMGU_mgv1a012555mg                370   7e-126   Erythranthe guttata [common monkey flower]
ref|XP_011099933.1|  PREDICTED: proteasome subunit alpha type-6-like    369   2e-125   Sesamum indicum [beniseed]
ref|XP_009631638.1|  PREDICTED: proteasome subunit alpha type-6         369   2e-125   Nicotiana tomentosiformis
ref|XP_009797939.1|  PREDICTED: proteasome subunit alpha type-6         368   3e-125   Nicotiana sylvestris
ref|XP_009380029.1|  PREDICTED: proteasome subunit alpha type-6         367   5e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004251692.1|  PREDICTED: proteasome subunit alpha type-6         365   7e-124   Solanum lycopersicum
ref|XP_009404175.1|  PREDICTED: proteasome subunit alpha type-6-like    364   9e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010274570.1|  PREDICTED: proteasome subunit alpha type-6         364   1e-123   Nelumbo nucifera [Indian lotus]
emb|CDP03072.1|  unnamed protein product                                364   1e-123   Coffea canephora [robusta coffee]
gb|EPS63192.1|  proteasome subunit alpha type-6                         363   2e-123   Genlisea aurea
gb|ACJ11727.1|  20S proteasome subunit alpha-1                          363   3e-123   Gossypium hirsutum [American cotton]
gb|KJB65226.1|  hypothetical protein B456_010G089600                    363   4e-123   Gossypium raimondii
ref|XP_010269878.1|  PREDICTED: proteasome subunit alpha type-6-like    363   4e-123   Nelumbo nucifera [Indian lotus]
gb|KHG01950.1|  Proteasome subunit alpha type-6                         362   6e-123   Gossypium arboreum [tree cotton]
ref|XP_002271929.1|  PREDICTED: proteasome subunit alpha type-6         362   1e-122   Vitis vinifera
gb|KJB82986.1|  hypothetical protein B456_013G223200                    360   3e-122   Gossypium raimondii
gb|KJB82988.1|  hypothetical protein B456_013G223200                    360   3e-122   Gossypium raimondii
ref|XP_007012615.1|  20S proteasome subunit PAA2 isoform 1              360   3e-122   Theobroma cacao [chocolate]
ref|XP_002516258.1|  proteasome subunit alpha type, putative            360   4e-122   Ricinus communis
ref|XP_006842706.1|  hypothetical protein AMTR_s00147p00090390          360   5e-122   Amborella trichopoda
ref|XP_010937324.1|  PREDICTED: proteasome subunit alpha type-6         360   6e-122   Elaeis guineensis
ref|XP_010111992.1|  Proteasome subunit alpha type-6                    362   7e-122   
ref|XP_008802476.1|  PREDICTED: proteasome subunit alpha type-6-like    359   8e-122   Phoenix dactylifera
ref|XP_002323091.1|  Proteasome subunit alpha type 6-1 family pro...    359   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_002532723.1|  proteasome subunit alpha type, putative            359   1e-121   Ricinus communis
gb|KDP33929.1|  hypothetical protein JCGZ_07500                         358   1e-121   Jatropha curcas
ref|XP_006381605.1|  hypothetical protein POPTR_0006s14260g             358   2e-121   Populus trichocarpa [western balsam poplar]
ref|XP_008782714.1|  PREDICTED: proteasome subunit alpha type-6         358   3e-121   Phoenix dactylifera
gb|KJB65225.1|  hypothetical protein B456_010G089600                    358   3e-121   Gossypium raimondii
ref|XP_011001657.1|  PREDICTED: proteasome subunit alpha type-6-like    357   5e-121   Populus euphratica
ref|XP_008462289.1|  PREDICTED: proteasome subunit alpha type-6         357   8e-121   Cucumis melo [Oriental melon]
gb|KDP45827.1|  hypothetical protein JCGZ_17434                         357   1e-120   Jatropha curcas
ref|XP_006592586.1|  PREDICTED: proteasome subunit alpha type-6-like    356   1e-120   Glycine max [soybeans]
gb|KJB82987.1|  hypothetical protein B456_013G223200                    356   2e-120   Gossypium raimondii
ref|XP_008228175.1|  PREDICTED: proteasome subunit alpha type-6         356   2e-120   Prunus mume [ume]
ref|XP_004488480.1|  PREDICTED: proteasome subunit alpha type-6-l...    356   2e-120   Cicer arietinum [garbanzo]
ref|XP_007215872.1|  hypothetical protein PRUPE_ppa010523mg             356   2e-120   Prunus persica
ref|XP_004141710.1|  PREDICTED: proteasome subunit alpha type-6-like    355   5e-120   Cucumis sativus [cucumbers]
ref|XP_006474717.1|  PREDICTED: proteasome subunit alpha type-6-l...    355   5e-120   
ref|NP_001238251.1|  proteasome subunit alpha type-6                    355   6e-120   
ref|XP_010939895.1|  PREDICTED: proteasome subunit alpha type-6-like    354   7e-120   Elaeis guineensis
ref|XP_010064020.1|  PREDICTED: proteasome subunit alpha type-6         354   8e-120   Eucalyptus grandis [rose gum]
ref|XP_006474716.1|  PREDICTED: proteasome subunit alpha type-6-l...    354   8e-120   Citrus sinensis [apfelsine]
gb|ABK95322.1|  unknown                                                 354   9e-120   Populus trichocarpa [western balsam poplar]
gb|ABK96399.1|  unknown                                                 353   2e-119   Populus trichocarpa x Populus deltoides
ref|XP_007133143.1|  hypothetical protein PHAVU_011G155200g             353   2e-119   Phaseolus vulgaris [French bean]
ref|XP_002308263.1|  Proteasome subunit alpha type 6-1 family pro...    353   3e-119   Populus trichocarpa [western balsam poplar]
gb|ACJ85916.1|  unknown                                                 353   3e-119   Medicago truncatula
ref|XP_008391412.1|  PREDICTED: proteasome subunit alpha type-6         352   5e-119   Malus domestica [apple tree]
ref|XP_009344472.1|  PREDICTED: proteasome subunit alpha type-6         352   6e-119   Pyrus x bretschneideri [bai li]
gb|AFK47610.1|  unknown                                                 352   6e-119   Lotus japonicus
ref|XP_011018964.1|  PREDICTED: proteasome subunit alpha type-6-like    352   9e-119   Populus euphratica
gb|ADJ95344.1|  PAA1                                                    352   1e-118   Carica papaya [mamon]
gb|KDO64982.1|  hypothetical protein CISIN_1g025897mg                   351   1e-118   Citrus sinensis [apfelsine]
gb|KDO64983.1|  hypothetical protein CISIN_1g025897mg                   349   1e-118   Citrus sinensis [apfelsine]
gb|ACU24622.1|  unknown                                                 350   2e-118   Glycine max [soybeans]
gb|AFK46380.1|  unknown                                                 350   4e-118   Lotus japonicus
ref|XP_003595788.1|  Proteasome subunit alpha type                      350   4e-118   Medicago truncatula
gb|ACN66752.1|  PAA1                                                    349   7e-118   Carica papaya [mamon]
gb|KDO64977.1|  hypothetical protein CISIN_1g025897mg                   349   7e-118   Citrus sinensis [apfelsine]
ref|XP_006465892.1|  PREDICTED: proteasome subunit alpha type-6-like    349   9e-118   Citrus sinensis [apfelsine]
ref|XP_010557672.1|  PREDICTED: proteasome subunit alpha type-6-B...    349   1e-117   Tarenaya hassleriana [spider flower]
ref|XP_004303706.1|  PREDICTED: proteasome subunit alpha type-6         348   2e-117   Fragaria vesca subsp. vesca
gb|AFK46801.1|  unknown                                                 348   3e-117   Medicago truncatula
ref|XP_010541996.1|  PREDICTED: proteasome subunit alpha type-6-B       347   4e-117   Tarenaya hassleriana [spider flower]
ref|XP_010666851.1|  PREDICTED: proteasome subunit alpha type-6         347   8e-117   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ85912.1|  unknown                                                 346   1e-116   Medicago truncatula
ref|XP_010533014.1|  PREDICTED: proteasome subunit alpha type-6-B...    345   4e-116   Tarenaya hassleriana [spider flower]
ref|XP_010435443.1|  PREDICTED: proteasome subunit alpha type-6-A...    344   8e-116   Camelina sativa [gold-of-pleasure]
ref|NP_178641.1|  20S proteasome subunit PAA2                           344   8e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450390.1|  PREDICTED: proteasome subunit alpha type-6-A       344   9e-116   Camelina sativa [gold-of-pleasure]
gb|KFK32243.1|  hypothetical protein AALP_AA6G216400                    343   2e-115   Arabis alpina [alpine rockcress]
ref|XP_006282775.1|  hypothetical protein CARUB_v10006215mg             342   5e-115   Capsella rubella
ref|XP_010494382.1|  PREDICTED: proteasome subunit alpha type-6-B       342   9e-115   Camelina sativa [gold-of-pleasure]
ref|NP_198409.1|  proteasome alpha subunit A1                           340   2e-114   Arabidopsis thaliana [mouse-ear cress]
emb|CAA74025.1|  multicatalytic endopeptidase complex, proteasome...    340   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649499.1|  PREDICTED: proteasome subunit alpha type-6-like    340   3e-114   Oryza brachyantha
gb|AAM12968.1|  multicatalytic endopeptidase complex alpha subuni...    340   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130062.1|  uncharacterized protein LOC100191154               340   5e-114   Zea mays [maize]
ref|XP_002870436.1|  hypothetical protein ARALYDRAFT_493620             339   6e-114   
ref|XP_004985490.1|  PREDICTED: proteasome subunit alpha type-6-like    339   9e-114   Setaria italica
ref|XP_010441957.1|  PREDICTED: proteasome subunit alpha type-6-B...    339   1e-113   Camelina sativa [gold-of-pleasure]
gb|ACN33969.1|  unknown                                                 339   1e-113   Zea mays [maize]
ref|XP_002465753.1|  hypothetical protein SORBIDRAFT_01g045210          338   1e-113   Sorghum bicolor [broomcorn]
ref|NP_001049162.1|  Os03g0180400                                       338   2e-113   
ref|XP_006396131.1|  hypothetical protein EUTSA_v10002649mg             338   3e-113   Eutrema salsugineum [saltwater cress]
ref|XP_009102355.1|  PREDICTED: proteasome subunit alpha type-6-B       337   3e-113   Brassica rapa
ref|NP_001105138.1|  maize 20S proteasome alpha subunit                 337   4e-113   Zea mays [maize]
gb|AAC32054.1|  20S proteasome subunit PAA1                             337   4e-113   Arabidopsis thaliana [mouse-ear cress]
gb|ABF94306.1|  Proteasome subunit alpha type 6, putative, expressed    338   4e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009136197.1|  PREDICTED: proteasome subunit alpha type-6-B...    337   6e-113   Brassica rapa
gb|AGO97077.1|  20S proteasome alpha                                    333   2e-111   Saccharum hybrid cultivar GT28
ref|XP_003558667.1|  PREDICTED: proteasome subunit alpha type-6         331   1e-110   Brachypodium distachyon [annual false brome]
gb|ABK22399.1|  unknown                                                 328   2e-109   Picea sitchensis
gb|EMT09268.1|  Proteasome subunit alpha type-6                         328   3e-109   
emb|CDY50408.1|  BnaC03g45100D                                          327   4e-109   Brassica napus [oilseed rape]
dbj|BAJ85935.1|  predicted protein                                      327   7e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX93103.1|  BnaA03g38250D                                          325   7e-108   
ref|XP_006452821.1|  hypothetical protein CICLE_v10010323mg             323   1e-107   
ref|XP_001777426.1|  predicted protein                                  313   9e-104   
gb|KHG04433.1|  Proteasome subunit alpha type-6                         312   1e-103   Gossypium arboreum [tree cotton]
ref|XP_002989745.1|  hypothetical protein SELMODRAFT_272088             311   8e-103   Selaginella moellendorffii
gb|KDO64985.1|  hypothetical protein CISIN_1g025897mg                   306   3e-102   Citrus sinensis [apfelsine]
ref|XP_001768229.1|  predicted protein                                  310   3e-102   
ref|XP_001782615.1|  predicted protein                                  306   6e-101   
ref|XP_006426693.1|  hypothetical protein CICLE_v100263522mg            301   2e-100   
ref|NP_001031340.1|  20S proteasome subunit PAA2                        298   3e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KHN46954.1|  Proteasome subunit alpha type-6                         309   9e-98    Glycine soja [wild soybean]
ref|XP_001751730.1|  predicted protein                                  286   4e-93    
ref|XP_001691723.1|  20S proteasome alpha subunit A                     270   1e-86    Chlamydomonas reinhardtii
ref|XP_002949740.1|  20S proteasome alpha subunit A                     270   2e-86    Volvox carteri f. nagariensis
gb|AFW89473.1|  hypothetical protein ZEAMMB73_334376                    266   1e-85    
ref|NP_001150310.1|  proteasome subunit alpha type 6                    267   7e-85    Zea mays [maize]
ref|XP_005648429.1|  proteasome subunit alpha type-6                    263   5e-84    Coccomyxa subellipsoidea C-169
gb|KDD75255.1|  proteasome subunit protein                              248   3e-78    Helicosporidium sp. ATCC 50920
ref|XP_005843942.1|  hypothetical protein CHLNCDRAFT_27583              245   5e-77    Chlorella variabilis
gb|ABR17363.1|  unknown                                                 241   6e-77    Picea sitchensis
ref|NP_989113.1|  proteasome subunit alpha type-6                       244   2e-76    Xenopus tropicalis [western clawed frog]
gb|ESA18832.1|  hypothetical protein GLOINDRAFT_344383                  243   4e-76    
ref|XP_004773397.1|  PREDICTED: proteasome subunit alpha type-6 i...    241   8e-76    Mustela putorius furo [black ferret]
emb|CAA43964.1|  macropain subunit iota                                 241   1e-75    Homo sapiens [man]
ref|XP_006835407.1|  PREDICTED: proteasome subunit alpha type-6 i...    241   1e-75    Chrysochloris asiatica
ref|XP_006240160.1|  PREDICTED: proteasome subunit alpha type-6 i...    241   2e-75    Rattus norvegicus [brown rat]
ref|XP_004681994.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   2e-75    
ref|XP_006515947.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   2e-75    
gb|KFZ47806.1|  Proteasome subunit alpha type-6                         240   2e-75    Antrostomus carolinensis
ref|NP_001088418.1|  uncharacterized protein LOC495277                  241   2e-75    Xenopus laevis [clawed frog]
ref|XP_007119013.1|  PREDICTED: proteasome subunit alpha type-6 i...    241   2e-75    
ref|XP_010631916.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   2e-75    Fukomys damarensis [Damara mole rat]
ref|XP_005376981.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   2e-75    Chinchilla lanigera
ref|NP_001269163.1|  proteasome subunit alpha type-6 isoform c          240   2e-75    Homo sapiens [man]
ref|XP_004436463.1|  PREDICTED: proteasome subunit alpha type-6 i...    241   2e-75    
ref|XP_004270017.1|  PREDICTED: proteasome subunit alpha type-6 i...    241   2e-75    
ref|XP_005656350.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   2e-75    
ref|XP_007464885.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   3e-75    Lipotes vexillifer [baiji]
ref|XP_004055136.1|  PREDICTED: proteasome subunit alpha type-6-like    240   3e-75    
ref|XP_537412.2|  PREDICTED: proteasome subunit alpha type-6 isof...    241   3e-75    Canis lupus familiaris [dogs]
ref|XP_003059392.1|  predicted protein                                  241   4e-75    Micromonas pusilla CCMP1545
gb|KFO90954.1|  Proteasome subunit alpha type-6                         239   4e-75    Buceros rhinoceros silvestris
ref|XP_004436462.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   5e-75    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_002824717.1|  PREDICTED: proteasome subunit alpha type-6 i...    240   7e-75    
ref|XP_005842332.1|  20S proteasome subunit alpha type 6                240   7e-75    Guillardia theta CCMP2712
gb|EDL36728.1|  proteasome (prosome, macropain) subunit, alpha ty...    240   7e-75    Mus musculus [mouse]
gb|KFO63713.1|  Proteasome subunit alpha type-6                         239   8e-75    Corvus brachyrhynchos
ref|XP_004698589.1|  PREDICTED: proteasome subunit alpha type-6         239   8e-75    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_001095366.1|  PREDICTED: proteasome subunit alpha type-6-l...    239   9e-75    
ref|NP_058979.1|  proteasome subunit alpha type-6                       239   9e-75    Rattus norvegicus [brown rat]
ref|NP_036098.1|  proteasome subunit alpha type-6                       239   1e-74    Mus musculus [mouse]
ref|XP_004649175.1|  PREDICTED: proteasome subunit alpha type-6         239   1e-74    Jaculus jaculus
ref|XP_005014711.1|  PREDICTED: proteasome subunit alpha type-6         238   1e-74    
ref|XP_004470220.1|  PREDICTED: proteasome subunit alpha type-6         239   1e-74    Dasypus novemcinctus
gb|KFP89006.1|  Proteasome subunit alpha type-6                         238   1e-74    Apaloderma vittatum
ref|XP_008267725.1|  PREDICTED: proteasome subunit alpha type-6 i...    239   1e-74    
gb|KFR01991.1|  Proteasome subunit alpha type-6                         238   1e-74    Opisthocomus hoazin [hoatzin]
ref|XP_007180773.1|  PREDICTED: proteasome subunit alpha type-6         239   1e-74    Balaenoptera acutorostrata scammoni
ref|XP_005047359.1|  PREDICTED: proteasome subunit alpha type-6         238   2e-74    
ref|XP_005158685.1|  PREDICTED: proteasome subunit alpha type-6 i...    239   2e-74    
ref|XP_005865030.1|  PREDICTED: proteasome subunit alpha type-6         239   2e-74    Myotis brandtii
gb|KFV43324.1|  Proteasome subunit alpha type-6                         238   2e-74    Tyto alba [Schleiereule]
ref|NP_001132918.1|  proteasome subunit alpha type-6                    239   2e-74    Ovis aries [domestic sheep]
ref|XP_006172412.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    238   2e-74    Tupaia chinensis
ref|XP_003924255.1|  PREDICTED: proteasome subunit alpha type-6         240   2e-74    Saimiri boliviensis boliviensis
gb|EMC83847.1|  Proteasome subunit alpha type-6                         238   2e-74    
ref|XP_009288678.1|  PREDICTED: proteasome subunit alpha type-6         238   2e-74    
gb|ABM86477.1|  proteasome (prosome, macropain) subunit, alpha ty...    238   3e-74    synthetic construct
gb|KFQ31740.1|  Proteasome subunit alpha type-6                         238   3e-74    Merops nubicus
ref|NP_001264372.1|  proteasome subunit alpha type-6                    238   3e-74    Gallus gallus [bantam]
ref|XP_002500811.1|  predicted protein                                  239   3e-74    Micromonas commoda
gb|KFQ96181.1|  Proteasome subunit alpha type-6                         238   4e-74    Nipponia nippon
ref|XP_006985315.1|  PREDICTED: proteasome subunit alpha type-6         238   4e-74    Peromyscus maniculatus bairdii
ref|XP_005965384.1|  PREDICTED: proteasome subunit alpha type-6-l...    239   4e-74    Pantholops hodgsonii [Tibetan antelope]
ref|NP_001232198.1|  putative proteasome subunit alpha type 6           238   5e-74    Taeniopygia guttata
ref|NP_001086785.1|  proteasome alpha 6 subunit                         238   5e-74    Xenopus laevis [clawed frog]
ref|XP_006258805.1|  PREDICTED: proteasome subunit alpha type-6         238   5e-74    Alligator mississippiensis
ref|XP_003471921.1|  PREDICTED: proteasome subunit alpha type-6         237   6e-74    Cavia porcellus [guinea pig]
ref|XP_005243955.1|  PREDICTED: proteasome subunit alpha type-6         238   6e-74    
ref|XP_005149366.1|  PREDICTED: proteasome subunit alpha type-6         237   6e-74    
pdb|4R3O|A  Chain A, Human Constitutive 20s Proteasome                  237   7e-74    Homo sapiens [man]
ref|XP_007530301.1|  PREDICTED: proteasome subunit alpha type-6         237   7e-74    Erinaceus europaeus [common hedgehog]
ref|XP_010153543.1|  PREDICTED: proteasome subunit alpha type-6 i...    237   8e-74    Eurypyga helias
ref|XP_009901279.1|  PREDICTED: proteasome subunit alpha type-6 i...    237   8e-74    Picoides pubescens
ref|XP_001418143.1|  predicted protein                                  237   9e-74    Ostreococcus lucimarinus CCE9901
ref|XP_001363110.1|  PREDICTED: proteasome subunit alpha type-6         237   1e-73    Monodelphis domestica
ref|XP_009317738.1|  PREDICTED: proteasome subunit alpha type-6         237   1e-73    Pygoscelis adeliae
gb|KFZ52790.1|  Proteasome subunit alpha type-6                         236   1e-73    Podiceps cristatus
gb|KFP76959.1|  Proteasome subunit alpha type-6                         236   1e-73    Acanthisitta chloris
ref|NP_001132944.1|  proteasome subunit alpha type-6                    236   1e-73    Sus scrofa [pigs]
ref|XP_010876681.1|  PREDICTED: proteasome subunit alpha type-6         236   1e-73    Esox lucius
dbj|BAE36518.1|  unnamed protein product                                236   2e-73    Mus musculus [mouse]
ref|XP_006632201.1|  PREDICTED: proteasome subunit alpha type-6-like    236   2e-73    Lepisosteus oculatus
ref|XP_007436765.1|  PREDICTED: proteasome subunit alpha type-6         236   2e-73    Python bivittatus
ref|XP_005285405.1|  PREDICTED: proteasome subunit alpha type-6 i...    236   2e-73    Chrysemys picta bellii
ref|XP_003445487.1|  PREDICTED: proteasome subunit alpha type-6-like    236   2e-73    Oreochromis niloticus
gb|ERE72543.1|  proteasome subunit alpha type-6-like protein            236   2e-73    Cricetulus griseus [Chinese hamsters]
ref|XP_004653726.1|  PREDICTED: proteasome subunit alpha type-6-like    236   3e-73    
emb|CAG00121.1|  unnamed protein product                                236   3e-73    Tetraodon nigroviridis
ref|XP_003971508.1|  PREDICTED: proteasome subunit alpha type-6-like    236   3e-73    Takifugu rubripes [tiger puffer]
gb|ACO51961.1|  Proteasome subunit alpha type-6                         235   3e-73    Rana catesbeiana [bullfrog]
ref|NP_001002589.1|  proteasome subunit alpha type-6                    235   3e-73    Danio rerio [leopard danio]
ref|XP_003440740.1|  PREDICTED: proteasome subunit alpha type-6-like    235   3e-73    Oreochromis niloticus
emb|CEF98211.1|  Proteasome A-type subunit                              235   4e-73    Ostreococcus tauri
ref|XP_007253022.1|  PREDICTED: proteasome subunit alpha type-6-l...    235   4e-73    Astyanax mexicanus [blind cave fish]
ref|XP_004542308.1|  PREDICTED: proteasome subunit alpha type-6-like    235   5e-73    Maylandia zebra
ref|XP_005356606.1|  PREDICTED: proteasome subunit alpha type-6-like    235   5e-73    
ref|XP_010744453.1|  PREDICTED: proteasome subunit alpha type-6         235   6e-73    
ref|XP_001511492.1|  PREDICTED: proteasome subunit alpha type-6 i...    234   7e-73    Ornithorhynchus anatinus [duck-billed platypus]
emb|CDQ90937.1|  unnamed protein product                                234   8e-73    Oncorhynchus mykiss
gb|ACH70968.1|  proteasome (prosome, macropain) subunit, alpha ty...    234   8e-73    Salmo salar
ref|XP_003216618.1|  PREDICTED: proteasome subunit alpha type-6         234   9e-73    Anolis carolinensis [Carolina anole]
gb|ACI66289.1|  Proteasome subunit alpha type-6                         234   1e-72    Salmo salar
ref|XP_008300217.1|  PREDICTED: proteasome subunit alpha type-6         234   1e-72    Stegastes partitus
gb|EIE83838.1|  hypothetical protein RO3G_08543                         234   1e-72    Rhizopus delemar RA 99-880
ref|XP_004559366.1|  PREDICTED: proteasome subunit alpha type-6-like    234   1e-72    Maylandia zebra
gb|ETE73021.1|  Proteasome subunit alpha type-6                         235   1e-72    Ophiophagus hannah
emb|CDQ78135.1|  unnamed protein product                                233   2e-72    Oncorhynchus mykiss
gb|ACH70967.1|  proteasome (prosome, macropain) subunit, alpha ty...    233   2e-72    Salmo salar
ref|NP_001279159.1|  proteasome (prosome, macropain) subunit, alp...    233   3e-72    Callorhinchus milii [Australian ghost shark]
gb|ACO08806.1|  Proteasome subunit alpha type 6                         233   3e-72    Oncorhynchus mykiss
gb|EPB88050.1|  proteasome subunit alpha type-6                         233   3e-72    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_006015430.1|  PREDICTED: proteasome subunit alpha type-6         237   3e-72    
gb|EXX71316.1|  proteasome core particle subunit alpha 1                231   3e-72    Rhizophagus irregularis DAOM 197198w
dbj|GAN03133.1|  proteasome subunit alpha type-6                        233   4e-72    Mucor ambiguus
ref|XP_004333676.1|  proteasome subunit alpha type6, putative           232   5e-72    Acanthamoeba castellanii str. Neff
ref|XP_005562133.1|  PREDICTED: proteasome subunit alpha type-6-like    232   5e-72    
ref|XP_005810950.1|  PREDICTED: proteasome subunit alpha type-6-like    232   6e-72    Xiphophorus maculatus
ref|XP_008396439.1|  PREDICTED: proteasome subunit alpha type-6         232   7e-72    Poecilia reticulata
ref|XP_008282309.1|  PREDICTED: proteasome subunit alpha type-6         232   7e-72    Stegastes partitus
gb|ACO08382.1|  Proteasome subunit alpha type 6                         232   8e-72    Oncorhynchus mykiss
ref|XP_006117859.1|  PREDICTED: proteasome subunit alpha type-6         231   8e-72    
