BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047L16

Length=787
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       383   9e-125   Ipomoea batatas [batate]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   382   2e-124   Ipomoea nil [qian niu]
emb|CAL91171.1|  phenylalanine ammonia-lyase 2                          369   1e-123   Cynara cardunculus var. scolymus [artichoke]
gb|AIA66448.1|  PAL1                                                    379   4e-123   Capsicum annuum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    379   6e-123   Capsicum annuum
gb|AGY49231.1|  phenylalanine ammonia lyase                             378   8e-123   Ricinus communis
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              377   1e-122   Ricinus communis
gb|AAU85591.1|  phenylalanine ammonia-lyase                             361   1e-122   Olea europaea
dbj|BAF96940.1|  phenylalanine ammonia lyase                            367   3e-122   Nicotiana tabacum [American tobacco]
gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           376   3e-122   Ipomoea purpurea
gb|ABV26012.1|  phenylalanine ammonia-lyase                             369   5e-122   Musa acuminata [banana]
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       374   1e-121   Helianthus annuus
gb|ACR10243.1|  phenylalanine ammonia-lyase                             372   2e-121   Canarium album [Chinese white-olive]
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    370   3e-121   Rhizophora mangle
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     374   3e-121   Petroselinum crispum
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          374   4e-121   Cynara cardunculus var. scolymus [artichoke]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              374   4e-121   Vitis vinifera
gb|AGO01926.1|  phenylalanine ammonia-lyase 3                           369   4e-121   Lycium barbarum [Duke of Argyll's teatree]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            374   4e-121   Daucus carota [carrots]
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            374   4e-121   Daucus carota [carrots]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           374   5e-121   Nicotiana attenuata
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             373   8e-121   Nicotiana tomentosiformis
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       373   9e-121   Nicotiana tabacum [American tobacco]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             372   1e-120   Vitis vinifera
emb|CAN77065.1|  hypothetical protein VITISV_009233                     372   1e-120   Vitis vinifera
gb|AGO01924.1|  phenylalanine ammonia-lyase 1                           368   1e-120   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_007027354.1|  PHE ammonia lyase 1                                372   1e-120   Theobroma cacao [chocolate]
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             372   1e-120   Vitis vinifera
gb|AGO01925.1|  phenylalanine ammonia-lyase 2                           367   1e-120   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             372   1e-120   Vitis vinifera
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         372   1e-120   Populus trichocarpa [western balsam poplar]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             372   2e-120   Solanum lycopersicum
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             372   2e-120   Vitis vinifera
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             372   2e-120   Populus tomentosa [Chinese white poplar]
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             372   2e-120   Vitis vinifera
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           372   2e-120   Nicotiana attenuata
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             372   3e-120   Sesamum indicum [beniseed]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             372   3e-120   Nicotiana tomentosiformis
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             372   3e-120   Populus euphratica
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    367   3e-120
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   3e-120   Vitis vinifera
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             372   3e-120   Gossypium arboreum [tree cotton]
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             371   3e-120   Nelumbo nucifera [Indian lotus]
gb|AEH02821.1|  phenylalanine ammonia lyase                             371   3e-120   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KJB16792.1|  hypothetical protein B456_002G248000                    371   4e-120   Gossypium raimondii
gb|AER12109.1|  PAL                                                     371   4e-120   Gossypium hirsutum [American cotton]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         371   4e-120   Populus trichocarpa [western balsam poplar]
gb|AAR31107.1|  phenylalanine ammonia-lyase                             371   4e-120   Quercus suber [cork oak]
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   4e-120   
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             371   4e-120   Sesamum indicum [beniseed]
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   4e-120   Populus euphratica
gb|AGT63063.1|  phenylalanine ammonia-lyase                             371   4e-120   Solanum tuberosum [potatoes]
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             371   4e-120   Vitis vinifera
gb|ABN79671.2|  phenylalanine ammonia-lyase                             371   5e-120   Rudbeckia hirta
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 370   6e-120   Manihot esculenta [manioc]
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             370   6e-120   Nelumbo nucifera [Indian lotus]
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      370   7e-120   
gb|AGE10589.1|  phenylalanine amononia-lyase                            370   9e-120   Lonicera japonica [Japanese honeysuckle]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         370   9e-120   Populus trichocarpa [western balsam poplar]
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    370   9e-120   Solanum lycopersicum
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        370   9e-120   
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             370   9e-120   Plectranthus scutellarioides
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             370   1e-119   Nicotiana sylvestris
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       370   1e-119   Populus trichocarpa [western balsam poplar]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          370   1e-119   Populus euphratica
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             370   1e-119   Populus tomentosa [Chinese white poplar]
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         370   1e-119   Jatropha curcas
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   370   1e-119   Lactuca sativa [cultivated lettuce]
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        370   1e-119   Vitis vinifera
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    370   1e-119   Solanum lycopersicum
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        370   1e-119   Vitis vinifera
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           370   1e-119   Populus tomentosa [Chinese white poplar]
emb|CDP20698.1|  unnamed protein product                                369   1e-119   Coffea canephora [robusta coffee]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       370   1e-119   Camellia sinensis [black tea]
dbj|BAA95629.1|  phenylalanine ammonia lyase                            370   2e-119   Catharanthus roseus [chatas]
gb|AIY26016.1|  PAL                                                     369   2e-119   Jasminum sambac [Arabian jasmine]
gb|ABI33979.1|  phenylalanine ammonia lyase                             369   2e-119   Jatropha curcas
gb|AFN85669.1|  phenylalanine ammonia-lyase                             369   2e-119   Hibiscus cannabinus [bimli-jute]
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    369   3e-119   Lithospermum erythrorhizon
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        369   3e-119   Vitis vinifera
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             369   3e-119   Gossypium arboreum [tree cotton]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        369   3e-119   Solanum tuberosum [potatoes]
gb|AGH13333.1|  phenylalanine ammonia-lyase                             369   3e-119   Rhus chinensis
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           369   3e-119   Coffea canephora [robusta coffee]
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            369   3e-119   Eucalyptus robusta [swamp messmate]
gb|KJB62426.1|  hypothetical protein B456_009G416300                    369