ref|XP_007569003.1|  PREDICTED: proteasome subunit alpha type-6         232   1e-71    Poecilia formosa
ref|XP_003388491.1|  PREDICTED: proteasome subunit alpha type-6-like    232   1e-71    Amphimedon queenslandica
ref|XP_004083706.1|  PREDICTED: proteasome subunit alpha type-6         232   1e-71    Oryzias latipes [Japanese rice fish]
gb|KIY96698.1|  20S proteasome subunit alpha 1                          233   1e-71    Monoraphidium neglectum
emb|CDS07623.1|  Putative Proteasome subunit alpha type                 231   1e-71    Lichtheimia ramosa
gb|ACI69778.1|  Proteasome subunit alpha type-6                         231   1e-71    Salmo salar
emb|CDH55408.1|  proteasome subunit alpha type-6                        231   1e-71    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006065991.1|  PREDICTED: proteasome subunit alpha type-6-like    231   1e-71    
ref|XP_005989234.1|  PREDICTED: proteasome subunit alpha type-6         231   1e-71    Latimeria chalumnae
emb|CEG74212.1|  Putative Proteasome subunit alpha type                 231   1e-71    Rhizopus microsporus
ref|XP_010876973.1|  PREDICTED: proteasome subunit alpha type-6         231   2e-71    Esox lucius
gb|ACQ58552.1|  Proteasome subunit alpha type-6                         231   2e-71    Anoplopoma fimbria
gb|ACM08640.1|  Proteasome subunit alpha type-6                         231   3e-71    Salmo salar
emb|CDH55409.1|  proteasome subunit alpha type-6                        230   4e-71    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004349345.1|  proteasome subunit iota                            230   5e-71    Capsaspora owczarzaki ATCC 30864
gb|AFK10987.1|  proteasome subunit alpha type-6-like protein            230   5e-71    Callorhinchus milii [Australian ghost shark]
emb|CEP12966.1|  hypothetical protein                                   230   5e-71    Parasitella parasitica
ref|XP_004637142.1|  PREDICTED: proteasome subunit alpha type-6         229   1e-70    Octodon degus
ref|XP_011151114.1|  PREDICTED: proteasome subunit alpha type-6-like    229   1e-70    Harpegnathos saltator
ref|XP_001640650.1|  predicted protein                                  229   1e-70    Nematostella vectensis
ref|XP_005798367.1|  PREDICTED: proteasome subunit alpha type-6-like    229   1e-70    Xiphophorus maculatus
ref|XP_010741287.1|  PREDICTED: proteasome subunit alpha type-6         228   2e-70    
ref|XP_011314423.1|  PREDICTED: proteasome subunit alpha type-6-like    228   2e-70    Fopius arisanus
ref|XP_008311014.1|  PREDICTED: proteasome subunit alpha type-6         228   2e-70    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011054784.1|  PREDICTED: proteasome subunit alpha type-6-like    228   4e-70    Acromyrmex echinatior
ref|XP_007513369.1|  predicted protein                                  228   4e-70    Bathycoccus prasinos
ref|XP_008543695.1|  PREDICTED: proteasome subunit alpha type-6-like    228   4e-70    Microplitis demolitor
ref|XP_007576015.1|  PREDICTED: proteasome subunit alpha type-6         227   5e-70    Poecilia formosa
ref|XP_002610620.1|  hypothetical protein BRAFLDRAFT_260512             227   6e-70    Branchiostoma floridae
ref|XP_008398058.1|  PREDICTED: proteasome subunit alpha type-6         227   6e-70    Poecilia reticulata
ref|XP_011329096.1|  PREDICTED: proteasome subunit alpha type-6-like    226   1e-69    Ooceraea biroi
ref|XP_010777538.1|  PREDICTED: proteasome subunit alpha type-6         226   2e-69    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011167410.1|  PREDICTED: proteasome subunit alpha type-6-like    226   2e-69    Solenopsis invicta [imported red fire ant]
emb|CCA15401.1|  proteasome subunit alpha type6 putative                226   2e-69    Albugo laibachii Nc14
gb|ETI45522.1|  hypothetical protein F443_09944                         225   2e-69    Phytophthora parasitica P1569
ref|XP_006658809.1|  PREDICTED: proteasome subunit alpha type-6-like    226   2e-69    Oryza brachyantha
emb|CCI48184.1|  unnamed protein product                                225   4e-69    Albugo candida
ref|XP_009526410.1|  hypothetical protein PHYSODRAFT_285915             225   4e-69    Phytophthora sojae
ref|XP_002902293.1|  proteasome subunit alpha type-6, putative          224   5e-69    Phytophthora infestans T30-4
ref|XP_008608969.1|  proteasome subunit alpha type-6                    224   6e-69    Saprolegnia diclina VS20
gb|EFZ13292.1|  hypothetical protein SINV_14495                         225   8e-69    
ref|XP_005717620.1|  20S core proteasome subunit alpha 1                224   9e-69    Chondrus crispus [carageen]
ref|XP_003706429.1|  PREDICTED: proteasome subunit alpha type-6-like    224   1e-68    Megachile rotundata
gb|AFK44903.1|  unknown                                                 221   1e-68    Medicago truncatula
ref|XP_011259025.1|  PREDICTED: proteasome subunit alpha type-6-like    224   1e-68    Camponotus floridanus
ref|XP_010768970.1|  PREDICTED: proteasome subunit alpha type-6-like    221   1e-68    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011494157.1|  PREDICTED: proteasome subunit alpha type-6-like    223   2e-68    Ceratosolen solmsi marchali
ref|XP_001263333.1|  proteasome subunit alpha type                      223   2e-68    Aspergillus fischeri NRRL 181
gb|EDP52622.1|  proteasome component Prs2, putative                     223   2e-68    Aspergillus fumigatus A1163
ref|XP_754489.1|  proteasome component Prs2                             223   2e-68    
ref|XP_001607854.1|  PREDICTED: proteasome subunit alpha type-6-like    223   3e-68    
ref|XP_003393493.1|  PREDICTED: proteasome subunit alpha type-6-like    222   4e-68    
ref|XP_006835408.1|  PREDICTED: proteasome subunit alpha type-6 i...    219   6e-68    
gb|ELU01128.1|  hypothetical protein CAPTEDRAFT_167909                  222   8e-68    
ref|XP_003697298.1|  PREDICTED: proteasome subunit alpha type-6-like    221   1e-67    
gb|EIE87129.1|  hypothetical protein RO3G_11840                         221   2e-67    
ref|XP_006732282.1|  PREDICTED: proteasome subunit alpha type-6 i...    218   2e-67    
ref|XP_010169981.1|  PREDICTED: proteasome subunit alpha type-6         218   2e-67    
ref|XP_006608469.1|  PREDICTED: proteasome subunit alpha type-6-like    220   3e-67    
ref|XP_011396415.1|  Proteasome subunit alpha type-6                    219   3e-67    
ref|XP_010136410.1|  PREDICTED: proteasome subunit alpha type-6 i...    217   3e-67    
ref|XP_008157204.1|  PREDICTED: proteasome subunit alpha type-6 i...    217   3e-67    
ref|XP_008881328.1|  hypothetical protein H310_15130                    220   3e-67    
ref|NP_001269161.1|  proteasome subunit alpha type-6 isoform b          217   4e-67    
ref|XP_004997606.1|  proteasome subunit alpha type-6                    219   6e-67    
ref|XP_009209664.1|  PREDICTED: proteasome subunit alpha type-6 i...    218   6e-67    
ref|XP_009019631.1|  hypothetical protein HELRODRAFT_106545             219   9e-67    
ref|XP_009942435.1|  PREDICTED: proteasome subunit alpha type-6         216   9e-67    
ref|XP_006678757.1|  hypothetical protein BATDEDRAFT_88011              219   1e-66    
ref|XP_009973400.1|  PREDICTED: proteasome subunit alpha type-6         216   1e-66    
ref|XP_008342576.1|  PREDICTED: proteasome subunit alpha type-6-like    214   1e-66    
ref|XP_005444182.1|  PREDICTED: proteasome subunit alpha type-6         216   1e-66    
gb|EFX71218.1|  proteasome subunit alpha type 6-like protein            218   1e-66    
ref|XP_005987929.1|  PREDICTED: proteasome subunit alpha type-6-l...    216   1e-66    
ref|XP_009831249.1|  hypothetical protein H257_07425                    218   2e-66    
ref|XP_005987928.1|  PREDICTED: proteasome subunit alpha type-6-l...    218   2e-66    
ref|XP_009209663.1|  PREDICTED: proteasome subunit alpha type-6 i...    217   2e-66    
gb|EHB05850.1|  Proteasome subunit alpha type-6                         218   2e-66    
ref|XP_010390621.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    215   3e-66    
gb|KFU86810.1|  Proteasome subunit alpha type-6                         216   3e-66    
gb|KFP22449.1|  Proteasome subunit alpha type-6                         216   3e-66    
ref|XP_010153544.1|  PREDICTED: proteasome subunit alpha type-6 i...    216   5e-66    
ref|XP_002143952.1|  proteasome component Prs2, putative                217   6e-66    
ref|XP_005285406.1|  PREDICTED: proteasome subunit alpha type-6 i...    214   6e-66    
ref|XP_007688022.1|  hypothetical protein COCMIDRAFT_5367               217   7e-66    
ref|XP_009222727.1|  proteasome subunit alpha type-6                    217   7e-66    
ref|XP_002411749.1|  proteasome subunit alpha type, putative            216   7e-66    
tpe|CBF76587.1|  TPA: proteasome core alpha 1 component (Eurofung)      217   8e-66    
gb|EGW11727.1|  Proteasome subunit alpha type-6                         214   9e-66    
gb|EOB05002.1|  Proteasome subunit alpha type-6                         215   9e-66    
ref|XP_662473.1|  hypothetical protein AN4869.2                         217   1e-65    
gb|EHK40697.1|  hypothetical protein TRIATDRAFT_301498                  216   1e-65    
gb|EHK16557.1|  hypothetical protein TRIVIDRAFT_75344                   216   1e-65    
ref|XP_002113578.1|  hypothetical protein TRIADDRAFT_27191              216   1e-65    
emb|CDM30570.1|  Probable proteasome subunit alpha type-6               216   1e-65    
ref|XP_008024763.1|  hypothetical protein SETTUDRAFT_168966             214   1e-65    
gb|KFW08632.1|  Proteasome subunit alpha type-6                         215   2e-65    
ref|XP_001271130.1|  predicted protein                                  216   2e-65    
ref|XP_005656349.1|  PREDICTED: proteasome subunit alpha type-6 i...    215   2e-65    
ref|XP_007660691.1|  PREDICTED: proteasome subunit alpha type-6 i...    213   2e-65    
emb|CDQ77351.1|  unnamed protein product                                215   2e-65    
ref|XP_006963196.1|  proteasome subunit alpha 6                         216   2e-65    
gb|KGO72988.1|  Proteasome A-type subunit                               216   2e-65    
ref|XP_007796832.1|  putative proteasome subunit alpha type 6 pro...    215   3e-65    
ref|XP_003740511.1|  PREDICTED: proteasome subunit alpha type-6-like    215   3e-65    
gb|ACI70015.1|  Proteasome subunit alpha type-6                         215   3e-65    
ref|XP_009063626.1|  hypothetical protein LOTGIDRAFT_229407             215   3e-65    
ref|XP_007912348.1|  putative proteasome subunit alpha type 6 pro...    215   3e-65    
gb|KGO36960.1|  Proteasome A-type subunit                               215   3e-65    
ref|XP_001796064.1|  hypothetical protein SNOG_05667                    215   4e-65    
emb|CDQ88726.1|  unnamed protein product                                214   4e-65    
ref|XP_003079656.1|  20S proteasome alpha subunit A1 (ISS)              212   5e-65    
gb|ACM09335.1|  Proteasome subunit alpha type-6                         214   5e-65    
gb|EFX02870.1|  proteasome subunit alpha type 6                         214   6e-65    
ref|XP_002741353.1|  PREDICTED: proteasome subunit alpha type-6-like    214   9e-65    
ref|XP_002480335.1|  proteasome component Prs2, putative                214   1e-64    
ref|XP_001843247.1|  proteasome subunit alpha type 6                    214   1e-64    
gb|EFA79004.1|  proteasome subunit alpha type 6                         213   1e-64    
ref|XP_007253021.1|  PREDICTED: proteasome subunit alpha type-6-l...    215   1e-64    
ref|XP_003303796.1|  hypothetical protein PTT_16156                     213   2e-64    
ref|XP_008599361.1|  proteasome A-type and B-type                       213   2e-64    
gb|EQL00512.1|  proteasome subunit alpha type 6                         213   2e-64    
ref|XP_005293216.1|  PREDICTED: proteasome subunit alpha type-6-l...    213   2e-64    
ref|XP_002559377.1|  Pc13g09540                                         213   2e-64    
ref|XP_003717769.1|  proteasome subunit alpha type-6                    213   2e-64    
gb|KFM81155.1|  Proteasome subunit alpha type-6                         213   3e-64    
gb|KGQ11560.1|  Proteasome subunit alpha type-6                         213   3e-64    
ref|XP_006696698.1|  hypothetical protein CTHT_0063920                  213   4e-64    
dbj|BAM18567.1|  proteasome alpha1 subunit                              212   4e-64    
ref|XP_003323788.2|  proteasome subunit alpha type-6                    212   5e-64    
ref|XP_001931683.1|  proteasome subunit alpha type-6                    212   5e-64    
ref|XP_001819832.1|  proteasome subunit alpha type-6                    212   7e-64    
gb|KIX01010.1|  hypothetical protein Z518_10076                         211   8e-64    
gb|KFY37296.1|  hypothetical protein V495_07258                         211   9e-64    
gb|KFA67907.1|  hypothetical protein S40285_04100                       211   9e-64    
emb|CEJ93046.1|  Putative Proteasome subunit alpha type                 211   1e-63    
gb|KDN66300.1|  putative proteasome A-type and B-type                   211   1e-63    
gb|KFY28594.1|  hypothetical protein V493_02857                         211   1e-63    
gb|EME46261.1|  hypothetical protein DOTSEDRAFT_70305                   211   1e-63    
ref|XP_011120711.1|  hypothetical protein AOL_s00075g98                 211   1e-63    
gb|KFA73659.1|  hypothetical protein S40288_07644                       212   1e-63    
gb|KEY66092.1|  hypothetical protein S7711_09211                        212   1e-63    
ref|XP_007068323.1|  PREDICTED: proteasome subunit alpha type-6-like    211   2e-63    
emb|CCF38339.1|  proteasome A-type and B-type                           211   2e-63    
gb|EFQ28985.1|  proteasome A-type and B-type                            211   2e-63    
gb|KIY02732.1|  proteasome subunit alpha type-6                         211   2e-63    
gb|KIW74909.1|  hypothetical protein Z517_11680                         211   2e-63    
gb|KIW87420.1|  hypothetical protein Z519_12056                         211   2e-63    
ref|XP_318387.2|  AGAP003935-PA                                         210   3e-63    
gb|ETN58251.1|  proteasome subunit alpha type 6                         210   3e-63    
gb|ERS99418.1|  hypothetical protein HMPREF1624_04618                   210   3e-63    
ref|XP_004584816.1|  PREDICTED: proteasome subunit alpha type-6         210   3e-63    
ref|XP_009579753.1|  PREDICTED: proteasome subunit alpha type-6 i...    207   3e-63    
gb|KFB46736.1|  AGAP003935-PA-like protein                              210   3e-63    
gb|EWG40643.1|  20S proteasome subunit alpha 1                          209   3e-63    
ref|XP_001654091.1|  AAEL009898-PA                                      210   3e-63    
ref|XP_007680618.1|  hypothetical protein BAUCODRAFT_126149             211   3e-63    
gb|EWY90454.1|  20S proteasome subunit alpha 1                          209   3e-63    
gb|KIW28395.1|  hypothetical protein PV07_08062                         210   3e-63    
gb|KIL96483.1|  hypothetical protein FAVG1_01227                        210   4e-63    
emb|CCE29503.1|  probable SCL1-20S proteasome subunit YC7ALPHA/Y8...    210   4e-63    
ref|XP_007741776.1|  20S proteasome subunit alpha 1                     211   4e-63    
ref|XP_002841029.1|  hypothetical protein                               209   4e-63    
ref|XP_009811688.1|  PREDICTED: proteasome subunit alpha type-6 i...    207   4e-63    
ref|XP_003756477.1|  PREDICTED: proteasome subunit alpha type-6         208   5e-63    
gb|EMF14550.1|  N-terminal nucleophile aminohydrolase                   209   5e-63    
gb|KFX91072.1|  hypothetical protein V490_06088                         209   5e-63    
ref|XP_007601883.1|  proteasome A-type and B-type                       209   5e-63    
ref|XP_003844849.1|  similar to proteasome subunit alpha type-6         209   5e-63    
ref|XP_009482321.1|  PREDICTED: proteasome subunit alpha type-6 i...    206   5e-63    
ref|XP_005703510.1|  20S proteasome subunit alpha 1                     209   5e-63    
ref|XP_007295783.1|  proteasome subunit alpha type 6                    209   5e-63    
gb|ACB87915.1|  20S proteasome alpha subunit A1                         207   6e-63    
ref|XP_005099053.1|  PREDICTED: proteasome subunit alpha type-6-like    209   6e-63    
ref|XP_008712166.1|  hypothetical protein HMPREF1541_09269              209   6e-63    
dbj|GAM19752.1|  hypothetical protein SAMD00019534_029270               209   6e-63    
ref|XP_007756206.1|  proteasome subunit alpha type-6                    209   6e-63    
ref|NP_724614.1|  proteasome alpha1 subunit, isoform A                  209   7e-63    
ref|XP_007821798.1|  Proteasome A-type subunit                          209   8e-63    
ref|XP_007807465.1|  proteasome subunit alpha type 6                    209   8e-63    
ref|XP_007926644.1|  hypothetical protein MYCFIDRAFT_188442             209   8e-63    
gb|KFG86753.1|  proteasome subunit alpha type 6                         209   8e-63    
gb|KDB16148.1|  proteasome subunit alpha type 6                         209   8e-63    
ref|XP_011319207.1|  proteasome component C7-alpha                      209   8e-63    
emb|CEF75633.1|  unnamed protein product                                209   8e-63    
gb|EPS29950.1|  hypothetical protein PDE_04900                          209   9e-63    
gb|EGU87091.1|  hypothetical protein FOXB_02485                         209   9e-63    
gb|KDO64978.1|  hypothetical protein CISIN_1g025897mg                   207   9e-63    
ref|XP_009255010.1|  hypothetical protein FPSE_03616                    209   1e-62    
gb|EWZ90275.1|  20S proteasome subunit alpha 1                          207   1e-62    
ref|XP_006801196.1|  PREDICTED: proteasome subunit alpha type-6-l...    208   1e-62    
gb|KHN94324.1|  proteasome subunit alpha type 6                         209   1e-62    
gb|KFY99093.1|  hypothetical protein V500_01465                         209   1e-62    
ref|XP_001361000.1|  GA15805                                            208   1e-62    
ref|XP_007873808.1|  hypothetical protein PNEG_01835                    208   1e-62    
gb|KID99895.1|  proteasome subunit alpha type 6                         208   1e-62    
gb|EKG12338.1|  Proteasome alpha-subunit conserved site                 208   1e-62    
ref|XP_005762775.1|  hypothetical protein EMIHUDRAFT_446206             209   1e-62    
gb|ELR02822.1|  20S proteasome subunit alpha 1                          208   1e-62    
gb|EMT05329.1|  Proteasome subunit alpha type-6                         209   2e-62    
gb|KEZ38816.1|  hypothetical protein SAPIO_CDS10856                     208   2e-62    
gb|KFY66093.1|  hypothetical protein V496_02185                         208   2e-62    
ref|XP_001244388.1|  hypothetical protein CIMG_03829                    208   2e-62    
gb|EPE09739.1|  proteasome subunit alpha type 6                         208   2e-62    
ref|XP_004075507.1|  PREDICTED: proteasome subunit alpha type-6-like    208   2e-62    
gb|ABI13160.1|  putative proteasome alpha subunit                       208   2e-62    
ref|XP_001749972.1|  hypothetical protein                               208   2e-62    
ref|XP_002427127.1|  proteasome subunit alpha type, putative            208   2e-62    
ref|XP_007719836.1|  proteasome subunit alpha type-6                    208   2e-62    
ref|XP_002089534.1|  Prosalpha6                                         207   2e-62    
ref|XP_003051118.1|  predicted protein                                  208   2e-62    
gb|AAD33944.1|AF144749_1  20S proteasome subunit alpha1                 207   2e-62    
ref|XP_009158794.1|  proteasome subunit alpha type-6                    208   2e-62    
ref|XP_008724612.1|  hypothetical protein G647_10399                    207   3e-62    
gb|KIW69429.1|  hypothetical protein PV04_05306                         207   3e-62    
dbj|GAD99016.1|  predicted protein                                      210   3e-62    
ref|XP_010896958.1|  PREDICTED: proteasome subunit alpha type-6-l...    207   3e-62    
gb|KFY13879.1|  hypothetical protein V492_03002                         207   3e-62    
ref|XP_006128209.1|  PREDICTED: proteasome subunit alpha type-6-like    208   3e-62    
dbj|GAM85636.1|  hypothetical protein ANO11243_036430                   207   3e-62    
gb|AGM32386.1|  proteasome subunit alpha type-6                         207   3e-62    
emb|CAK44248.1|  unnamed protein product                                207   3e-62    
gb|KID80249.1|  proteasome subunit alpha type 6                         207   3e-62    
ref|XP_003349217.1|  hypothetical protein SMAC_05500                    207   4e-62    
ref|XP_008993532.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    207   4e-62    
ref|NP_001187798.1|  proteasome subunit alpha type-6                    207   4e-62    
ref|NP_001040459.1|  proteasome subunit alpha type 6-A                  207   5e-62    
ref|XP_007731114.1|  proteasome subunit alpha type-6                    207   5e-62    
ref|XP_011419593.1|  PREDICTED: proteasome subunit alpha type-6         206   5e-62    
ref|NP_001060261.1|  Os07g0614100                                       207   6e-62    
gb|KIW43338.1|  hypothetical protein PV06_04450                         207   6e-62    
ref|XP_006665767.1|  proteasome subunit alpha type 6                    207   6e-62    
ref|XP_002032815.1|  GM20751                                            206   6e-62    
ref|XP_002004197.1|  GI19734                                            206   6e-62    
ref|XP_003662349.1|  hypothetical protein MYCTH_2302907                 207   7e-62    
gb|ABY55470.1|  Prosalpha6                                              206   7e-62    
dbj|GAA88851.1|  proteasome subunit alpha type 6                        207   7e-62    
ref|XP_003449352.1|  PREDICTED: proteasome subunit alpha type-6-like    206   7e-62    
ref|XP_957907.1|  proteasome subunit alpha type 6                       206   9e-62    
ref|XP_007833194.1|  Proteasome subunit alpha type-6                    206   1e-61    
ref|XP_001399838.2|  proteasome subunit alpha type-6                    206   1e-61    
ref|XP_001986319.1|  GH20588                                            206   1e-61    
ref|XP_008085140.1|  N-terminal nucleophile aminohydrolases (Ntn ...    206   1e-61    
ref|XP_001548586.1|  conserved hypothetical protein                     206   1e-61    
emb|CCC12323.1|  unnamed protein product                                206   1e-61    
ref|XP_005177054.1|  PREDICTED: proteasome subunit alpha type-6         206   1e-61    
gb|EQB51932.1|  proteasome A-type and B-type                            206   1e-61    
gb|ENH81729.1|  proteasome subunit alpha type 6                         206   2e-61    
ref|XP_003015989.1|  hypothetical protein ARB_05386                     204   2e-61    
gb|KIN06410.1|  hypothetical protein OIDMADRAFT_141988                  205   2e-61    
ref|XP_001960978.1|  GF11235                                            205   2e-61    
ref|XP_007234010.1|  PREDICTED: proteasome subunit alpha type-6-like    205   3e-61    
gb|KIV96436.1|  hypothetical protein PV10_00308                         205   3e-61    
gb|KFH45227.1|  Proteasome subunit alpha-like protein                   205   3e-61    
ref|XP_001912148.1|  hypothetical protein                               205   3e-61    
ref|XP_003286860.1|  proteasome subunit alpha type 6                    204   3e-61    
ref|XP_003857582.1|  proteasome core particle subunit alpha 1           205   4e-61    
ref|XP_002296891.1|  26S proteasome subunit                             204   4e-61    
ref|XP_007586723.1|  putative proteasome subunit alpha type-6 pro...    204   5e-61    
ref|XP_001970565.1|  GG10705                                            204   5e-61    
gb|KHJ35771.1|  putative proteasome subunit alpha type 6                204   6e-61    
emb|CCG84721.1|  protein of unknown function                            204   6e-61    
ref|XP_003649967.1|  hypothetical protein THITE_2109162                 204   6e-61    
ref|XP_003177216.1|  proteasome subunit alpha type-6                    204   7e-61    
ref|XP_003024134.1|  hypothetical protein TRV_01692                     203   8e-61    
gb|ESZ92951.1|  proteasome subunit alpha type 6                         204   8e-61    
gb|EHJ78841.1|  proteasome subunit alpha type 6-A                       204   9e-61    
ref|XP_011414019.1|  PREDICTED: proteasome subunit alpha type-6-like    201   1e-60    
ref|XP_010896959.1|  PREDICTED: proteasome subunit alpha type-6-l...    201   1e-60    
gb|EZG02619.1|  hypothetical protein H106_07457                         203   1e-60    



>ref|XP_011098408.1| PREDICTED: proteasome subunit alpha type-6 [Sesamum indicum]
Length=246

 Score =   370 bits (950),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD LARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG 
Sbjct  111  VDALARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGG  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIE+GVVR++DP F+VL
Sbjct  171  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEVGVVRKDDPVFKVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246



>gb|EYU19318.1| hypothetical protein MIMGU_mgv1a012555mg [Erythranthe guttata]
Length=246

 Score =   370 bits (949),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
             DVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG 
Sbjct  111  ADVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGG  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLEKKMKNDPAFSY+ETVQTAISALQSVLQEDFKASEIE+GVVR+EDP F+VL
Sbjct  171  KEQEAVNFLEKKMKNDPAFSYDETVQTAISALQSVLQEDFKASEIEVGVVRKEDPVFKVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STDEIDEHLTAISERD  246



>ref|XP_011099933.1| PREDICTED: proteasome subunit alpha type-6-like [Sesamum indicum]
Length=246

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD LARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG 
Sbjct  111  VDALARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGG  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAFS++ETVQTAISALQSVLQEDFKASEIE+GVVR+EDP F+VL
Sbjct  171  KEQEAINFLEKKMKNDPAFSFDETVQTAISALQSVLQEDFKASEIEVGVVRKEDPVFKVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246



>ref|XP_009631638.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana tomentosiformis]
Length=246

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVL++WIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG 
Sbjct  111  VDVLSKWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIE+GVV++EDP FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEVGVVKKEDPVFRVL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_009797939.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana sylvestris]
 sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Nicotiana tabacum]
 emb|CAB39975.1| PRCI [Nicotiana tabacum]
Length=246

 Score =   368 bits (945),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVL++WIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG 
Sbjct  111  VDVLSKWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIE+GVV++EDP FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEVGVVKKEDPIFRVL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_009380029.1| PREDICTED: proteasome subunit alpha type-6 [Musa acuminata subsp. 
malaccensis]
Length=246

 Score =   367 bits (943),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAAEFRF++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARSLVQQARNEAAEFRFKWGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQ+YTQHAYMRPLGVVAM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG+
Sbjct  111  VDVLAKWIADKSQIYTQHAYMRPLGVVAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR +DP+FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRNDDPAFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_004251692.1| PREDICTED: proteasome subunit alpha type-6 [Solanum lycopersicum]
 ref|XP_006345264.1| PREDICTED: proteasome subunit alpha type-6-like [Solanum tuberosum]
Length=246

 Score =   365 bits (936),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
             DVL++WIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG 
Sbjct  111  ADVLSKWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKN+PAFSYEETVQT ISALQSVLQEDFKASEIE+GVVR+EDP FRVL
Sbjct  171  KEQEAINFLEKKMKNNPAFSYEETVQTTISALQSVLQEDFKASEIEVGVVRKEDPVFRVL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_009404175.1| PREDICTED: proteasome subunit alpha type-6-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   364 bits (935),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATGITADAR+LVQQARNEAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYLGLLATGITADARSLVQQARNEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQ+YTQHAYMRPLG+VAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKSQIYTQHAYMRPLGIVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAFSYEETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FRVLST
Sbjct  173  QEAINFLEKKMKNDPAFSYEETVQIAISALQSVLQEDFKATEIEVGVVRKEDTVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010274570.1| PREDICTED: proteasome subunit alpha type-6 [Nelumbo nucifera]
Length=246

 Score =   364 bits (935),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLF +TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFAITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VL++WIADKSQ+YTQHAYMRPLGV AM+LGIDEE GPQLFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLSKWIADKSQIYTQHAYMRPLGVAAMVLGIDEENGPQLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVLST
Sbjct  173  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRKENPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>emb|CDP03072.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   364 bits (935),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF++GYEMP
Sbjct  52   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKFGYEMP  111

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD LA+WIADKSQVYTQHAYMRPLGVVAMILGIDEE GPQLFKCDPAGHFFGHKATSAG 
Sbjct  112  VDTLAKWIADKSQVYTQHAYMRPLGVVAMILGIDEEAGPQLFKCDPAGHFFGHKATSAGA  171

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVL
Sbjct  172  KDQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKANEIEVGVVRKENPIFRVL  231

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  232  STEEIDEHLTAISERD  247


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  38   ITSIGVRGKDSVCVVTQKKVPDKLL  62



>gb|EPS63192.1| proteasome subunit alpha type-6 [Genlisea aurea]
Length=246

 Score =   363 bits (933),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLF VTKYLGLL TGITADARTLVQQARN+AA+FRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFHVTKYLGLLTTGITADARTLVQQARNKAADFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLARWIADKSQVYTQHAYMRPLG++AM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG 
Sbjct  111  VDVLARWIADKSQVYTQHAYMRPLGIIAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKASEIE+GVVR+EDP F+VL
Sbjct  171  KDQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKASEIEVGVVRKEDPVFKVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246



>gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum]
Length=246

 Score =   363 bits (931),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
             ++ ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE
Sbjct  49   CFVTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            MPVDVL++WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSA
Sbjct  109  MPVDVLSKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P+FR
Sbjct  169  GSKEQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPAFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            VLST EIDEHLTAISERD
Sbjct  229  VLSTEEIDEHLTAISERD  246



>gb|KJB65226.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=246

 Score =   363 bits (931),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVL++WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG 
Sbjct  111  VDVLSKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P+FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPAFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010269878.1| PREDICTED: proteasome subunit alpha type-6-like [Nelumbo nucifera]
Length=246

 Score =   363 bits (931),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQ+YTQHAYMRP GV AMILGIDEE GPQLFKCDPAGHFFGHKATS G+
Sbjct  111  VDVLAKWIADKSQIYTQHAYMRPFGVAAMILGIDEENGPQLFKCDPAGHFFGHKATSVGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRKENPVFRVL  230

Query  194  STVEIDEHLTAISERD  147
             T EIDEHLTAISERD
Sbjct  231  PTEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|KHG01950.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=246

 Score =   362 bits (930),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVL++WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG 
Sbjct  111  VDVLSKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+  +P+FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKANNPAFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 [Vitis vinifera]
 emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera]
 emb|CBI35851.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   362 bits (928),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLARWIADKSQVYTQHAYMRPLGVVAMILGID+E GP+LFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDDENGPRLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAFSY+ETVQTAISALQSVLQEDFK +EIE+GVVR + P+FRVLST
Sbjct  173  QEAINFLEKKMKNDPAFSYDETVQTAISALQSVLQEDFKPNEIEVGVVRTDSPAFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|KJB82986.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=246

 Score =   360 bits (925),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVL++WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG 
Sbjct  111  VDVLSKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FRV+
Sbjct  171  KEQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPVFRVM  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|KJB82988.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=244

 Score =   360 bits (925),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  59   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  118

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  178

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FRV+ST EIDEHLT
Sbjct  179  KKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPVFRVMSTEEIDEHLT  238

Query  164  AISERD  147
            AISERD
Sbjct  239  AISERD  244



>ref|XP_007012615.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
 gb|EOY30234.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
Length=246

 Score =   360 bits (925),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE+P
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYELP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG 
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FR L
Sbjct  171  KEQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPVFRAL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STAEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_002516258.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF46260.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   360 bits (924),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGV+AM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVIAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMKND AF+YEETVQTAISALQSVLQEDFKA+EIE+GVVR +D  FRVLST EIDEHLT
Sbjct  181  KKMKNDRAFTYEETVQTAISALQSVLQEDFKATEIEVGVVRADDRVFRVLSTEEIDEHLT  240

Query  164  AISERD  147
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006842706.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
 gb|ERN04381.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
Length=246

 Score =   360 bits (923),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQAR+EAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARSLVQQARHEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQ+YTQHAYMRPLG+ AM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKSQIYTQHAYMRPLGIAAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAFSYEETVQT ISALQSVLQEDFKA+EIE+GVVR+E+P FRVLST
Sbjct  173  QEAINFLEKKMKNDPAFSYEETVQTTISALQSVLQEDFKATEIEVGVVRRENPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDS+CVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSICVVTQKKVPDKLL  61



>ref|XP_010937324.1| PREDICTED: proteasome subunit alpha type-6 [Elaeis guineensis]
Length=246

 Score =   360 bits (923),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQ+YTQHAYMRPLGV AMILGIDEEKGPQLFKCDPAGHFFGHKATS+G+KE
Sbjct  113  VLAKWIADKSQIYTQHAYMRPLGVAAMILGIDEEKGPQLFKCDPAGHFFGHKATSSGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDP FSYEETVQTAISALQSVLQEDFKA+EIE+GVVR +DP FRVLST
Sbjct  173  QEAINFLEKKMKNDPKFSYEETVQTAISALQSVLQEDFKATEIEVGVVRTDDPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010111992.1| Proteasome subunit alpha type-6 [Morus notabilis]
 gb|EXC32303.1| Proteasome subunit alpha type-6 [Morus notabilis]
Length=299

 Score =   362 bits (928),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD
Sbjct  106  QKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVD  165

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFGHKATSAG+KE
Sbjct  166  VLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDEFGPRLYKCDPAGHFFGHKATSAGLKE  225

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVVRQ++P FRVLST
Sbjct  226  QEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKANEIEVGVVRQDNPVFRVLST  285

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  286  EEIDEHLTAISERD  299



>ref|XP_008802476.1| PREDICTED: proteasome subunit alpha type-6-like [Phoenix dactylifera]
Length=246

 Score =   359 bits (922),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDP F YEETVQTAISALQSV+QEDFKA+EIE+GVVR ED  FRVL
Sbjct  171  KEQEAINFLEKKMKNDPKFLYEETVQTAISALQSVIQEDFKATEIEVGVVRTEDSVFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_002323091.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|ABK93034.1| unknown [Populus trichocarpa]
 gb|EEF04852.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   359 bits (921),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
             LARWIADKSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ALARWIADKSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPA SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST
Sbjct  173  QEAINFLEKKMKNDPALSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDCVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246



>ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   359 bits (921),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVD
Sbjct  53   QKKVPDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQ+YTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKSQIYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FRVLST
Sbjct  173  QEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVRTENPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246



>gb|KDP33929.1| hypothetical protein JCGZ_07500 [Jatropha curcas]
Length=246

 Score =   358 bits (920),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHF+GHKATSAG+KE
Sbjct  113  VLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFYGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAFSYEETVQTAISALQS+LQEDFKA+EIE+GVVR ++  FRVL T
Sbjct  173  QEAINFLEKKMKNDPAFSYEETVQTAISALQSILQEDFKATEIEVGVVRADNRVFRVLPT  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_006381605.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
 ref|XP_011039970.1| PREDICTED: proteasome subunit alpha type-6 [Populus euphratica]
 gb|ERP59402.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
Length=246

 Score =   358 bits (920),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
             LARWIADKSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KE
Sbjct  113  ALARWIADKSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPA SYEETVQTAISALQSVLQEDFKA+EIE+GVVR ++  FRVLST
Sbjct  173  QEAINFLEKKMKNDPALSYEETVQTAISALQSVLQEDFKATEIEVGVVRTDNLVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246



>ref|XP_008782714.1| PREDICTED: proteasome subunit alpha type-6 [Phoenix dactylifera]
Length=246

 Score =   358 bits (919),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPLTKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQ+YTQHAYMRPLGV AMILGIDEEKGPQLFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKSQIYTQHAYMRPLGVAAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVV+ +DP FR LST
Sbjct  173  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVKTDDPVFRGLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|KJB65225.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=247

 Score =   358 bits (918),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 187/197 (95%), Gaps = 1/197 (1%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK-ATSAG  378
            VDVL++WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHK ATSAG
Sbjct  111  VDVLSKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKVATSAG  170

Query  377  VKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRV  198
             KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P+FRV
Sbjct  171  SKEQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPAFRV  230

Query  197  LSTVEIDEHLTAISERD  147
            LST EIDEHLTAISERD
Sbjct  231  LSTEEIDEHLTAISERD  247


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_011001657.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
 ref|XP_011015647.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   357 bits (917),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
             LARWIADKSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ALARWIADKSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPA SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST
Sbjct  173  QEAINFLEKKMKNDPALSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDHVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246



>ref|XP_008462289.1| PREDICTED: proteasome subunit alpha type-6 [Cucumis melo]
Length=246

 Score =   357 bits (916),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAA+FRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAADFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFGHKATSAG+
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKANEIEVGVVRSENPIFRVL  230

Query  194  STVEIDEHLTAISERD  147
            +T E+DEHLTAISERD
Sbjct  231  TTEEVDEHLTAISERD  246



>gb|KDP45827.1| hypothetical protein JCGZ_17434 [Jatropha curcas]
Length=246

 Score =   357 bits (915),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVT+LFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTNLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAFSYEETVQTAISALQS+LQEDFKA+EIE+GVVR +   FRVL T
Sbjct  173  QEAINFLEKKMKNDPAFSYEETVQTAISALQSILQEDFKATEIEVGVVRADSRVFRVLPT  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_006592586.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max]
 gb|KHN16010.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=246

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMP
Sbjct  51   VTQKKVPDKLLDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVL
Sbjct  171  KDQEAINFLEKKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKENPEFRVL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDS+CVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSICVVTQKKVPDKLL  61



>gb|KJB82987.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=247

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 186/197 (94%), Gaps = 1/197 (1%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK-ATSAG  378
            VDVL++WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHK ATSAG
Sbjct  111  VDVLSKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKVATSAG  170

Query  377  VKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRV  198
             KEQEAINFLEKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FRV
Sbjct  171  SKEQEAINFLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPVFRV  230

Query  197  LSTVEIDEHLTAISERD  147
            +ST EIDEHLTAISERD
Sbjct  231  MSTEEIDEHLTAISERD  247


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_008228175.1| PREDICTED: proteasome subunit alpha type-6 [Prunus mume]
Length=246

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLARWIADKSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KE
Sbjct  113  VLARWIADKSQIYTQHAYMRPLGVVAMVLGIDEEFGPQLYKCDPAGHYFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDP F+Y+ETVQTAISALQSVLQEDFKA+EIE+GVV +E+P FRVLST
Sbjct  173  QEAINFLEKKMKNDPLFTYDETVQTAISALQSVLQEDFKANEIEVGVVVKENPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_004488480.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Cicer 
arietinum]
 ref|XP_004488481.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Cicer 
arietinum]
 ref|XP_004488482.1| PREDICTED: proteasome subunit alpha type-6-like isoform X3 [Cicer 
arietinum]
Length=246

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR +YGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH++GHKATSAG+
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYYGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVV++++P+FRVL
Sbjct  171  KDQEAINFLEKKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVQKDNPAFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246



>ref|XP_007215872.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
 gb|EMJ17071.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
Length=246

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLARWIADKSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KE
Sbjct  113  VLARWIADKSQIYTQHAYMRPLGVVAMVLGIDEEFGPQLYKCDPAGHYFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDP F+Y+ETVQTAISALQSVLQEDFKA+EIE+GVV +E+P FRVLST
Sbjct  173  QEAINFLEKKMKNDPLFTYDETVQTAISALQSVLQEDFKANEIEVGVVVKENPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  DEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 ref|XP_004155912.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 gb|KGN45477.1| hypothetical protein Csa_7G448880 [Cucumis sativus]
Length=246

 Score =   355 bits (911),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAAEFRF+YGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAAEFRFQYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GP+LFKCDPAGHFFGHKATSAG+
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDEYGPRLFKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRSDNPIFRVL  230

Query  194  STVEIDEHLTAISERD  147
            +T E+DEHLTAISERD
Sbjct  231  TTEEVDEHLTAISERD  246



>ref|XP_006474717.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Citrus 
sinensis]
 gb|KDO73882.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=244

 Score =   355 bits (910),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  59   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  118

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  178

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMKNDPAFSYEETVQTA+SALQSVLQEDFKA+EIE+GVVR +D  FRVLS+ EIDEHLT
Sbjct  179  KKMKNDPAFSYEETVQTAVSALQSVLQEDFKATEIEVGVVRSDDRVFRVLSSEEIDEHLT  238

Query  164  AISERD  147
            AISERD
Sbjct  239  AISERD  244



>ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max]
 sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1; AltName: Full=Proteasome iota subunit [Glycine 
max]
 gb|AAC28135.1| proteasome IOTA subunit [Glycine max]
Length=246

 Score =   355 bits (910),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+++P FRVL+T EIDEHLT
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKDNPEFRVLTTDEIDEHLT  240

Query  164  AISERD  147
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010939895.1| PREDICTED: proteasome subunit alpha type-6-like [Elaeis guineensis]
Length=246

 Score =   354 bits (909),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEF F++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFHFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQ+YTQHAYMRPLG+VAMILGIDEEKGPQL KCDPAGHFFGHKATSAGVKE
Sbjct  113  VLAKWIADKSQIYTQHAYMRPLGLVAMILGIDEEKGPQLLKCDPAGHFFGHKATSAGVKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDP FSY ETVQTAISALQSV+QEDFKA+EIE+GVVR +DP FRVLST
Sbjct  173  QEAINFLEKKMKNDPKFSYGETVQTAISALQSVIQEDFKATEIEVGVVRTKDPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010064020.1| PREDICTED: proteasome subunit alpha type-6 [Eucalyptus grandis]
 gb|KCW71315.1| hypothetical protein EUGRSUZ_F04398 [Eucalyptus grandis]
Length=246

 Score =   354 bits (909),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFR GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRNGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD LA+WIADKSQ+YTQHAYMRPLGVVAM+LGIDEE GP+L+KCDPAGHFFGHKATSAG 
Sbjct  111  VDALAKWIADKSQIYTQHAYMRPLGVVAMVLGIDEEFGPRLYKCDPAGHFFGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAFSY+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFSYDETVQTAISALQSVLQEDFKANEIEVGVVRSDNPVFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_006474716.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Citrus 
sinensis]
 gb|KDO73881.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=246

 Score =   354 bits (909),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMP
Sbjct  51   VTQKKVPDKLLDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVL+RWIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHFFGHKATSAG+
Sbjct  111  VDVLSRWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAFSYEETVQTA+SALQSVLQEDFKA+EIE+GVVR +D  FRVL
Sbjct  171  KEQEAINFLEKKMKNDPAFSYEETVQTAVSALQSVLQEDFKATEIEVGVVRSDDRVFRVL  230

Query  194  STVEIDEHLTAISERD  147
            S+ EIDEHLTAISERD
Sbjct  231  SSEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|ABK95322.1| unknown [Populus trichocarpa]
Length=246

 Score =   354 bits (909),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRY YEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYWYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
             LARWIADKSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ALARWIADKSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPA SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST
Sbjct  173  QEAINFLEKKMKNDPALSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDCVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246



>gb|ABK96399.1| unknown [Populus trichocarpa x Populus deltoides]
Length=246

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
             LARWIADKSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+K DPAGHFFGHKATSAG+KE
Sbjct  113  ALARWIADKSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKSDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPA SYEETVQTAISALQSVLQE+FKA+EIE+GVVR ++  FRVLST
Sbjct  173  QEAINFLEKKMKNDPALSYEETVQTAISALQSVLQENFKATEIEVGVVRTDNLVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  774  TSIGVRGKDSVCVVTQKKVPDKLF  703
            TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  38   TSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_007133143.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
 gb|ESW05137.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
Length=246

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF  GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTNGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLARWIADKSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+
Sbjct  111  VDVLARWIADKSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMK DPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+++P FRVL
Sbjct  171  KDQEAINFLEKKMKGDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKDNPEFRVL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDS+CVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSICVVTQKKVPDKLL  61



>ref|XP_002308263.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|EEE91786.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   353 bits (905),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LDQTSVTHLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMKNDP+ SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLT
Sbjct  181  KKMKNDPSLSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDRIFRVLSTEEIDEHLT  240

Query  164  AISERD  147
            AISERD
Sbjct  241  AISERD  246



>gb|ACJ85916.1| unknown [Medicago truncatula]
 gb|AFK46669.1| unknown [Medicago truncatula]
 gb|KEH19590.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
Length=246

 Score =   353 bits (905),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LD TSVTHLFP+TKYLGLLATGITADARTLVQQARNEAAE+RFRYGYEMP
Sbjct  51   VTQKKVPDKLLDHTSVTHLFPITKYLGLLATGITADARTLVQQARNEAAEYRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVL++W+ADKSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+
Sbjct  111  VDVLSKWVADKSQVYTQHAYMRPLGVVAMVLGIDDELGPQLYKCDPAGHYFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDP+F+Y ETVQTAISALQSVLQEDFKA+EIE+GVV++++P FRVL
Sbjct  171  KDQEAINFLEKKMKNDPSFTYAETVQTAISALQSVLQEDFKATEIEVGVVQKDNPEFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STDEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_008391412.1| PREDICTED: proteasome subunit alpha type-6 [Malus domestica]
Length=246

 Score =   352 bits (904),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KE
Sbjct  113  VLAKWIADKSQIYTQHAYMRPLGVVAMVLGIDEEVGPQLYKCDPAGHYFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKN+P+FSY+ETVQT ISALQSVLQEDFKA+EIE+GVV +E+P FRVLST
Sbjct  173  QEAINFLEKKMKNEPSFSYDETVQTCISALQSVLQEDFKATEIEVGVVVKENPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_009344472.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
 ref|XP_009344473.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
Length=246

 Score =   352 bits (903),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KE
Sbjct  113  VLAKWIADKSQIYTQHAYMRPLGVVAMVLGIDEELGPQLYKCDPAGHYFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKN+P+FSY+ETVQT ISALQSVLQEDFKA+EIE+GVV +E+P FRVLST
Sbjct  173  QEAINFLEKKMKNEPSFSYDETVQTCISALQSVLQEDFKATEIEVGVVVKENPVFRVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|AFK47610.1| unknown [Lotus japonicus]
Length=246

 Score =   352 bits (903),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR  YGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDENGAQLYKCDPAGHYFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+++P FRVL
Sbjct  171  KDQEAINFLEKKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKDNPEFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STDEIDEHLTAISERD  246


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDS+CVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSICVVTQKKVPDKLL  61



>ref|XP_011018964.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   352 bits (902),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LDQTSV+HLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVSHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMKNDP+ SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLT
Sbjct  181  KKMKNDPSLSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDRIFRVLSTEEIDEHLT  240

Query  164  AISERD  147
            AISERD
Sbjct  241  AISERD  246



>gb|ADJ95344.1| PAA1 [Carica papaya]
Length=246

 Score =   352 bits (902),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD LA+WIADKSQ+YTQHAYMRPLGVVAM+LGIDEE+GPQLFKCDPAG F+GHKATSAG 
Sbjct  111  VDALAKWIADKSQIYTQHAYMRPLGVVAMVLGIDEEEGPQLFKCDPAGFFYGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR E+P F VL
Sbjct  171  KDQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRTENPVFHVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|KDO64982.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=225

 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVD
Sbjct  32   QKKVPDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVD  91

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KE
Sbjct  92   VLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKE  151

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAF+++ETVQTAIS LQSVLQEDFKASEIE+GVV +E+P FRVLS 
Sbjct  152  QEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSI  211

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  212  EEIDEHLTAISERD  225


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  16   VTSIGVRGKDSVCVVTQKKVPDKLL  40



>gb|KDO64983.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64984.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=191

 Score =   349 bits (896),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  6    LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  65

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  66   KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  125

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMKNDPAF+++ETVQTAIS LQSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLT
Sbjct  126  KKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLT  185

Query  164  AISERD  147
            AISERD
Sbjct  186  AISERD  191



>gb|ACU24622.1| unknown [Glycine max]
Length=246

 Score =   350 bits (899),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYE+PVD
Sbjct  53   QKKVPDKLLDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEIPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+K+
Sbjct  113  VLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDEYGLQLYKCDPAGHYFGHKATSAGLKD  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVL+T
Sbjct  173  QEAINFLEKKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKENPEFRVLTT  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDS+CVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSICVVTQKKVPDKLL  61



>gb|AFK46380.1| unknown [Lotus japonicus]
Length=246

 Score =   350 bits (898),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSV+HLFP+TKYLGLLATG+TADARTL QQARNEAAEFR  YGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVSHLFPITKYLGLLATGMTADARTLAQQARNEAAEFRHTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDENGAQLYKCDPAGHYFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+++P FRVL
Sbjct  171  KDQEAINFLEKKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKDNPEFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STDEIDEHLTAISERD  246



>ref|XP_003595788.1| Proteasome subunit alpha type [Medicago truncatula]
 gb|AES66039.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
 gb|AFK48993.1| unknown [Medicago truncatula]
Length=246

 Score =   350 bits (898),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG 
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDP+F+Y+ETVQTAI+ALQSVLQEDFKA+EIE+GVV+++ P FRVL
Sbjct  171  KDQEAINFLEKKMKNDPSFTYDETVQTAIAALQSVLQEDFKATEIEVGVVQKDKPEFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246



>gb|ACN66752.1| PAA1 [Carica papaya]
Length=246

 Score =   349 bits (896),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEA EFRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEATEFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
             LA+WIADKSQ+YTQHAYMRPLGVVAM+LGIDEE+GPQLFKCDPAG F+GHKATSAG K+
Sbjct  113  ALAKWIADKSQIYTQHAYMRPLGVVAMVLGIDEEEGPQLFKCDPAGFFYGHKATSAGSKD  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR E+P F VLST
Sbjct  173  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRTENPVFHVLST  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246



>gb|KDO64977.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=241

 Score =   349 bits (896),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVD
Sbjct  48   QKKVPDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVD  107

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KE
Sbjct  108  VLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKE  167

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAF+++ETVQTAIS LQSVLQEDFKASEIE+GVV +E+P FRVLS 
Sbjct  168  QEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSI  227

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  228  EEIDEHLTAISERD  241


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  32   VTSIGVRGKDSVCVVTQKKVPDKLL  56



>ref|XP_006465892.1| PREDICTED: proteasome subunit alpha type-6-like [Citrus sinensis]
 gb|KDO64976.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=246

 Score =   349 bits (896),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVD
Sbjct  53   QKKVPDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMKNDPAF+++ETVQTAIS LQSVLQEDFKASEIE+GVV +E+P FRVLS 
Sbjct  173  QEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSI  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   VTSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010557672.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
 ref|XP_010557673.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   349 bits (895),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SV+HLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVSHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATSAGV
Sbjct  111  VDILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSAGV  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMK++P F+Y ETVQTAISALQSVLQEDFKA+EIE+GVVR + P+FR L
Sbjct  171  KEQEAINFLEKKMKDNPTFTYNETVQTAISALQSVLQEDFKATEIEVGVVRADSPAFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_004303706.1| PREDICTED: proteasome subunit alpha type-6 [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+TK+LGLLATG+TADARTLV QARNEAA+FRF+ GYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPITKFLGLLATGMTADARTLVSQARNEAADFRFKNGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA WIA+KSQVYTQHAYMRPLGVVAM+LG+DEE GPQL+KCDPAGH+FGHKATSAG+
Sbjct  111  VDVLANWIANKSQVYTQHAYMRPLGVVAMVLGVDEETGPQLYKCDPAGHYFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDP+F+Y+ETVQTAISALQSVLQEDFKA+EIE+GVV  E+P+FRVL
Sbjct  171  KEQEAINFLEKKMKNDPSFTYDETVQTAISALQSVLQEDFKATEIEVGVVSMENPAFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|AFK46801.1| unknown [Medicago truncatula]
Length=246

 Score =   348 bits (892),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG 
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDP+F+Y+ETVQTAI+ALQSV QEDFKA+EIE+GVV+++ P FRVL
Sbjct  171  KDQEAINFLEKKMKNDPSFTYDETVQTAIAALQSVFQEDFKATEIEVGVVQKDKPEFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246



>ref|XP_010541996.1| PREDICTED: proteasome subunit alpha type-6-B [Tarenaya hassleriana]
Length=246

 Score =   347 bits (891),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQ+SVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQSSVTHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATS G+KE
Sbjct  113  ILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSVGMKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR + P FR L+T
Sbjct  173  QEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADSPVFRALTT  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010666851.1| PREDICTED: proteasome subunit alpha type-6 [Beta vulgaris subsp. 
vulgaris]
Length=246

 Score =   347 bits (889),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSV+HLF VTKYLGLLATG+TADAR LVQQARNEAAEFR +YGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVSHLFQVTKYLGLLATGMTADARNLVQQARNEAAEFRHKYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLARWIADKSQVYTQHAYMRPLGVVAM+LGIDEE+GP LFKCDPAGHF+GHKATSAG 
Sbjct  111  VDVLARWIADKSQVYTQHAYMRPLGVVAMVLGIDEERGPLLFKCDPAGHFYGHKATSAGA  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDPAFSY+ETVQTAISALQSVLQEDFKA+EIE+GVV+  +P+FR L
Sbjct  171  KDQEAINFLEKKMKNDPAFSYDETVQTAISALQSVLQEDFKATEIEVGVVQVGNPAFRGL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246



>gb|ACJ85912.1| unknown [Medicago truncatula]
Length=246

 Score =   346 bits (888),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSV HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVAHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG 
Sbjct  111  VDVLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            K+QEAINFLEKKMKNDP+F+Y+ETVQTAI+ALQSVLQEDFKA+EIE+GVV+++ P FRVL
Sbjct  171  KDQEAINFLEKKMKNDPSFTYDETVQTAIAALQSVLQEDFKATEIEVGVVQKDKPEFRVL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAI ERD
Sbjct  231  STEEIDEHLTAIGERD  246



>ref|XP_010533014.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   345 bits (885),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQ+SVTHLF +TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD
Sbjct  53   QKKVPDKLLDQSSVTHLFQITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATS G+KE
Sbjct  113  ILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSVGMKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L+T
Sbjct  173  QEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPVFRALTT  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   VTSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010435443.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
 ref|XP_010440739.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
Length=246

 Score =   344 bits (883),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGVVAM+LG+DEE GP L+KCDPAGHF+GHKATSAG+
Sbjct  111  VDILAKWIADKSQVYTQHAYMRPLGVVAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGM  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLEKKMK +PAF++ ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L
Sbjct  171  KEQEAVNFLEKKMKENPAFTFNETVQTAISALQSVLQEDFKATEIEVGVVRAENPLFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|NP_178641.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 ref|XP_002883713.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O81147.1|PSA6B_ARATH RecName: Full=Proteasome subunit alpha type-6-B; AltName: Full=20S 
proteasome subunit alpha A-2; AltName: Full=Proteasome 
subunit alpha type-1 [Arabidopsis thaliana]
 gb|AAC32055.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AAC95161.1| 20S proteasome alpha subunit A2 (PAA2) [Arabidopsis thaliana]
 gb|AAK96583.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|AAN28768.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|EFH59972.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC05979.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=246

 Score =   344 bits (883),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D
Sbjct  53   QKKVPDKLLDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPAD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEA+NFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR +DP FR L T
Sbjct  173  QEAVNFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADDPLFRSLRT  232

Query  188  VEIDEHLTAISERD  147
             EIDEHLTAISERD
Sbjct  233  EEIDEHLTAISERD  246


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010450390.1| PREDICTED: proteasome subunit alpha type-6-A [Camelina sativa]
Length=246

 Score =   344 bits (882),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPITKYVGLVATGITADARSLVQQARNEAAEFRFTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGVVAM+LG+DEE GP L+KCDPAGHF+GHKATSAG+
Sbjct  111  VDILAKWIADKSQVYTQHAYMRPLGVVAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGM  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLEKKMK +PAF+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L
Sbjct  171  KEQEAVNFLEKKMKENPAFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPLFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|KFK32243.1| hypothetical protein AALP_AA6G216400 [Arabis alpina]
Length=246

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LD +SV+HLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMP
Sbjct  51   VTQKKVPDKLLDASSVSHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFSYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEE GP L+KCDPAGHF+GHKATSAG+
Sbjct  111  VDILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEENGPLLYKCDPAGHFYGHKATSAGM  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L
Sbjct  171  KEQEAVNFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRAENPVFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_006282775.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
 gb|EOA15673.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
Length=246

 Score =   342 bits (877),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+TK++GL+ATGITADAR+LVQQARNEAAEFRF YGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPITKFIGLVATGITADARSLVQQARNEAAEFRFTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+
Sbjct  111  VDILAKWIADKSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGM  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLEKKMK +PAF+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L
Sbjct  171  KEQEAVNFLEKKMKENPAFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPLFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EIDEHLTAISERD
Sbjct  231  TTEEIDEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_010494382.1| PREDICTED: proteasome subunit alpha type-6-B [Camelina sativa]
Length=246

 Score =   342 bits (876),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SV+HLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVSHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
             D+LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAGV
Sbjct  111  ADILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGV  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L
Sbjct  171  KEQEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPIFRSL  230

Query  194  STVEIDEHLTAISERD  147
             T EI+EHLTAISERD
Sbjct  231  ETEEIEEHLTAISERD  246


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|NP_198409.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
 sp|O81146.2|PSA6A_ARATH RecName: Full=Proteasome subunit alpha type-6-A; AltName: Full=20S 
proteasome subunit alpha A-1; AltName: Full=Proteasome 
component 1; AltName: Full=Proteasome subunit alpha type-1 
[Arabidopsis thaliana]
 dbj|BAB09993.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 dbj|BAF00393.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AED93984.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
Length=246

 Score =   340 bits (873),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+
Sbjct  111  VDILAKWIADKSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGM  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLEKKMK +P+F+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L
Sbjct  171  KEQEAVNFLEKKMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EI+EHLTAISERD
Sbjct  231  TTEEIEEHLTAISERD  246


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>emb|CAA74025.1| multicatalytic endopeptidase complex, proteasome component, alpha 
subunit [Arabidopsis thaliana]
Length=245

 Score =   340 bits (873),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMP
Sbjct  50   VTQKKVPDKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMP  109

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+
Sbjct  110  VDILAKWIADKSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGM  169

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLEKKMK +P+F+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L
Sbjct  170  KEQEAVNFLEKKMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRAL  229

Query  194  STVEIDEHLTAISERD  147
            +T EI+EHLTAISERD
Sbjct  230  TTEEIEEHLTAISERD  245


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  36   ITSIGVRGKDSVCVVTQKKVPDKLL  60



>ref|XP_006649499.1| PREDICTED: proteasome subunit alpha type-6-like [Oryza brachyantha]
Length=246

 Score =   340 bits (872),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYVGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK+DP FSY+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T
Sbjct  173  QEAINFLEKKMKDDPQFSYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRALTT  232

Query  188  VEIDEHLTAISERD  147
             EID+HLTAISERD
Sbjct  233  EEIDQHLTAISERD  246


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   VTSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|AAM12968.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AAM47883.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
Length=246

 Score =   340 bits (872),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMK +P+F+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLT
Sbjct  181  KKMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLT  240

Query  164  AISERD  147
            AISERD
Sbjct  241  AISERD  246


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQK+VPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKEVPDKLL  61



>ref|NP_001130062.1| uncharacterized protein LOC100191154 [Zea mays]
 gb|ACF78183.1| unknown [Zea mays]
 gb|ACG28463.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG40310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACL54338.1| unknown [Zea mays]
Length=246

 Score =   340 bits (871),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+E+  FRVL+T
Sbjct  173  QEAINFLEKKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEERLFRVLTT  232

Query  188  VEIDEHLTAISERD  147
             EID+HLTAISERD
Sbjct  233  EEIDQHLTAISERD  246



>ref|XP_002870436.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46695.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   339 bits (870),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGV AM+LG+DEE GP L+KCDPAGHF+GHKATSAG+
Sbjct  111  VDILAKWIADKSQVYTQHAYMRPLGVGAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGM  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLEKKMK +PAF+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L
Sbjct  171  KEQEAVNFLEKKMKENPAFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EI+EHLTAISERD
Sbjct  231  TTEEIEEHLTAISERD  246


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_004985490.1| PREDICTED: proteasome subunit alpha type-6-like [Setaria italica]
Length=246

 Score =   339 bits (869),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKKAQLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T
Sbjct  173  QEAINFLEKKMKDDPQFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRALTT  232

Query  188  VEIDEHLTAISERD  147
             EID+HLTAISERD
Sbjct  233  EEIDQHLTAISERD  246



>ref|XP_010441957.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X1 
[Camelina sativa]
 ref|XP_010441958.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X2 
[Camelina sativa]
Length=246

 Score =   339 bits (869),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
             D+LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAGV
Sbjct  111  ADILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGV  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++  FR L
Sbjct  171  KEQEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNRIFRSL  230

Query  194  STVEIDEHLTAISERD  147
             T EI+EHLTAISERD
Sbjct  231  ETEEIEEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|ACN33969.1| unknown [Zea mays]
 tpg|DAA43695.1| TPA: proteasome subunit alpha type [Zea mays]
Length=246

 Score =   339 bits (869),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+
Sbjct  111  VDVLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR++D  FR L
Sbjct  171  KEQEAINFLEKKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKDDRVFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EID+HLTAISERD
Sbjct  231  TTEEIDQHLTAISERD  246



>ref|XP_002465753.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
 gb|EER92751.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
Length=246

 Score =   338 bits (868),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+
Sbjct  111  VDVLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L
Sbjct  171  KEQEAINFLEKKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EID+HLTAISERD
Sbjct  231  TTEEIDQHLTAISERD  246



>ref|NP_001049162.1| Os03g0180400 [Oryza sativa Japonica Group]
 sp|Q9LSU3.1|PSA6_ORYSJ RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Oryza sativa Japonica Group]
 dbj|BAA96829.1| alpha 1 subunit of 20S proteasome [Oryza sativa Japonica Group]
 gb|AAN65435.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|AAO13479.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|ABF94305.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11076.1| Os03g0180400 [Oryza sativa Japonica Group]
 gb|EAY88785.1| hypothetical protein OsI_10259 [Oryza sativa Indica Group]
 gb|EAZ25813.1| hypothetical protein OsJ_09653 [Oryza sativa Japonica Group]
 dbj|BAG94887.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87220.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   338 bits (867),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDHTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KE
Sbjct  113  VLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK+DP FSYEETVQ AISALQSVLQEDFKA+EIE+GVVR++D  FR L+T
Sbjct  173  QEAINFLEKKMKDDPQFSYEETVQIAISALQSVLQEDFKATEIEVGVVRKDDRVFRALTT  232

Query  188  VEIDEHLTAISERD  147
             EID+HLTAISERD
Sbjct  233  EEIDQHLTAISERD  246


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   VTSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_006396131.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
 gb|ESQ36910.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
Length=246

 Score =   338 bits (866),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D
Sbjct  53   QKKVPDKLLDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPAD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FR L T
Sbjct  173  QEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVKADNPIFRSLET  232

Query  188  VEIDEHLTAISERD  147
             EI+EHLTAISERD
Sbjct  233  EEIEEHLTAISERD  246


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_009102355.1| PREDICTED: proteasome subunit alpha type-6-B [Brassica rapa]
 emb|CDY33398.1| BnaA07g04410D [Brassica napus]
 emb|CDY18045.1| BnaC07g04250D [Brassica napus]
Length=246

 Score =   337 bits (865),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D
Sbjct  53   QKKVPDKLLDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPAD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +LA+WIADKSQVYTQHAYMRPLGVVAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ILAKWIADKSQVYTQHAYMRPLGVVAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L T
Sbjct  173  QEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPIFRSLET  232

Query  188  VEIDEHLTAISERD  147
             EI+EHLTAISERD
Sbjct  233  EEIEEHLTAISERD  246


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|NP_001105138.1| maize 20S proteasome alpha subunit [Zea mays]
 emb|CAC19494.1| maize 20S proteasome alpha subunit [Zea mays]
Length=246

 Score =   337 bits (865),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TKY+GLLATG+TAD R+LV QARNEAAEFRF++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKYVGLLATGLTADGRSLVSQARNEAAEFRFKWGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+
Sbjct  111  VDVLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR++D  FR L
Sbjct  171  KEQEAINFLEKKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKDDRVFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EID+HLTAISERD
Sbjct  231  TTEEIDQHLTAISERD  246



>gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidopsis thaliana]
Length=246

 Score =   337 bits (865),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMP
Sbjct  51   VTQKKVPDKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD+LA+WIADKSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+
Sbjct  111  VDILAKWIADKSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGM  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+NFLE++MK +P+F+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L
Sbjct  171  KEQEAVNFLEEEMKGNPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EI+EHLTAISERD
Sbjct  231  TTEEIEEHLTAISERD  246


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|ABF94306.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
Length=286

 Score =   338 bits (868),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  101  LDHTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  160

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  161  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  220

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMK+DP FSYEETVQ AISALQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLT
Sbjct  221  KKMKDDPQFSYEETVQIAISALQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLT  280

Query  164  AISERD  147
            AISERD
Sbjct  281  AISERD  286



>ref|XP_009136197.1| PREDICTED: proteasome subunit alpha type-6-B-like [Brassica rapa]
Length=246

 Score =   337 bits (864),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D
Sbjct  53   QKKVPDKLLDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPAD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +LA+WIADKSQVYTQHAYMRPLGVVAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ILAKWIADKSQVYTQHAYMRPLGVVAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L T
Sbjct  173  QEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPIFRCLET  232

Query  188  VEIDEHLTAISERD  147
             EI+EHLTAISERD
Sbjct  233  EEIEEHLTAISERD  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|AGO97077.1| 20S proteasome alpha [Saccharum hybrid cultivar GT28]
Length=246

 Score =   333 bits (854),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHL P+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLLPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+
Sbjct  111  VDVLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR  
Sbjct  171  KEQEAINFLEKKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRAP  230

Query  194  STVEIDEHLTAISERD  147
            +T EID+HLTAISERD
Sbjct  231  TTEEIDQHLTAISERD  246



>ref|XP_003558667.1| PREDICTED: proteasome subunit alpha type-6 [Brachypodium distachyon]
Length=246

 Score =   331 bits (848),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LD+TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAE+R ++GYEMP
Sbjct  51   VTQKKVPDKLLDETSVTHLFPITKYIGLLATGLTADARSLVSQARNEAAEYRKKWGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA+WIADK+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+
Sbjct  111  VDVLAKWIADKAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMK+ P F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L
Sbjct  171  KEQEAINFLEKKMKDSPQFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRAL  230

Query  194  STVEIDEHLTAISERD  147
            +T EID+HLTAISERD
Sbjct  231  TTEEIDQHLTAISERD  246


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   VTSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|ABK22399.1| unknown [Picea sitchensis]
 gb|ABK25916.1| unknown [Picea sitchensis]
Length=246

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK++GLLATG+TADAR+LVQ ARNEAAEFRF++GYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFIGLLATGMTADARSLVQHARNEAAEFRFKWGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLAR +ADKSQVYTQHAYMRPLGV A++LGIDEE GPQLFKCDPAGHF G+KAT+AGV
Sbjct  111  VDVLARRLADKSQVYTQHAYMRPLGVAAIVLGIDEESGPQLFKCDPAGHFVGYKATAAGV  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KE EA++FLEKK+KN+P  SYEETVQTA+SALQSVLQEDFKA+EIE+GVV ++ P FR L
Sbjct  171  KESEAVSFLEKKLKNNPELSYEETVQTAVSALQSVLQEDFKATEIEVGVVTKDSPVFRTL  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STDEIDEHLTAISERD  246


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDS+CVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSICVVTQKKVPDKLL  61



>gb|EMT09268.1| Proteasome subunit alpha type-6 [Aegilops tauschii]
Length=246

 Score =   328 bits (840),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMK+ P FSY+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLT
Sbjct  181  KKMKDSPQFSYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRSLTTEEIDQHLT  240

Query  164  AISERD  147
            AISERD
Sbjct  241  AISERD  246


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   VTSIGVRGKDSVCVVTQKKVPDKLL  61



>emb|CDY50408.1| BnaC03g45100D [Brassica napus]
Length=244

 Score =   327 bits (838),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 178/194 (92%), Gaps = 2/194 (1%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D
Sbjct  53   QKKVPDKLLDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPAD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +LA+WIADKSQVYTQHAYMRPL  VAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ILAKWIADKSQVYTQHAYMRPL--VAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKE  170

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
            QEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L T
Sbjct  171  QEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPIFRSLET  230

Query  188  VEIDEHLTAISERD  147
             EI+EHLTAISERD
Sbjct  231  EEIEEHLTAISERD  244


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>dbj|BAJ85935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score =   327 bits (837),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMK+ P F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLT
Sbjct  181  KKMKDSPQFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRSLTTEEIDQHLT  240

Query  164  AISERD  147
            AISERD
Sbjct  241  AISERD  246


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            +TSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   VTSIGVRGKDSVCVVTQKKVPDKLL  61



>emb|CDX93103.1| BnaA03g38250D [Brassica napus]
Length=263

 Score =   325 bits (832),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 17/211 (8%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD++SVTHLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D
Sbjct  53   QKKVPDKLLDESSVTHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPAD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGV-----------------VAMILGIDEEKGPQLFKCD  420
            +LA+WIADKSQVYTQHAYMRPLGV                  AM+LG+DEE+GP L+KCD
Sbjct  113  ILAKWIADKSQVYTQHAYMRPLGVGKFCTHFPTYLHIYTSTFAMVLGMDEERGPLLYKCD  172

Query  419  PAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEI  240
            PAGHF+GHKATSAG+KEQEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EI
Sbjct  173  PAGHFYGHKATSAGMKEQEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEI  232

Query  239  EIGVVRQEDPSFRVLSTVEIDEHLTAISERD  147
            E+GVVR ++P FR L T EI+EHLTAISERD
Sbjct  233  EVGVVRADNPIFRCLETEEIEEHLTAISERD  263


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_006452821.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
 gb|ESR66061.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
Length=235

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 167/186 (90%), Gaps = 11/186 (6%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGV           GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGV-----------GPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  169

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KKMKNDP FSYEETVQTA+SALQSVLQEDFKA+EIE+GVVR +D  FRVLS+ EIDEHLT
Sbjct  170  KKMKNDPTFSYEETVQTAVSALQSVLQEDFKATEIEVGVVRSDDRVFRVLSSEEIDEHLT  229

Query  164  AISERD  147
            AISERD
Sbjct  230  AISERD  235


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_001777426.1| predicted protein [Physcomitrella patens]
 gb|EDQ57713.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   313 bits (803),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
             ++ ++K     LDQTSVTHLF VTKY+GLLATG+TADA++L+  ARNEAAEF+F+ GYE
Sbjct  49   CFVTQKKVPDKLLDQTSVTHLFAVTKYIGLLATGMTADAKSLLAHARNEAAEFKFKLGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD LA+ +ADKSQVYTQHAYMRPLGV AM++GID+E+GPQL+KCDPAGH+FG+KATS+
Sbjct  109  IPVDYLAKRLADKSQVYTQHAYMRPLGVSAMLIGIDDEQGPQLYKCDPAGHYFGYKATSS  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G KEQEA+NFLEKKMKNDP  S+E+TVQTAISALQS+L EDFK +EIE+GVVR   P FR
Sbjct  169  GSKEQEAVNFLEKKMKNDPQLSFEDTVQTAISALQSILLEDFKPTEIEVGVVRVGKPEFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +LST EIDEHLTAISERD
Sbjct  229  ILSTEEIDEHLTAISERD  246



>gb|KHG04433.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=226

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 166/196 (85%), Gaps = 20/196 (10%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP
Sbjct  51   VTQKKVPDKLLDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVL++WIADKSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG 
Sbjct  111  VDVLSKWIADKSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGS  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEAINFLEKKMKNDPAF+YEETVQ                    +GVV+ ++P FRV+
Sbjct  171  KEQEAINFLEKKMKNDPAFTYEETVQ--------------------VGVVKADNPVFRVM  210

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  211  STEEIDEHLTAISERD  226


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>ref|XP_002989745.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
 ref|XP_002991751.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ07155.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ09222.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
Length=246

 Score =   311 bits (797),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LDQ+SVTHL+ +T Y+GLLATG+TADAR+LVQ ARNEAAEFR + GYE+P
Sbjct  51   VTQKKVPDKLLDQSSVTHLYAITPYIGLLATGMTADARSLVQHARNEAAEFRHKNGYEIP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD L++ +ADKSQVYTQHAYMRPLGV AMI+ IDEEKGPQLFKCDPAGH+ G++ATSAG+
Sbjct  111  VDFLSKRLADKSQVYTQHAYMRPLGVAAMIIAIDEEKGPQLFKCDPAGHYVGYRATSAGL  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA+N LEKKMKN+P  SY+ETVQTAISALQS+L EDFKA+EIE+G+VR  DP F+++
Sbjct  171  KEQEAVNILEKKMKNNPQLSYDETVQTAISALQSILLEDFKATEIEVGIVRATDPKFQIM  230

Query  194  STVEIDEHLTAISERD  147
            ST EIDEHLTAISERD
Sbjct  231  STEEIDEHLTAISERD  246



>gb|KDO64985.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=164

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  638  ITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILG  459
            +TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM+L 
Sbjct  1    MTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLS  60

Query  458  IDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISAL  279
            IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLEKKMKNDPAF+++ETVQTAIS L
Sbjct  61   IDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTL  120

Query  278  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  147
            QSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  121  QSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  164



>ref|XP_001768229.1| predicted protein [Physcomitrella patens]
 gb|EDQ66843.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   310 bits (793),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
             ++ ++K     LDQTSVTHLF VTK++GLLATG+TADA++L+  ARNEAA F+F  GYE
Sbjct  49   CFVTQKKVPDKLLDQTSVTHLFAVTKFIGLLATGMTADAKSLIAHARNEAANFKFDLGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD LA+ IADKSQVYTQHAYMRPLGV AM++GID+E+GPQL+KCDPAGH+FG+KATS+
Sbjct  109  IPVDYLAKRIADKSQVYTQHAYMRPLGVSAMLIGIDDEQGPQLYKCDPAGHYFGYKATSS  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G KEQEA+NFLEKK+KN+P  SY+ETVQTAISALQS+L EDFK +EIE+GVVR   P FR
Sbjct  169  GSKEQEAVNFLEKKIKNNPQLSYDETVQTAISALQSILLEDFKPTEIEVGVVRAGKPEFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            VLST EIDEHLTAISERD
Sbjct  229  VLSTEEIDEHLTAISERD  246



>ref|XP_001782615.1| predicted protein [Physcomitrella patens]
 gb|EDQ52604.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   306 bits (784),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
             ++ ++K     LDQ SVTHLF +TKY+GLLATG+TADA++LV  ARNEAAEF+F+ GYE
Sbjct  49   CFVTQKKVPDKLLDQASVTHLFAITKYIGLLATGMTADAKSLVAHARNEAAEFKFKLGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD LA+ +AD+SQVYTQHAYMRPLGV AM++GID+E GPQL+KCDPAGH+FG+KATS+
Sbjct  109  IPVDYLAKRLADESQVYTQHAYMRPLGVSAMLIGIDDELGPQLYKCDPAGHYFGYKATSS  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G KEQEA+NFLEKK K++P FSYEETVQ AISALQS+L EDFK +EIE+GVVR   P FR
Sbjct  169  GSKEQEAVNFLEKKCKSNPQFSYEETVQIAISALQSILLEDFKPTEIEVGVVRASKPEFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            VL+T EIDEHLTAISERD
Sbjct  229  VLTTEEIDEHLTAISERD  246



>ref|XP_006426693.1| hypothetical protein CICLE_v100263522mg, partial [Citrus clementina]
 gb|ESR39933.1| hypothetical protein CICLE_v100263522mg, partial [Citrus clementina]
Length=161

 Score =   301 bits (772),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -2

Query  629  DARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDE  450
            DARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM+L IDE
Sbjct  1    DARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDE  60

Query  449  EKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSV  270
            E GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLEKKMKNDPAF+++ETVQTAIS LQSV
Sbjct  61   ECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSV  120

Query  269  LQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  147
            LQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  121  LQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  161



>ref|NP_001031340.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AEC05980.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=220

 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D
Sbjct  53   QKKVPDKLLDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPAD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +LA+WIADKSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KE
Sbjct  113  ILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKE  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEI  234
            QEA+NFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+
Sbjct  173  QEAVNFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEV  217


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSVCVVTQKKVPDKLL  61



>gb|KHN46954.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=560

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVD
Sbjct  53   QKKVPDKLLDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADKSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+
Sbjct  113  VLAKWIADKSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKD  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEI  234
            QEAINFLEKKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+
Sbjct  173  QEAINFLEKKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEM  217


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRGKDS+CVVTQKKVPDKL 
Sbjct  37   ITSIGVRGKDSICVVTQKKVPDKLL  61



>ref|XP_001751730.1| predicted protein [Physcomitrella patens]
 gb|EDQ83165.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   286 bits (733),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD++SVTHLF VTK +GLLATG+T DA++LV  AR EAAEFRF+ GYE+PVD LA+ +AD
Sbjct  61   LDRSSVTHLFVVTKRIGLLATGMTGDAKSLVAGARAEAAEFRFKMGYEIPVDYLAKRLAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            KSQVYTQHAYMRPLGV AM +G+D+E GP+L+KCDPAGHF G+KATS+G KEQEA+N L+
Sbjct  121  KSQVYTQHAYMRPLGVSAMFIGMDDEHGPRLYKCDPAGHFVGYKATSSGAKEQEAVNILD  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KK+K++P  SY+ETVQTAI ALQS+L EDFK +EIE+GVV Q DP+FR+L+T +ID+HLT
Sbjct  181  KKLKHNPQLSYDETVQTAICALQSILLEDFKPTEIEVGVVSQADPNFRLLTTEDIDDHLT  240

Query  164  AISERD  147
            +ISERD
Sbjct  241  SISERD  246


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -1

Query  777  ITSIGVRGKDSVCVVTQKKVPDKLF  703
            ITSIGVRG+DSVCVVTQKKVPDKL 
Sbjct  37   ITSIGVRGRDSVCVVTQKKVPDKLL  61



>ref|XP_001691723.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
 gb|EDP04831.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
Length=249

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 166/202 (82%), Gaps = 4/202 (2%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V++ ++K +   +D TSVT LF +TK++G+L TG+ AD R +VQQAR +AA+FRF++GYE
Sbjct  48   VFVTQKKVQDKLIDPTSVTRLFKITKFIGMLVTGLPADTRAIVQQARQQAADFRFKFGYE  107

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD LA+ +ADK+QVYTQHAYMRPLGVV+M++G+DEE+GPQLFK DPAG++ G+KATS 
Sbjct  108  VPVDYLAKVLADKAQVYTQHAYMRPLGVVSMLIGVDEERGPQLFKVDPAGYYVGYKATSV  167

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQ----ED  213
            GVKE EA NFLEKK K++P F+Y+E V TAI+ALQ VL E+FK+S++E+GVVR      D
Sbjct  168  GVKETEANNFLEKKFKSNPQFTYDEAVTTAIAALQGVLSEEFKSSDLEVGVVRAGSEGGD  227

Query  212  PSFRVLSTVEIDEHLTAISERD  147
             SFRVL+T E+D +LT ISERD
Sbjct  228  GSFRVLTTEEVDHYLTIISERD  249



>ref|XP_002949740.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
 gb|EFJ49292.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
Length=249

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V++ ++K +   +D TSVT LF +TKY+G+L TG+ AD R +VQQAR +AA+FRF++GYE
Sbjct  48   VFVTQKKVQDKLIDPTSVTRLFKITKYVGMLVTGLPADTRAIVQQARQQAADFRFKFGYE  107

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD LA+ +ADK+QVYTQHAYMRPLGV++M++GIDEE+GPQLFK DPAG++ G+KAT+ 
Sbjct  108  VPVDYLAKVLADKAQVYTQHAYMRPLGVISMLIGIDEERGPQLFKVDPAGYYVGYKATAV  167

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQ----ED  213
            GVKE EA NFLEKK+K +PA SY+E V TAISALQ VL E+FKA+++E+GVVR      D
Sbjct  168  GVKETEAHNFLEKKLKGNPALSYDEAVITAISALQGVLSEEFKAADLEVGVVRNGPDGSD  227

Query  212  PSFRVLSTVEIDEHLTAISERD  147
             +FRVL+T E+D  LT ISERD
Sbjct  228  RAFRVLTTEEVDHFLTIISERD  249



>gb|AFW89473.1| hypothetical protein ZEAMMB73_334376 [Zea mays]
Length=214

 Score =   266 bits (680),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 149/194 (77%), Gaps = 32/194 (16%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVD
Sbjct  53   QKKVPDKLLDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            VLA+WIADK+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHK        
Sbjct  113  VLAKWIADKAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHK--------  164

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
                                     AISALQSVLQEDFKA+EIE+GVVR+E+  FRVL+T
Sbjct  165  ------------------------IAISALQSVLQEDFKATEIEVGVVRKEERLFRVLTT  200

Query  188  VEIDEHLTAISERD  147
             EID+HLTAISERD
Sbjct  201  EEIDQHLTAISERD  214



>ref|NP_001150310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG38611.1| proteasome subunit alpha type 6 [Zea mays]
 tpg|DAA63585.1| TPA: proteasome subunit alpha type 6 [Zea mays]
Length=285

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD TSV+ LFP+T  LGLLATGI  + R L  +ARN+ AEFRF +GYEMP DVLA+WIAD
Sbjct  81   LDMTSVSRLFPITDRLGLLATGIAGEGRALAHEARNQTAEFRFNWGYEMPPDVLAQWIAD  140

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKG-PQLFKCDPAGHFFGHKATSAGVKEQEAINFL  348
            ++Q++TQ+   RP GVVAMILGID+EKG PQLF CDPAG+FFGHKA SAG ++ EA+NFL
Sbjct  141  RAQIWTQYVSKRPSGVVAMILGIDDEKGTPQLFTCDPAGYFFGHKAASAGQRDTEAVNFL  200

Query  347  EKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHL  168
            EKKMKN+P+  ++ET+Q AISALQ  L+ D KASE+E+GVVR +DP+FRVL+  EIDEHL
Sbjct  201  EKKMKNNPSLPFQETIQMAISALQFALKADLKASEVEVGVVRTDDPTFRVLTEAEIDEHL  260

Query  167  TAIS  156
             AI+
Sbjct  261  EAIN  264



>ref|XP_005648429.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
 gb|EIE23885.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
Length=247

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     +D +SVTH+F +TK++G+LATG  ADAR+LVQ++R+ AAEFR  YGYE+P
Sbjct  51   VTQKKVPDKLIDPSSVTHMFKITKFIGMLATGQRADARSLVQKSRSIAAEFRHTYGYEIP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD LA  +AD++QVYTQHAYMRPL VV ++ GIDEE GPQLFK DPAG++ G+KATSAG 
Sbjct  111  VDYLAARLADQAQVYTQHAYMRPLAVVLILAGIDEEAGPQLFKVDPAGYYVGYKATSAGA  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVR-QEDPSFRV  198
            K+QEA NFLEK+ K +P FS+EET QTAI+ALQSVL EDFKASEIE+GVVR  E   FRV
Sbjct  171  KDQEADNFLEKRFKGNPEFSFEETAQTAIAALQSVLAEDFKASEIEVGVVRASEGGVFRV  230

Query  197  LSTVEIDEHLTAISERD  147
            L   E+++HL+AISERD
Sbjct  231  LGVEEVEDHLSAISERD  247



>gb|KDD75255.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=248

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V++ ++K     +D +S+T+++ +T   GLL TG+  DAR+LV +AR+EAAEFRF+YGYE
Sbjct  49   VFVSQKKVPDKMVDASSITNIYKITACTGLLVTGMHGDARSLVHKARSEAAEFRFKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            MPVDVLAR +AD++QV+TQHAYMRPLGV+A I+G+DEE+GPQLFK DPAG+F G+KAT+A
Sbjct  109  MPVDVLARVLADQAQVHTQHAYMRPLGVIATIIGVDEERGPQLFKVDPAGYFVGYKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVV--RQEDPS  207
            GVKEQEAIN LEK+ K++P ++ ++T+Q AI  LQ VL ED KA+++E+GV   R    S
Sbjct  169  GVKEQEAINALEKRFKSNPEYTLDQTIQAAIEILQDVLGEDLKATDVEVGVAERRNAMSS  228

Query  206  FRVLSTVEIDEHLTAISER  150
            FR L   EI EH+ A++ER
Sbjct  229  FRTLPVSEIAEHVIALAER  247



>ref|XP_005843942.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
 gb|EFN51840.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
Length=246

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
             ++ +RK      D +SVT +  +TK +G+L TG+  DAR+L+Q+AR+EAAEFRF++GYE
Sbjct  48   CFVTQRKVPDKLTDPSSVTQIHSITKNIGMLLTGMHGDARSLMQKARSEAAEFRFKFGYE  107

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            MPV  LAR +AD++QVYTQHAYMRPLGV+ +++ IDEE+GPQLFK DPAG+F G+KAT+A
Sbjct  108  MPVHYLARVLADQAQVYTQHAYMRPLGVIPILIAIDEERGPQLFKVDPAGYFVGYKATAA  167

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPS-F  204
            GVKE EA+N LEKK K  P +S +E V+ AIS LQ VL ED K S+IE+G+   +D   F
Sbjct  168  GVKETEAVNMLEKKFKTGPQYSQKEVVELAISTLQHVLGEDLKVSDIEVGLASAQDGGRF  227

Query  203  RVLSTVEIDEHLTAISERD  147
            RVLS  E++EHL AISERD
Sbjct  228  RVLSCEELEEHLVAISERD  246



>gb|ABR17363.1| unknown [Picea sitchensis]
Length=138

 Score =   241 bits (615),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            MPVDVLAR +ADKSQVYTQHAYMRPLGV A++LGIDEE GPQLFKCDPAGHF G+KAT+A
Sbjct  1    MPVDVLARRLADKSQVYTQHAYMRPLGVAAIVLGIDEESGPQLFKCDPAGHFVGYKATAA  60

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVKE EA++FLEKK+KN+P  SYEETVQTA+SALQSVLQEDFKA+EIE+GVV ++ P FR
Sbjct  61   GVKESEAVSFLEKKLKNNPELSYEETVQTAVSALQSVLQEDFKATEIEVGVVTKDSPVFR  120

Query  200  VLSTVEIDEHLTAISERD  147
             LST EIDEHLTAISERD
Sbjct  121  TLSTDEIDEHLTAISERD  138



>ref|NP_989113.1| proteasome subunit alpha type-6 [Xenopus (Silurana) tropicalis]
 gb|AAH61438.1| proteasome (prosome, macropain) subunit, alpha type 6 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81265.1| proteasome (prosome macropain) subunit alpha type 6 [Xenopus 
(Silurana) tropicalis]
Length=246

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + +RK     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQRKVPDKLLDSNTVTHLFRITESIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++YE+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATTAGVKQTEATSFLEKKVKKKLDWTYEQTLETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  EDP FRVL+  EID HL A++ERD
Sbjct  220  VTVEDPKFRVLTEAEIDVHLVALAERD  246



>gb|ESA18832.1| hypothetical protein GLOINDRAFT_344383 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71315.1| proteasome core particle subunit alpha 1 [Rhizophagus irregularis 
DAOM 197198w]
Length=245

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD ++VTH+F ++ Y+G + TG+ ADAR  V +AR EAAEFR+++GY 
Sbjct  48   VIVTQKKIPDKLLDPSTVTHMFQLSPYVGCVMTGLIADARAQVTRARQEAAEFRYKFGYY  107

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            MP D+LA+ +A+ +QVYTQHA MRPLGV  +++G D+E+GPQLFKCDPAG++ G+KAT+A
Sbjct  108  MPSDMLAKRVANINQVYTQHAAMRPLGVSMILIGYDDERGPQLFKCDPAGYYVGYKATAA  167

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+QEA+N LEKK+K DP   +EETV+ AI+ L SVL  DFK++EIE+ VV ++DP FR
Sbjct  168  GAKQQEALNHLEKKLKKDPVLDFEETVELAINTLSSVLSADFKSTEIEVAVVTKDDPKFR  227

Query  200  VLSTVEIDEHLTAISERD  147
             LS  EID+HL  I E+D
Sbjct  228  TLSINEIDDHLQRIVEKD  245



>ref|XP_004773397.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Mustela 
putorius furo]
 ref|XP_004820514.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Mustela 
putorius furo]
 ref|XP_005623383.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Canis 
lupus familiaris]
Length=227

 Score =   241 bits (616),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  21   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  80

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  81   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  140

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  141  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  200

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+LS  EID HL A++ERD
Sbjct  201  VTVENPKFRILSEAEIDAHLVALAERD  227



>emb|CAA43964.1| macropain subunit iota [Homo sapiens]
Length=221

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  15   VAVRGKDCAVIVTQKKVPDCLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  74

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  75   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  134

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  135  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  194

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  195  VTVENPKFRILTEAEIDAHLVALAERD  221



>ref|XP_006835407.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysochloris 
asiatica]
Length=246

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+I+FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESISFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDTHLVALAERD  246



>ref|XP_006240160.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Rattus 
norvegicus]
Length=227

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  21   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  80

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  81   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  140

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  141  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  200

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  201  VTVENPKFRILTEAEIDAHLVALAERD  227



>ref|XP_004681994.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Condylura 
cristata]
Length=227

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  21   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  80

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  81   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  140

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  141  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  200

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  201  VTVENPKFRILTEAEIDAHLVALAERD  227



>ref|XP_006515947.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mus musculus]
Length=227

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  21   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAA  80

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  81   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  140

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  141  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  200

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  201  VTVENPKFRILTEAEIDAHLVALAERD  227



>gb|KFZ47806.1| Proteasome subunit alpha type-6, partial [Caprimulgus carolinensis]
Length=221

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE
Sbjct  24   VIVTQKKVPDKLLDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYE  83

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  84   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  143

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  144  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  203

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  204  ILTEAEIDAHLVALAERD  221



>ref|NP_001088418.1| uncharacterized protein LOC495277 [Xenopus laevis]
 gb|AAH84423.1| LOC495277 protein [Xenopus laevis]
Length=246

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + +RK     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQRKVPDKLLDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++Y +T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATTAGVKQTEATSFLEKKVKKKLDWTYGQTLETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  +DP FRVL+  EID HL A++ERD
Sbjct  220  VTVQDPKFRVLTEAEIDTHLVALAERD  246



>ref|XP_007119013.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Physeter 
catodon]
 ref|XP_007119014.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Physeter 
catodon]
Length=236

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  30   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  89

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  90   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  149

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  150  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  209

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  210  VTVENPKFRILTEAEIDAHLVALAERD  236



>ref|XP_010631916.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Fukomys 
damarensis]
Length=229

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  23   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  82

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  83   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  142

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  143  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  202

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  203  VTVENPKFRILTEAEIDAHLVALAERD  229



>ref|XP_005376981.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Chinchilla 
lanigera]
Length=229

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  23   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  82

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  83   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  142

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  143  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  202

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  203  VTVENPKFRILTEAEIDAHLVALAERD  229



>ref|NP_001269163.1| proteasome subunit alpha type-6 isoform c [Homo sapiens]
 gb|EAW65876.1| proteasome (prosome, macropain) subunit, alpha type, 6, isoform 
CRA_a [Homo sapiens]
 dbj|BAG63411.1| unnamed protein product [Homo sapiens]
Length=227

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  21   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  80

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  81   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  140

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  141  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  200

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  201  VTVENPKFRILTEAEIDAHLVALAERD  227



>ref|XP_004436463.1| PREDICTED: proteasome subunit alpha type-6 isoform 2 [Ceratotherium 
simum simum]
Length=236

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF VT+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  30   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKVTENIGCVMTGMTADSRSQVQRARYEAA  89

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  90   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  149

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  150  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  209

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  210  VTVENPKFRILTEAEIDAHLVALAERD  236



>ref|XP_004270017.1| PREDICTED: proteasome subunit alpha type-6 isoform 2 [Orcinus 
orca]
 ref|XP_004319608.1| PREDICTED: proteasome subunit alpha type-6 isoform 2 [Tursiops 
truncatus]
Length=236

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  30   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  89

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  90   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  149

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  150  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  209

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  210  VTVENPKFRILTEAEIDAHLVALAERD  236



>ref|XP_005656350.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Sus scrofa]
Length=227

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  21   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  80

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  81   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  140

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  141  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  200

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  201  VTVENPKFRILTEAEIDAHLVALAERD  227



>ref|XP_007464885.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Lipotes 
vexillifer]
Length=236

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  30   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  89

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  90   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  149

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  150  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  209

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  210  VTVENPKFRILTEAEIDAHLVALAERD  236



>ref|XP_004055136.1| PREDICTED: proteasome subunit alpha type-6-like, partial [Gorilla 
gorilla gorilla]
Length=235

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  29   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  88

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  89   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  148

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  149  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  208

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  209  VTVENPKFRILTEAEIDAHLVALAERD  235



>ref|XP_537412.2| PREDICTED: proteasome subunit alpha type-6 isoformX2 [Canis lupus 
familiaris]
 ref|XP_002922862.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_004399857.1| PREDICTED: proteasome subunit alpha type-6 [Odobenus rosmarus 
divergens]
 ref|XP_004773396.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_004820513.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_005080563.1| PREDICTED: proteasome subunit alpha type-6 [Mesocricetus auratus]
 ref|XP_005343781.1| PREDICTED: proteasome subunit alpha type-6 [Microtus ochrogaster]
 ref|XP_006732281.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006891612.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Elephantulus 
edwardii]
 ref|XP_003509963.2| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Cricetulus 
griseus]
 ref|XP_007632099.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Cricetulus 
griseus]
 ref|XP_008692325.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ursus 
maritimus]
 gb|ERE72544.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=246

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+LS  EID HL A++ERD
Sbjct  220  VTVENPKFRILSEAEIDAHLVALAERD  246



>ref|XP_003059392.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56524.1| predicted protein [Micromonas pusilla CCMP1545]
Length=249

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 148/189 (78%), Gaps = 3/189 (2%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            +D   VTH+F +TK +G+ ATG + D R +VQ+AR++AAEFR  +GYE+PVD L+  +AD
Sbjct  61   VDPADVTHMFKITKVIGMCATGKSPDIRNVVQKARHKAAEFRHEFGYEIPVDFLSTRMAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            + QVYTQHAYMRP+  + M +GIDEEKGP LFK DPAG+  G+KATSAGVKEQEAINFLE
Sbjct  121  EFQVYTQHAYMRPMAAMCMFVGIDEEKGPCLFKNDPAGYCVGYKATSAGVKEQEAINFLE  180

Query  344  KKMKND---PAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDE  174
            KK+K +    AF   ET+QTAIS LQSVL ED K+ E+E+G+V  E+ +FR+LS+  I+E
Sbjct  181  KKVKGENAGNAFDETETIQTAISCLQSVLGEDLKSKELEVGIVTTENKNFRLLSSDVIEE  240

Query  173  HLTAISERD  147
            HLTAISERD
Sbjct  241  HLTAISERD  249



>gb|KFO90954.1| Proteasome subunit alpha type-6, partial [Buceros rhinoceros 
silvestris]
 gb|KFP26112.1| Proteasome subunit alpha type-6, partial [Colius striatus]
Length=222

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  EDP FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVEDPKFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDVHLVALAERD  222



>ref|XP_004436462.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Ceratotherium 
simum simum]
Length=246

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF VT+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKVTENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_002824717.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pongo 
abelii]
Length=246

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_005842332.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
 gb|EKX55352.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
Length=252

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -2

Query  719  SRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLA  540
            S+   LD +SVTH++ VT+ +G + TG  ADAR  +Q+ R EAA+FR++YGY+MP +VLA
Sbjct  61   SQDKLLDPSSVTHMYRVTETIGCVQTGHQADARAQIQRVRQEAAQFRYKYGYDMPPEVLA  120

Query  539  RWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEA  360
            + +AD +QVYTQHA MRP GV  M+ G+D+EKGPQLF CDPAGH+ G+KA +AG K+ EA
Sbjct  121  KRVADMNQVYTQHAGMRPYGVTMMLCGMDDEKGPQLFMCDPAGHYLGYKAVAAGQKDLEA  180

Query  359  INFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPS-FRVLSTVE  183
             N LEKK+KN P  SY+ET+Q AI+ LQSVL  DFK S+IE+GVV +++   FR L   E
Sbjct  181  KNMLEKKLKNSPTLSYDETIQMAITVLQSVLSADFKCSDIEVGVVNKDNKGRFRQLDEAE  240

Query  182  IDEHLTAISERD  147
            I+ HL AISERD
Sbjct  241  IERHLVAISERD  252



>gb|EDL36728.1| proteasome (prosome, macropain) subunit, alpha type 6, isoform 
CRA_b [Mus musculus]
Length=251

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  45   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAA  104

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  105  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  164

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  165  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  224

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  225  VTVENPKFRILTEAEIDAHLVALAERD  251



>gb|KFO63713.1| Proteasome subunit alpha type-6, partial [Corvus brachyrhynchos]
Length=222

 Score =   239 bits (609),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 155/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDVHLVALAERD  222



>ref|XP_004698589.1| PREDICTED: proteasome subunit alpha type-6 [Echinops telfairi]
 ref|XP_006085896.1| PREDICTED: proteasome subunit alpha type-6 [Myotis lucifugus]
 ref|XP_006759764.1| PREDICTED: proteasome subunit alpha type-6 [Myotis davidii]
 ref|XP_008157203.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eptesicus 
fuscus]
 gb|ELK33263.1| Proteasome subunit alpha type-6 [Myotis davidii]
Length=246

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDTHLVALAERD  246



>ref|XP_001095366.1| PREDICTED: proteasome subunit alpha type-6-like isoform 1 [Macaca 
mulatta]
 ref|XP_001095483.1| PREDICTED: proteasome subunit alpha type-6-like isoform 2 [Macaca 
mulatta]
Length=246

 Score =   239 bits (611),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|NP_058979.1| proteasome subunit alpha type-6 [Rattus norvegicus]
 ref|NP_002782.1| proteasome subunit alpha type-6 isoform a [Homo sapiens]
 ref|NP_001039427.1| proteasome subunit alpha type-6 [Bos taurus]
 ref|NP_001180482.1| proteasome subunit alpha type-6 [Macaca mulatta]
 ref|NP_001233586.1| proteasome subunit alpha type-6 [Pan troglodytes]
 ref|NP_001271993.1| uncharacterized protein LOC101866963 [Macaca fascicularis]
 ref|NP_001272627.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Capra 
hircus]
 ref|XP_001491320.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Equus caballus]
 ref|XP_002718187.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_003408905.1| PREDICTED: proteasome subunit alpha type-6 [Loxodonta africana]
 ref|XP_003792017.1| PREDICTED: proteasome subunit alpha type-6 [Otolemur garnettii]
 ref|XP_003821244.1| PREDICTED: proteasome subunit alpha type-6 [Pan paniscus]
 ref|XP_003987590.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Felis 
catus]
 ref|XP_004270016.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Orcinus 
orca]
 ref|XP_004319607.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Tursiops 
truncatus]
 ref|XP_004376568.1| PREDICTED: proteasome subunit alpha type-6 [Trichechus manatus 
latirostris]
 ref|XP_004681993.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Condylura 
cristata]
 ref|XP_004884716.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_004867614.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_005376980.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005891864.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Bos mutus]
 ref|XP_006186437.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Camelus 
ferus]
 ref|XP_006212818.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Vicugna 
pacos]
 ref|XP_006913536.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus alecto]
 ref|XP_007073792.1| PREDICTED: proteasome subunit alpha type-6 [Panthera tigris altaica]
 ref|XP_007119012.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Physeter 
catodon]
 ref|XP_006043909.1| PREDICTED: proteasome subunit alpha type-6 [Bubalus bubalis]
 ref|XP_007464884.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007936738.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Orycteropus 
afer afer]
 ref|XP_007984674.1| PREDICTED: proteasome subunit alpha type-6 [Chlorocebus sabaeus]
 ref|XP_008069643.1| PREDICTED: proteasome subunit alpha type-6 [Tarsius syrichta]
 ref|XP_008511175.1| PREDICTED: proteasome subunit alpha type-6 [Equus przewalskii]
 ref|XP_008572098.1| PREDICTED: proteasome subunit alpha type-6 [Galeopterus variegatus]
 ref|XP_008831132.1| PREDICTED: proteasome subunit alpha type-6 [Nannospalax galili]
 ref|XP_010631915.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Fukomys 
damarensis]
 ref|XP_010833601.1| PREDICTED: proteasome subunit alpha type-6 [Bison bison bison]
 ref|XP_010966161.1| PREDICTED: proteasome subunit alpha type-6 [Camelus bactrianus]
 ref|XP_010984427.1| PREDICTED: proteasome subunit alpha type-6 [Camelus dromedarius]
 ref|XP_011374978.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus vampyrus]
 sp|P60901.1|PSA6_RAT RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Rattus norvegicus]
 sp|P60900.1|PSA6_HUMAN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=27 
kDa prosomal protein; Short=PROS-27; Short=p27K; AltName: 
Full=Macropain iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota 
chain [Homo sapiens]
 sp|Q2YDE4.1|PSA6_BOVIN RecName: Full=Proteasome subunit alpha type-6 [Bos taurus]
 pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|O Chain O, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 emb|CAA42052.1| prosomal P27K protein [Homo sapiens]
 dbj|BAA01587.1| proteasome subunit R-IOTA [Rattus sp.]
 gb|AAH02979.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH17882.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH22354.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH23659.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH62232.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 gb|AAH70137.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 emb|CAG33225.1| PSMA6 [Homo sapiens]
 dbj|BAE01337.1| unnamed protein product [Macaca fascicularis]
 gb|AAI10261.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Bos taurus]
 gb|EAW65877.1| proteasome (prosome, macropain) subunit, alpha type, 6, isoform 
CRA_b [Homo sapiens]
 gb|ABM83272.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 gb|EDM03426.1| proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 dbj|BAG35846.1| unnamed protein product [Homo sapiens]
 gb|ACM47241.1| proteasome subunit alpha type 6 [Capra hircus]
 dbj|BAI46667.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 tpg|DAA17455.1| TPA: proteasome subunit alpha type-6 [Bos taurus]
 dbj|BAK63685.1| proteasome subunit alpha type 6 [Pan troglodytes]
 gb|EHB02978.1| Proteasome subunit alpha type-6 [Heterocephalus glaber]
 gb|EHH27823.1| hypothetical protein EGK_18113 [Macaca mulatta]
 gb|EHH63557.1| hypothetical protein EGM_16549 [Macaca fascicularis]
 gb|ELK11320.1| Proteasome subunit alpha type-6 [Pteropus alecto]
 gb|ELR59203.1| Proteasome subunit alpha type-6 [Bos mutus]
 gb|AIC63124.1| PSMA6, partial [synthetic construct]
 gb|KFO29294.1| Proteasome subunit alpha type-6 [Fukomys damarensis]
 prf||1912298A prosomal RNA-binding protein p27K
Length=246

 Score =   239 bits (611),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|NP_036098.1| proteasome subunit alpha type-6 [Mus musculus]
 ref|XP_010383847.1| PREDICTED: proteasome subunit alpha type-6 [Rhinopithecus roxellana]
 sp|Q9QUM9.1|PSA6_MOUSE RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Mus musculus]
 pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|U Chain U, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|II Chain i, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|WW Chain w, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|G Chain G, Mouse Constitutive 20s Proteasome
 pdb|3UNE|U Chain U, Mouse Constitutive 20s Proteasome
 pdb|3UNE|II Chain i, Mouse Constitutive 20s Proteasome
 pdb|3UNE|WW Chain w, Mouse Constitutive 20s Proteasome
 pdb|3UNF|G Chain G, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|U Chain U, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|G Chain G, Mouse 20s Immunoproteasome
 pdb|3UNH|U Chain U, Mouse 20s Immunoproteasome
 gb|AAD50532.1|AF060087_1 proteasome subunit iota [Mus musculus]
 gb|AAF21459.1|U60288_1 proteasome subunit iota [Mus musculus]
 dbj|BAC40169.1| unnamed protein product [Mus musculus]
 dbj|BAE31592.1| unnamed protein product [Mus musculus]
 gb|AAH86685.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Mus musculus]
Length=246

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_004649175.1| PREDICTED: proteasome subunit alpha type-6 [Jaculus jaculus]
Length=246

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+LS  EID HL A++ERD
Sbjct  220  VTVDNPKFRILSEAEIDTHLVALAERD  246



>ref|XP_005014711.1| PREDICTED: proteasome subunit alpha type-6, partial [Anas platyrhynchos]
Length=222

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSNTVTHLFSITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDVHLVALAERD  222



>ref|XP_004470220.1| PREDICTED: proteasome subunit alpha type-6 [Dasypus novemcinctus]
Length=246

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTIENPKFRILTEAEIDAHLVALAERD  246



>gb|KFP89006.1| Proteasome subunit alpha type-6, partial [Apaloderma vittatum]
 gb|KFQ33586.1| Proteasome subunit alpha type-6, partial [Mesitornis unicolor]
 gb|KFQ88161.1| Proteasome subunit alpha type-6, partial [Phoenicopterus ruber 
ruber]
 gb|KFW81906.1| Proteasome subunit alpha type-6, partial [Manacus vitellinus]
 gb|KFW90363.1| Proteasome subunit alpha type-6, partial [Phalacrocorax carbo]
Length=222

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDVHLVALAERD  222



>ref|XP_008267725.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Oryctolagus 
cuniculus]
Length=264

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  58   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  117

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  118  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  177

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  178  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  237

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  238  VTVENPKFRILTEAEIDAHLVALAERD  264



>gb|KFR01991.1| Proteasome subunit alpha type-6, partial [Opisthocomus hoazin]
Length=222

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 155/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P+FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPNFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDVHLVALAERD  222



>ref|XP_007180773.1| PREDICTED: proteasome subunit alpha type-6 [Balaenoptera acutorostrata 
scammoni]
Length=246

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDVHLVALAERD  246



>ref|XP_005047359.1| PREDICTED: proteasome subunit alpha type-6, partial [Ficedula 
albicollis]
Length=226

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  29   VIVTQKKVPDKLLDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  88

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  89   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  148

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  149  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  208

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  209  ILTEAEIDVHLVALAERD  226



>ref|XP_005158685.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Danio 
rerio]
 gb|AAH55520.1| Psma6a protein [Danio rerio]
 gb|AAI64827.1| Psma6a protein [Danio rerio]
Length=246

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + +RK     LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVITQRKVPDKLLDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVVGVDEELGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++++TV+TAIS L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKIKKKLDWTFDQTVETAISCLSTVLAIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+LS  EID HL A++ERD
Sbjct  220  VTTEEPKFRILSESEIDTHLMALTERD  246



>ref|XP_005865030.1| PREDICTED: proteasome subunit alpha type-6 [Myotis brandtii]
 gb|EPQ06979.1| Proteasome subunit alpha type-6 [Myotis brandtii]
Length=246

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG 
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGS  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDTHLVALAERD  246



>gb|KFV43324.1| Proteasome subunit alpha type-6, partial [Tyto alba]
Length=222

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDMHLVALAERD  222



>ref|NP_001132918.1| proteasome subunit alpha type-6 [Ovis aries]
 gb|ACI46679.1| proteasome subunit alpha type 6 [Ovis aries]
Length=246

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQSAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_006172412.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, alpha type, 6 [Tupaia chinensis]
Length=246

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK  E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKXTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_003924255.1| PREDICTED: proteasome subunit alpha type-6 [Saimiri boliviensis 
boliviensis]
Length=283

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  77   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  136

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  137  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  196

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  197  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  256

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  257  VTVENPKFRILTEAEIDAHLVALAERD  283



>gb|EMC83847.1| Proteasome subunit alpha type-6, partial [Columba livia]
 gb|KFM02429.1| Proteasome subunit alpha type-6, partial [Aptenodytes forsteri]
 gb|KFO12524.1| Proteasome subunit alpha type-6, partial [Balearica regulorum 
gibbericeps]
 gb|KFO78195.1| Proteasome subunit alpha type-6, partial [Cuculus canorus]
 gb|KFO97178.1| Proteasome subunit alpha type-6, partial [Calypte anna]
 gb|KFP41949.1| Proteasome subunit alpha type-6, partial [Chlamydotis macqueenii]
 gb|KFP68093.1| Proteasome subunit alpha type-6, partial [Cariama cristata]
 gb|KFQ10797.1| Proteasome subunit alpha type-6, partial [Haliaeetus albicilla]
 gb|KFQ13409.1| Proteasome subunit alpha type-6, partial [Leptosomus discolor]
 gb|KFQ48093.1| Proteasome subunit alpha type-6, partial [Nestor notabilis]
 gb|KFQ52159.1| Proteasome subunit alpha type-6, partial [Pelecanus crispus]
 gb|KFQ72088.1| Proteasome subunit alpha type-6, partial [Phaethon lepturus]
 gb|KFV18823.1| Proteasome subunit alpha type-6, partial [Tauraco erythrolophus]
 gb|KFV43399.1| Proteasome subunit alpha type-6, partial [Gavia stellata]
 gb|KFV79271.1| Proteasome subunit alpha type-6, partial [Struthio camelus australis]
 gb|KFW08157.1| Proteasome subunit alpha type-6, partial [Fulmarus glacialis]
 gb|KFW63854.1| Proteasome subunit alpha type-6, partial [Pygoscelis adeliae]
 gb|KGL82190.1| Proteasome subunit alpha type-6, partial [Tinamus guttatus]
 gb|KGL94893.1| Proteasome subunit alpha type-6, partial [Charadrius vociferus]
Length=222

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDVHLVALAERD  222



>ref|XP_009288678.1| PREDICTED: proteasome subunit alpha type-6 [Aptenodytes forsteri]
Length=224

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  27   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  86

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  87   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  146

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  147  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  206

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  207  ILTEAEIDVHLVALAERD  224



>gb|ABM86477.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
Length=246

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++E+D
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAEKD  246



>gb|KFQ31740.1| Proteasome subunit alpha type-6, partial [Merops nubicus]
Length=226

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  29   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  88

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  89   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  148

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  149  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  208

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  209  ILTEAEIDVHLVALAERD  226



>ref|NP_001264372.1| proteasome subunit alpha type-6 [Gallus gallus]
 ref|XP_003206625.1| PREDICTED: proteasome subunit alpha type-6 [Meleagris gallopavo]
Length=246

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  49   VIVTQKKVPDKLLDSNTVTHLFSITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  169  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  229  ILTETEIDMHLVALAERD  246



>ref|XP_002500811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62069.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 151/199 (76%), Gaps = 3/199 (2%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     LD T +TH+F +TK +GL ATG   D R +VQ+AR+ AAEFR  YGYE+P
Sbjct  93   VTQKKIPDKLLDPTDITHMFKITKTIGLCATGKLPDIRNVVQKARHTAAEFRHEYGYEIP  152

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VD L+  +AD  QVYTQHAYMRP+  + M +GIDEE+GP L+K DPAG+F G+KATSAG 
Sbjct  153  VDYLSCKLADWFQVYTQHAYMRPMAAMCMFVGIDEERGPSLYKNDPAGYFVGYKATSAGA  212

Query  374  KEQEAINFLEKKMKNDPA---FSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSF  204
            KEQEAINFLEKK+K   A   F+ +ETV+TAI+ LQ+VL ED KA E+E+G+V  +DP+F
Sbjct  213  KEQEAINFLEKKVKGKDAGNTFTEQETVRTAIACLQTVLGEDLKARELEVGIVTVDDPNF  272

Query  203  RVLSTVEIDEHLTAISERD  147
            R+LS   I++HLTAISERD
Sbjct  273  RLLSETAIEDHLTAISERD  291



>gb|KFQ96181.1| Proteasome subunit alpha type-6, partial [Nipponia nippon]
Length=233

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  36   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  95

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  96   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  155

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  156  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  215

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  216  ILTEAEIDVHLVALAERD  233



>ref|XP_006985315.1| PREDICTED: proteasome subunit alpha type-6 [Peromyscus maniculatus 
bairdii]
Length=246

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GID E+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDGEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+LS  EID HL A++ERD
Sbjct  220  VTVENPKFRILSEAEIDAHLVALAERD  246



>ref|XP_005965384.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Pantholops 
hodgsonii]
Length=279

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  73   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  132

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  133  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  192

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  193  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  252

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  253  VTVENPKFRILTEAEIDAHLVALAERD  279



>ref|NP_001232198.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
 ref|XP_005479894.1| PREDICTED: proteasome subunit alpha type-6 [Zonotrichia albicollis]
 ref|XP_005520349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Pseudopodoces 
humilis]
 gb|ACH43691.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
Length=246

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  49   VIVTQKKVPDKLLDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  169  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  229  ILTEAEIDVHLVALAERD  246



>ref|NP_001086785.1| proteasome alpha 6 subunit [Xenopus laevis]
 gb|AAH77442.1| Psma6-prov protein [Xenopus laevis]
 dbj|BAD42870.1| 20S proteasome alpha1 subunit [Xenopus laevis]
Length=246

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + +RK     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQRKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + +AD SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRMADISQVYTQNAEMRPLGCCMILIGVDEEHGPQVFKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++YE+T++TAIS L +VL  DFK SE+E+ V
Sbjct  160  YCGFKATTAGVKQTEATSFLEKKVKKKLDWTYEQTLETAISCLSTVLSIDFKPSELEVAV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  +DP F+VL+  EID HL A++ERD
Sbjct  220  VTVQDPKFKVLTEAEIDTHLVALAERD  246



>ref|XP_006258805.1| PREDICTED: proteasome subunit alpha type-6 [Alligator mississippiensis]
Length=246

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 155/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  49   VIVTQKKVPDKLLDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  169  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  229  ILTEAEIDTHLVALAERD  246



>ref|XP_003471921.1| PREDICTED: proteasome subunit alpha type-6 [Cavia porcellus]
Length=246

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+ AI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVEIAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_005243955.1| PREDICTED: proteasome subunit alpha type-6 [Falco peregrinus]
Length=254

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  57   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  116

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  117  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  176

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  177  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  236

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  237  ILTEAEIDVHLVALAERD  254



>ref|XP_005149366.1| PREDICTED: proteasome subunit alpha type-6 [Melopsittacus undulatus]
Length=246

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  49   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  169  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  229  ILTEAEIDGHLVALAERD  246



>pdb|4R3O|A Chain A, Human Constitutive 20s Proteasome
 pdb|4R3O|O Chain O, Human Constitutive 20s Proteasome
 pdb|4R67|A Chain A, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|O Chain O, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|CC Chain c, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|QQ Chain q, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=244

 Score =   237 bits (605),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 158/206 (77%), Gaps = 0/206 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  39   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  98

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  99   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  158

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  159  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  218

Query  227  VRQEDPSFRVLSTVEIDEHLTAISER  150
            V  E+P FR+L+  EID HL A++ER
Sbjct  219  VTVENPKFRILTEAEIDAHLVALAER  244



>ref|XP_007530301.1| PREDICTED: proteasome subunit alpha type-6 [Erinaceus europaeus]
Length=246

 Score =   237 bits (605),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             +++++GYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKFGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  +DP FR+L+  EID HL A++ERD
Sbjct  220  VTIDDPKFRILTEAEIDAHLVALAERD  246



>ref|XP_010153543.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eurypyga 
helias]
 ref|XP_010581956.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Haliaeetus 
leucocephalus]
Length=246

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  49   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  169  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  229  ILTEAEIDVHLVALAERD  246



>ref|XP_009901279.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Picoides 
pubescens]
 gb|KFV69230.1| Proteasome subunit alpha type-6 [Picoides pubescens]
Length=246

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  49   VVVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  169  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  229  ILTEAEIDVHLVALAERD  246



>ref|XP_001418143.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96436.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=246

 Score =   237 bits (604),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 151/196 (77%), Gaps = 0/196 (0%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     +D + VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGYE+P
Sbjct  51   VTQKKIPDKLIDASDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQHYGYEVP  110

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            VDVLA  +AD+ QVYTQHAYMRPL V+ +++ +DE++GP LFKCDPAG+F G+ ATSAG 
Sbjct  111  VDVLANILADEFQVYTQHAYMRPLAVMVILIAVDEDRGPSLFKCDPAGYFVGYSATSAGA  170

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KE EA+NFLEKK+K+  +F   +T Q AISALQ VL E+ KASE+E+ VV  ++P+FRV+
Sbjct  171  KEVEAVNFLEKKVKSGASFDVNQTAQLAISALQHVLGEEVKASELEVAVVTADNPNFRVI  230

Query  194  STVEIDEHLTAISERD  147
            S  E+++HLT+ISERD
Sbjct  231  SESEVEDHLTSISERD  246



>ref|XP_001363110.1| PREDICTED: proteasome subunit alpha type-6 [Monodelphis domestica]
Length=246

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTESEIDTHLVALAERD  246



>ref|XP_009317738.1| PREDICTED: proteasome subunit alpha type-6 [Pygoscelis adeliae]
Length=259

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  62   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  121

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  122  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  181

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  182  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  241

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  242  ILTEAEIDVHLVALAERD  259



>gb|KFZ52790.1| Proteasome subunit alpha type-6, partial [Podiceps cristatus]
Length=222

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+++ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSNTVTHLFKITENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GID+E GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDDEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDVHLVALAERD  222



>gb|KFP76959.1| Proteasome subunit alpha type-6, partial [Acanthisitta chloris]
 gb|KFV03490.1| Proteasome subunit alpha type-6, partial [Pterocles gutturalis]
Length=222

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  25   VIVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  84

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+A
Sbjct  85   IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAA  144

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+ AI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  145  GVKQTESTSFLEKKVKKKFDWTYEQTVEVAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  204

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  205  ILTEAEIDVHLVALAERD  222



>ref|NP_001132944.1| proteasome subunit alpha type-6 [Sus scrofa]
 gb|ACJ06406.1| proteasome subunit alpha type 6 [Sus scrofa]
Length=246

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLFTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+ +  EID HL A++ERD
Sbjct  220  VTVENPKFRIFTEAEIDAHLVALAERD  246



>ref|XP_010876681.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + +AD SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRMADISQVYTQNAEMRPLGCCMIVIGVDEECGPQVFKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++++ETV+TAI+ L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFKETVETAITCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  EDP FR+LS  E+D HL +++ERD
Sbjct  220  ITTEDPKFRILSESEVDTHLVSLAERD  246



>dbj|BAE36518.1| unnamed protein product [Mus musculus]
Length=246

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MR LG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRTLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_006632201.1| PREDICTED: proteasome subunit alpha type-6-like [Lepisosteus 
oculatus]
Length=246

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDSNTVTHLFRITETIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEEFGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++++TV+TAI+ L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFDQTVETAITCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  EDP FR+LS  EID HL +++ERD
Sbjct  220  VTTEDPKFRILSEAEIDGHLVSLAERD  246



>ref|XP_007436765.1| PREDICTED: proteasome subunit alpha type-6 [Python bivittatus]
Length=246

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIMIGIDEENNPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIEIGV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKLDWTFEQTVETAITCLSTVLSIDFKPSEIEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+L+  EID HL A++ERD
Sbjct  220  VTVDNPKFRILTEAEIDTHLVALAERD  246



>ref|XP_005285405.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysemys 
picta bellii]
Length=246

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFRITETIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+T I+ L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKYDWTFEQTVETGITCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTEAEIDTHLVALAERD  246



>ref|XP_003445487.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
 ref|XP_005738779.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005933943.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
 ref|XP_006799416.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=246

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             + ++YGYE+PVD+L + +AD SQVYTQ+A MRPLG   +++GIDEE GPQLFKCDPAG+
Sbjct  100  NWMYKYGYEVPVDMLCKRMADISQVYTQNAEMRPLGCCMIVIGIDEELGPQLFKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++YE+T++TAIS L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTYEQTIETAISCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  ++P F++LS  EID HL  +SER+
Sbjct  220  ITAQEPKFKILSEAEIDAHLMTLSERE  246



>gb|ERE72543.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=250

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 159/211 (75%), Gaps = 4/211 (2%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETV----QTAISALQSVLQEDFKASEI  240
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV    QTAI+ L +VL  DFK SEI
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVEHSFQTAITCLSTVLSIDFKPSEI  219

Query  239  EIGVVRQEDPSFRVLSTVEIDEHLTAISERD  147
            E+GVV  E+P FR+LS  EID HL A++ERD
Sbjct  220  EVGVVTVENPKFRILSEAEIDAHLVALAERD  250



>ref|XP_004653726.1| PREDICTED: proteasome subunit alpha type-6-like [Jaculus jaculus]
Length=246

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+  MRPLG   +++G DEE+GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNTEMRPLGCCMILIGTDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+LS  EID HL A++ERD
Sbjct  220  VTVDNPKFRILSEAEIDTHLVALAERD  246



>emb|CAG00121.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=246

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+TV+TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTVETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  +DP FR+L+  E+D HL +++ERD
Sbjct  220  ITTQDPKFRILTETEVDTHLMSLAERD  246



>ref|XP_003971508.1| PREDICTED: proteasome subunit alpha type-6-like [Takifugu rubripes]
Length=246

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  +DP FR+L+  E+D HL A++ERD
Sbjct  220  ITTQDPKFRILTETEVDTHLMALAERD  246



>gb|ACO51961.1| Proteasome subunit alpha type-6 [Rana catesbeiana]
Length=246

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   + + ++K     LD ++V+HLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAIVVTQKKVPDKSLDNSTVSHLFRITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEETGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E++V+TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATTAGVKQTEATSFLEKKVKKKFDWTFEQSVETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  +DP FR+L+  EID HL A++ERD
Sbjct  220  VTVQDPKFRILTEAEIDVHLVALAERD  246



>ref|NP_001002589.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAH76196.1| Zgc:92716 [Danio rerio]
Length=246

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   + + ++K     LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAIVVTQKKVPDKLLDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGLDEELGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+ V+TAI+ L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQAVETAITCLTTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  EDP FR+LS  E+D HL ++SERD
Sbjct  220  ITAEDPKFRILSESEVDTHLVSLSERD  246



>ref|XP_003440740.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
Length=246

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  +DP FR+L+  E+D HL +++ERD
Sbjct  220  VTTQDPKFRILAETEVDTHLMSLAERD  246



>emb|CEF98211.1| Proteasome A-type subunit [Ostreococcus tauri]
Length=246

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            +D T VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGY++PVDVLA  +AD
Sbjct  61   IDPTDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQNYGYDVPVDVLANILAD  120

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
            + QVYTQHAYMRPL V+ +++ +DE++GP LFKCDPAG++ G++ATSAG KE EA+NFLE
Sbjct  121  EFQVYTQHAYMRPLAVMVILVSMDEDRGPSLFKCDPAGYYVGYRATSAGSKEVEAVNFLE  180

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KK+K   +F   ET Q AISALQ VL E+ KASE+E+ +V  ++P+FRV+S  +++EHLT
Sbjct  181  KKVKAGSSFDANETAQLAISALQHVLGEEVKASELEVAIVTADNPAFRVISESQVEEHLT  240

Query  164  AISERD  147
            AISERD
Sbjct  241  AISERD  246



>ref|XP_007253022.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Astyanax 
mexicanus]
Length=246

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDSSTVTHLFRITESIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YG+E+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGFEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGLDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EAI+FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+G+
Sbjct  160  YCGFKATAAGVKQTEAISFLEKKVKKKHDWTFEQTIETAISCLSTVLSIDFKPSELEVGI  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  +DP FR+L+  E+D HL ++SERD
Sbjct  220  ITADDPKFRILTESEVDTHLVSLSERD  246



>ref|XP_004542308.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
 ref|XP_005724902.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005917154.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
Length=246

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  +DP FR+L+  E+D HL +++ERD
Sbjct  220  ITTQDPKFRILAETEVDTHLMSLAERD  246



>ref|XP_005356606.1| PREDICTED: proteasome subunit alpha type-6-like [Microtus ochrogaster]
Length=242

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+A  EAA ++++YGYE+PVD+L + IAD
Sbjct  57   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRAHYEAANWKYKYGYEIPVDMLCKRIAD  116

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++   KAT+AGVK+ E+ +FLE
Sbjct  117  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCSFKATAAGVKQTESTSFLE  176

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL 
Sbjct  177  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLV  236

Query  164  AISERD  147
            A++ERD
Sbjct  237  ALAERD  242



>ref|XP_010744453.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  +DP FR+L+  E+D HL A++ERD
Sbjct  220  LTTQDPKFRILTETEVDTHLMALAERD  246



>ref|XP_001511492.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ornithorhynchus 
anatinus]
Length=246

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+++ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFRITENIGCVMTGMTADSKSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  220  VTVENPKFRILTESEIDTHLVALAERD  246



>emb|CDQ90937.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++++ETV+TAI+ L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFKETVETAITCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  EDP FR+L+  E+D HL +++ERD
Sbjct  220  ITTEDPKFRILTESEVDVHLVSLAERD  246



>gb|ACH70968.1| proteasome (prosome, macropain) subunit, alpha type 6-2 [Salmo 
salar]
Length=246

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K   + LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDTLLDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             + ++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG+
Sbjct  100  NWNYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K     +++ETV+TAI+ L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDLTFKETVETAITCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  EDP FR+L+  E+D HL +++ERD
Sbjct  220  ISTEDPKFRILTESEVDTHLVSLAERD  246



>ref|XP_003216618.1| PREDICTED: proteasome subunit alpha type-6 [Anolis carolinensis]
Length=246

 Score =   234 bits (597),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGY++PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG+
Sbjct  100  NWKYKYGYDIPVDMLCKRIADISQVYTQNAEMRPLGCCVIMIGIDEENNPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIEIGV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKLDWTFEQTVETAITCLSTVLSIDFKPSEIEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+L+  E+D HL A++ERD
Sbjct  220  VTVDNPKFRILTEAEVDTHLVALAERD  246



>gb|ACI66289.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ADM16303.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++++ETV+TAI+ L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFKETVETAITCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  EDP FR+L+  E+D HL +++ERD
Sbjct  220  ITTEDPKFRILTESEVDIHLVSLAERD  246



>ref|XP_008300217.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA
Sbjct  40   VAVRGKDCVVIVTQKKVPDKLLDAMTVTHLFRITESIGCVMTGMTADGRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGY++PVD+L + +AD SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG+
Sbjct  100  NWKYKYGYDIPVDMLCKRMADISQVYTQNAEMRPLGCCMIVVGLDEELGPQLYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++YE+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTYEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            ++ ++P F++LS  EID HL A+S+R+
Sbjct  220  IKTQEPEFKILSEAEIDTHLMALSDRE  246



>gb|EIE83838.1| hypothetical protein RO3G_08543 [Rhizopus delemar RA 99-880]
Length=246

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + +RK     LD +++TH+F +T  +G   TG+ ADAR+ V +AR EAAEFR++YGYE
Sbjct  49   VIVTQRKVPDKLLDPSTITHVFKLTPKIGCAMTGMIADARSQVTRARQEAAEFRYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +P D+LAR +A+ +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG+F G+KAT+A
Sbjct  109  IPTDMLARRVANINQVYTQQAAMRPYGVSMILIGYDDEFGPQLYKCDPAGYFVGYKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+QEA+N LEKK+K +P  + E+T++ AI+ L SVL  DFKASEIEIGVV +E+  FR
Sbjct  169  GAKQQEALNHLEKKLKKNPELNMEDTIELAITTLSSVLAVDFKASEIEIGVVTKENTDFR  228

Query  200  VLSTVEIDEHLTAISERD  147
             LST EI++HL  I E+D
Sbjct  229  TLSTEEIEDHLQRIVEKD  246



>ref|XP_004559366.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
Length=246

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 153/207 (74%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             + ++YGYE+PVD+L + +AD SQVYTQ+A MRPLG   +++GIDEE GPQLFKCDPAG+
Sbjct  100  NWMYKYGYEVPVDMLCKRMADISQVYTQNAEMRPLGCCMIVIGIDEELGPQLFKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++YE+T++ AIS L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTYEQTIEAAISCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  ++P F++LS  EID HL  +SER+
Sbjct  220  ITAQEPKFKILSEAEIDAHLMTLSERE  246



>gb|ETE73021.1| Proteasome subunit alpha type-6, partial [Ophiophagus hannah]
Length=279

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  73   VAVRGKDCAVVVTQKKVPDKLLDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAA  132

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG+
Sbjct  133  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIMIGIDEENNPQVYKCDPAGY  192

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TA++ L +VL  DFK SEIE+GV
Sbjct  193  YCGFKATAAGVKQTESTSFLEKKVKKKLDWTFEQTVETAVTCLSTVLSIDFKPSEIEVGV  252

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+LS  EID HL A++ERD
Sbjct  253  VTVDNPKFRILSEAEIDTHLVALAERD  279



>emb|CDQ78135.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             + ++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG+
Sbjct  100  NWNYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K     +++ETV+TAI+ L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDLTFKETVETAITCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  EDP FR+L+  E+D HL +++ERD
Sbjct  220  IATEDPKFRILTESEVDTHLVSLAERD  246



>gb|ACH70967.1| proteasome (prosome, macropain) subunit, alpha type 6-1 [Salmo 
salar]
 gb|ACI66033.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ACI70006.1| Proteasome subunit alpha type-6 [Salmo salar]
 emb|CDQ70650.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE
Sbjct  49   VVVTQKKVPDKLLDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + +AD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRMADISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ EA  FLEKK+K    +++ +T++TAI+ L +VL  DFK SE+EIGV+  EDP FR
Sbjct  169  GVKQTEATTFLEKKVKKKLDWTFAQTIETAITCLSTVLSIDFKPSELEIGVITTEDPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL ++SERD
Sbjct  229  ILTETEIDVHLVSLSERD  246



>ref|NP_001279159.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Callorhinchus 
milii]
 gb|AFM88302.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILVGVDEELGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++Y++TV+TAI+ L +VL  DFK SEIEIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTYDQTVETAITCLSTVLSIDFKPSEIEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+ +  E D HL A++ERD
Sbjct  220  VSVDNPKFRIFTETETDVHLVALAERD  246



>gb|ACO08806.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD ++VTHLF  T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE
Sbjct  49   VVVTQKKVPDKLLDASTVTHLFKTTENIGCVMSGMTADSKSQVQRARCEAANWKYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + +AD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRMADISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ EA  FLEKK+K    +++ +T++TAI+ L +VL  DFK SE+EIGV+  EDP FR
Sbjct  169  GVKQTEATTFLEKKVKKKLDWTFAQTIETAITCLSTVLSIDFKPSELEIGVITTEDPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL ++SERD
Sbjct  229  ILTETEIDVHLVSLSERD  246



>gb|EPB88050.1| proteasome subunit alpha type-6 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=246

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + +RK     LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE
Sbjct  49   VIVTQRKVPDKLLDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +P D+LA+ +A+ +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSA
Sbjct  109  IPTDMLAKRVANINQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYYVGYKATSA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+QE++N LEKK+K +P  + E+T++ AI+ L +VL  DFKASEIE+G+V +ED  FR
Sbjct  169  GAKQQESLNHLEKKLKKNPELNMEDTIELAITTLSTVLAVDFKASEIEVGIVHKEDTDFR  228

Query  200  VLSTVEIDEHLTAISERD  147
             LST EI++HL  I E+D
Sbjct  229  TLSTEEIEDHLQRIVEKD  246



>ref|XP_006015430.1| PREDICTED: proteasome subunit alpha type-6 [Alligator sinensis]
Length=382

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 155/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY+
Sbjct  185  VIVTQKKVPDKLLDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYD  244

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+A
Sbjct  245  IPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCGFKATAA  304

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ E+ +FLEKK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  305  GVKQTESTSFLEKKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  364

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL A++ERD
Sbjct  365  ILTEAEIDTHLVALAERD  382



>gb|EXX71316.1| proteasome core particle subunit alpha 1 [Rhizophagus irregularis 
DAOM 197198w]
Length=178

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = -2

Query  680  LFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQH  501
            +F ++ Y+G + TG+ ADAR  V +AR EAAEFR+++GY MP D+LA+ +A+ +QVYTQH
Sbjct  1    MFQLSPYVGCVMTGLIADARAQVTRARQEAAEFRYKFGYYMPSDMLAKRVANINQVYTQH  60

Query  500  AYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPA  321
            A MRPLGV  +++G D+E+GPQLFKCDPAG++ G+KAT+AG K+QEA+N LEKK+K DP 
Sbjct  61   AAMRPLGVSMILIGYDDERGPQLFKCDPAGYYVGYKATAAGAKQQEALNHLEKKLKKDPV  120

Query  320  FSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  147
              +EETV+ AI+ L SVL  DFK++EIE+ VV ++DP FR LS  EID+HL  I E+D
Sbjct  121  LDFEETVELAINTLSSVLSADFKSTEIEVAVVTKDDPKFRTLSINEIDDHLQRIVEKD  178



>dbj|GAN03133.1| proteasome subunit alpha type-6 [Mucor ambiguus]
Length=246

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + +RK     LD +++TH+F +T  +G + TG+ ADAR  V +AR EAAEFR++YGYE
Sbjct  49   VIVTQRKVPDKLLDPSTITHVFKLTPKIGCVMTGMIADARAQVTKARQEAAEFRYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +P D+LA+ +A+ +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSA
Sbjct  109  IPTDMLAKRVANINQVYTQQAAMRPYGVSMILVGYDDELGPQLYKCDPAGYYVGYKATSA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+QE++N LEKK+K +P  + E+T++ AI+ L +VL  DFKASEIE+GVV +ED  FR
Sbjct  169  GAKQQESLNHLEKKLKKNPELNMEDTIELAITTLSTVLAVDFKASEIEVGVVHKEDTDFR  228

Query  200  VLSTVEIDEHLTAISERD  147
             LST EI++HL  I E+D
Sbjct  229  TLSTEEIEDHLQRIVEKD  246



>ref|XP_004333676.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11663.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
Length=242

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = -2

Query  734  LLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMP  555
            + ++K     +D TSVTHLF +T  +G + TG+ ADAR+ VQ+AR EAA+F  ++GY++P
Sbjct  49   ITQKKVPEKLVDPTSVTHLFNITPTIGCVMTGMIADARSQVQRARKEAADFAHKFGYDIP  108

Query  554  VDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGV  375
            V  LA+ +AD +Q+YTQHAYMRPL ++  ++ IDEE+GPQL+KCDPAG + G KAT AG 
Sbjct  109  VSYLAKRMADIAQIYTQHAYMRPLAMI--LISIDEEEGPQLYKCDPAGSYAGFKATGAGH  166

Query  374  KEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVL  195
            KEQEA NFLEKK K DP    ++T++ AI+ALQ+VL EDFKAS+IE+GVV  + P FR L
Sbjct  167  KEQEARNFLEKKFKTDPKLDADKTIKMAINALQTVLGEDFKASDIEVGVVTTDSPRFRRL  226

Query  194  STVEIDEHLTAISERD  147
            S  E+D HLT I+ERD
Sbjct  227  SDDEVDRHLTEIAERD  242



>ref|XP_005562133.1| PREDICTED: proteasome subunit alpha type-6-like [Macaca fascicularis]
Length=245

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 157/207 (76%), Gaps = 1/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTAD-RSQVQRARYEAA  98

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  99   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  158

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SE E+GV
Sbjct  159  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSETEVGV  218

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  219  VTVENPKFRILTEAEIDAHLVALAERD  245



>ref|XP_005810950.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+L+  E+D HL +++ERD
Sbjct  220  VTTQEPKFRILTESEVDTHLMSLAERD  246



>ref|XP_008396439.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+L+  E+D HL +++ERD
Sbjct  220  VTTQEPKFRILTESEVDAHLMSLAERD  246



>ref|XP_008282309.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGIDEEHGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  +D  FR+L+  E+D HL +++ERD
Sbjct  220  VTTQDAKFRILTETEVDVHLMSLAERD  246



>gb|ACO08382.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = -2

Query  728  RRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVD  549
            ++K     LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA ++++YGYE+PVD
Sbjct  53   QKKVPDKLLDASTVTHLFKITENIGCVMSGMTADNKSQVQRARYEAANWKYKYGYEIPVD  112

Query  548  VLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKE  369
            +L + +AD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+
Sbjct  113  MLCKRMADISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQ  172

Query  368  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  189
             EA  FLEKK+K    +++ +T++TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+ 
Sbjct  173  TEATTFLEKKVKKKLDWTFAQTIETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTE  232

Query  188  VEIDEHLTAISERD  147
             EID HL ++SERD
Sbjct  233  TEIDVHLVSLSERD  246



>ref|XP_006117859.1| PREDICTED: proteasome subunit alpha type-6, partial [Pelodiscus 
sinensis]
Length=236

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  30   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFRITETIGCVMTGMTADSRSQVQRARYEAA  89

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGY++PVD+L + IAD SQVYTQ+A MRPLG   +  G+DEE GPQ++KCDPAG+
Sbjct  90   NWKYKYGYDIPVDMLCKRIADISQVYTQNAEMRPLGCCMIRQGVDEEHGPQVYKCDPAGY  149

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GV
Sbjct  150  YCGFKATAAGVKQTESTSFLEKKVKKKYDWTFEQTVETAITCLSTVLSIDFKPSELEVGV  209

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  E+P FR+L+  EID HL A++ERD
Sbjct  210  VTVENPKFRILTEAEIDTHLVALAERD  236



>ref|XP_007569003.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGMDEEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+L+  E+D HL +++ERD
Sbjct  220  VTTQEPKFRILTESEVDTHLMSLAERD  246



>ref|XP_003388491.1| PREDICTED: proteasome subunit alpha type-6-like [Amphimedon queenslandica]
Length=246

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  S+THLF +T  +G + TG+TAD+R  V++AR+EAAEF++RYGY+
Sbjct  49   VVITQKKVPDKLLDPDSITHLFKITDTVGCVMTGMTADSRAQVKRARHEAAEFKYRYGYD  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            MPVD + + +AD +Q+YTQ+A+MRP G   +++GIDEE+G QLFK DPAG++ G+KATS 
Sbjct  109  MPVDAVCKRMADIAQIYTQNAFMRPYGCSMILIGIDEERGIQLFKTDPAGYYCGYKATSV  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+ EA N+LEKK+K +P++ Y ETV+ A+  L  VL  D K++E+EIGVV +++P FR
Sbjct  169  GAKQTEANNYLEKKIKKNPSWGYHETVEVALLTLSQVLSADLKSNEVEIGVVTEDNPEFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EIDE LTA++ERD
Sbjct  229  ILTEKEIDERLTALAERD  246



>ref|XP_004083706.1| PREDICTED: proteasome subunit alpha type-6 [Oryzias latipes]
Length=246

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG+
Sbjct  100  NWQYKYGYEVPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGIDEEFGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  +D  FR+L+  E+D HL A++ERD
Sbjct  220  VTTQDHKFRILTEAEVDTHLMALAERD  246



>gb|KIY96698.1| 20S proteasome subunit alpha 1 [Monoraphidium neglectum]
Length=290

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 165/251 (66%), Gaps = 44/251 (18%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K    ++ ++K +   +D  +VT +F +TKY+G+L TG+ AD+R++VQQAR +AA
Sbjct  40   IAIRGKDCVCFVTQKKVQDKLIDPGTVTRIFKITKYIGMLVTGLPADSRSVVQQARQQAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQ--------------------------------  504
            EFRF YGYE+PVD LA+ +ADK+QVYTQ                                
Sbjct  100  EFRFTYGYEVPVDYLAKVLADKAQVYTQVGAGMLAGRGPPPADWGCPLTPPAGARWLAPP  159

Query  503  -----HAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKK  339
                 HAYMRPLGV++M++ +DEE+GP LFK DPAG++ G+KAT+ G KE EA+NFLEKK
Sbjct  160  TALSQHAYMRPLGVISMLVSVDEERGPSLFKVDPAGYYVGYKATAVGTKETEAVNFLEKK  219

Query  338  MKNDPA--FSYEETVQTAISALQSVLQEDFKASEIEIGVVR-----QEDPSFRVLSTVEI  180
            ++  PA   SY++T QTAISALQSVL EDFKASEIE+GV R     +++ +F+VL   E+
Sbjct  220  VRAMPAEGASYDDTCQTAISALQSVLAEDFKASEIEVGVARTSWDGRDERAFKVLPVEEV  279

Query  179  DEHLTAISERD  147
            D  L AISERD
Sbjct  280  DAFLVAISERD  290



>emb|CDS07623.1| Putative Proteasome subunit alpha type [Absidia idahoensis var. 
thermophila]
Length=246

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE
Sbjct  49   VIVTQKKVPDKLLDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +P D+LA+ +A+ +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSA
Sbjct  109  IPADMLAKRVANINQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+QE++N LEKK+K +P  + E+T++ AI+ L +VL  DFKASEIE+G+V ++ P FR
Sbjct  169  GAKQQESLNHLEKKLKKNPTLNMEDTIELAITTLSTVLAVDFKASEIEVGIVEKDQPDFR  228

Query  200  VLSTVEIDEHLTAISERD  147
             LS  EID+HL  I E+D
Sbjct  229  TLSVEEIDDHLQRIVEKD  246



>gb|ACI69778.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD ++VTHLF +T+ +G + +G+ AD+++ VQ+AR EAA ++++YGYE
Sbjct  49   VVVTQKKVPDKLLDASTVTHLFKITENIGCVMSGMAADSKSQVQRARYEAANWKYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + +AD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRMADVSQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ EA  FLEKK+K    +++ +T++TAI+ L +VL  DFK SE+EIGV+  EDP FR
Sbjct  169  GVKQTEATTFLEKKVKKKLDWTFAQTIETAITCLSTVLSIDFKPSELEIGVITTEDPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL ++SERD
Sbjct  229  ILTETEIDVHLVSLSERD  246



>emb|CDH55408.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=246

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE
Sbjct  49   VIVTQKKVPDKLLDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +P D+LA+ +A+ +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSA
Sbjct  109  IPADMLAKRVANINQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+QE++N LEKK+K +P  + E+T++ AI+ L +VL  DFKASEIE+G+V ++ P FR
Sbjct  169  GAKQQESLNHLEKKLKKNPTLNMEDTIELAITTLSTVLAVDFKASEIEVGIVEKDQPDFR  228

Query  200  VLSTVEIDEHLTAISERD  147
             LS  EID+HL  I E+D
Sbjct  229  TLSVEEIDDHLQRIVEKD  246



>ref|XP_006065991.1| PREDICTED: proteasome subunit alpha type-6-like [Bubalus bubalis]
Length=246

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     L  ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVAQKKVPDKLLHSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
            +++++YGYE+PV +L + IAD SQVYTQ+A MRPLG   +++G+DEE+GPQ++KCDPAG+
Sbjct  100  KWKYKYGYEIPVHMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEEQGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  160  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+L+  EID HL A++ERD
Sbjct  220  VTVKNPKFRILTEAEIDAHLVALAERD  246



>ref|XP_005989234.1| PREDICTED: proteasome subunit alpha type-6 [Latimeria chalumnae]
Length=246

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF VT+ +G + TG+TAD+++ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKLLDAGTVTHLFRVTENIGCVMTGMTADSKSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++GID+E GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILVGIDQEYGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTVETAITCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+L   EID HL A++ERD
Sbjct  220  VTVDNPKFRILRESEIDAHLVALAERD  246



>emb|CEG74212.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEJ00907.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEI93442.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
Length=246

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE
Sbjct  49   VIVTQKKIPDKLLDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +P D+LA+ +A+ +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG+F G+KAT+A
Sbjct  109  IPTDMLAKRVANINQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYFVGYKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+QEA+N+LEKK+K +P  + E+T++ AI+ L +VL  DFKA+E+EIG+V +++  FR
Sbjct  169  GAKQQEALNYLEKKLKKNPELNMEDTIELAITTLSNVLAVDFKAAELEIGIVTKDNTDFR  228

Query  200  VLSTVEIDEHLTAISERD  147
             LST EID+HL  I E+D
Sbjct  229  TLSTEEIDDHLQRIVEKD  246



>ref|XP_010876973.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE
Sbjct  49   VVVTQKKVPDKLLDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + +AD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+A
Sbjct  109  IPVDMLCKRMADISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ EA +FLEKK+K    +++ +TV+ AI+ L +VL  DFK SE+EIGV+  EDP FR
Sbjct  169  GVKQTEATSFLEKKVKKKLDWTFAQTVEMAITCLSTVLSIDFKPSELEIGVITTEDPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            +L+  EID HL ++SERD
Sbjct  229  ILTESEIDVHLVSLSERD  246



>gb|ACQ58552.1| Proteasome subunit alpha type-6 [Anoplopoma fimbria]
Length=246

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   + + ++K     LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAIVVTQKKVPDKLLDSATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + +AD SQVYTQ+A MRPLG   +++GIDEE G Q++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRLADISQVYTQNAEMRPLGCCMIMIGIDEEHGAQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    +++E+T++TAIS L +VL  DFK SE+E+GV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  +DP FR+L+  E+D HL A++ERD
Sbjct  220  VTIQDPKFRILTETEVDVHLVALAERD  246



>gb|ACM08640.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA
Sbjct  40   VAVRGKDCAVVVTQKKVPDKPLDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++++ETV+TAI+ L +VL  DFK SE+EIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTFKETVETAITCLSTVLSIDFKPSELEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            +  EDP FR+L+  E D HL +++ERD
Sbjct  220  ITTEDPKFRILTESEGDIHLVSLAERD  246



>emb|CDH55409.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=244

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -2

Query  704  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  525
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  59   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  118

Query  524  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  345
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSAG K+QE++N LE
Sbjct  119  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSAGAKQQESLNHLE  178

Query  344  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  165
            KK+K +P  + E+T++ AI+ L +VL  DFKASEIE+G+V ++ P FR LS  EID+HL 
Sbjct  179  KKLKKNPTLNMEDTIELAITTLSTVLAVDFKASEIEVGIVEKDQPDFRTLSVEEIDDHLQ  238

Query  164  AISERD  147
             I E+D
Sbjct  239  RIVEKD  244



>ref|XP_004349345.1| proteasome subunit iota [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91465.1| proteasome subunit iota [Capsaspora owczarzaki ATCC 30864]
Length=244

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     +D +SVTHLF +T+ +G + TG+ ADAR  VQ+AR+EAA+F+F YGY 
Sbjct  47   VVITQKKVPDKLMDASSVTHLFQLTEEIGCVMTGMIADARAQVQRARHEAAQFKFTYGYP  106

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD LAR +AD SQV TQ A  RPLG   +++G D+E G QL+K DPAG++ G+KATSA
Sbjct  107  IPVDQLARRVADISQVSTQQAGARPLGCSMILIGYDDEYGAQLYKTDPAGYYIGYKATSA  166

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G+K QEA N+LEKK+K +P +SY+ETV+ AI+AL SVL  DFK SEIE+GVV +E+P FR
Sbjct  167  GIKSQEANNYLEKKIKKNPEWSYQETVENAITALGSVLSLDFKPSEIEVGVVTKENPFFR  226

Query  200  VLSTVEIDEHLTAISERD  147
            VLS  EI+ HL  ++ERD
Sbjct  227  VLSEREIEAHLQTLAERD  244



>gb|AFK10987.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDELLDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
             ++++YGYE+PVD+L + IAD SQVY Q+A MRPLG   +++G+DEE GPQ++KCDPAG+
Sbjct  100  NWKYKYGYEIPVDMLCKRIADISQVYMQNAEMRPLGCCMILVGVDEELGPQVYKCDPAGY  159

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ EA +FLEKK+K    ++Y++TV+TAI+ L +VL  DFK SEIEIGV
Sbjct  160  YCGFKATAAGVKQTEATSFLEKKVKKKLDWTYDQTVETAITCLSTVLPIDFKPSEIEIGV  219

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+ +  E D HL A++ERD
Sbjct  220  VSVDNPKFRIFTETETDVHLVALAERD  246



>emb|CEP12966.1| hypothetical protein [Parasitella parasitica]
Length=246

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + +RK     LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE
Sbjct  49   VIVTQRKVPDKLLDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +P D+LA+ +A+ +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSA
Sbjct  109  IPTDMLAKRVANINQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYYVGYKATSA  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+QE++N LEKK+K +P  + E+T++ AI+ L +VL  DFKASEIE+GVV ++D  FR
Sbjct  169  GAKQQESLNHLEKKLKKNPELNMEDTIELAITTLSTVLAVDFKASEIEVGVVHKDDSDFR  228

Query  200  VLSTVEIDEHLTAISERD  147
             LS  EI++HL  I E+D
Sbjct  229  TLSIEEIEDHLQRIVEKD  246



>ref|XP_004637142.1| PREDICTED: proteasome subunit alpha type-6 [Octodon degus]
Length=244

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  767  LASEEKILYVWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAA  588
            +A   K   V + ++K     LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA
Sbjct  40   VAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA  99

Query  587  EFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGH  408
               ++Y YE+PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG+
Sbjct  100  --NWKYNYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY  157

Query  407  FFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  228
            + G KAT+AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GV
Sbjct  158  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGV  217

Query  227  VRQEDPSFRVLSTVEIDEHLTAISERD  147
            V  ++P FR+L+  EID HL A++ERD
Sbjct  218  VTVDNPKFRILTEAEIDAHLVALAERD  244



>ref|XP_011151114.1| PREDICTED: proteasome subunit alpha type-6-like [Harpegnathos 
saltator]
 gb|EFN76820.1| Proteasome subunit alpha type-6 [Harpegnathos saltator]
Length=246

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V+  ++K     LD +SVTH+F +T+Y+G + TG+ AD+R+ VQ+AR EAA F+++YGYE
Sbjct  49   VFATQKKVPDKLLDASSVTHVFHLTEYIGCVMTGMIADSRSQVQRARYEAAHFKYKYGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD L + +AD SQVYTQ+A MRPLG   M++  D+EKGP ++K DPAG+F G++A S 
Sbjct  109  IPVDALCQRVADISQVYTQNAEMRPLGCSMMLIAYDKEKGPCIYKADPAGYFCGYRAISV  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            G K+ EA ++LEKK+K    + Y+ET+Q AI+ L +VL  DFK +EIE+GVV +++P FR
Sbjct  169  GAKQTEANSYLEKKLKKKQNYDYDETIQLAITCLSTVLSVDFKPTEIEVGVVSKDNPKFR  228

Query  200  VLSTVEIDEHLTAISERD  147
            VL+  EID+HLTAI+E+D
Sbjct  229  VLTEQEIDKHLTAIAEKD  246



>ref|XP_001640650.1| predicted protein [Nematostella vectensis]
 gb|EDO48587.1| predicted protein [Nematostella vectensis]
Length=246

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 149/198 (75%), Gaps = 0/198 (0%)
 Frame = -2

Query  740  VWLLRRKSRTSYLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYE  561
            V + ++K     LD  +VT LF +++ +G + TG+ AD+R+ VQ+AR EAA +++++GYE
Sbjct  49   VVVTQKKVPDKLLDSNTVTQLFELSERIGCVMTGMVADSRSQVQRARYEAANWKYKFGYE  108

Query  560  MPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSA  381
            +PVD+L + IAD SQVYTQ+A MRPLG   +++GIDEEKGPQL+K DPAG+F G KA S 
Sbjct  109  IPVDMLCKRIADISQVYTQNAEMRPLGCGMILIGIDEEKGPQLYKTDPAGYFCGFKACSV  168

Query  380  GVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  201
            GVK+ EA +FLEKK+K   A+++ ETV+TAIS L SVL  DFK SE+E+GVV  ++P FR
Sbjct  169  GVKQTEANSFLEKKVKKKHAWTFNETVETAISCLSSVLSADFKPSELEVGVVSMDNPRFR  228

Query  200  VLSTVEIDEHLTAISERD  147
             L+  EID HL AI+ERD
Sbjct  229  KLTEAEIDTHLVAIAERD  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730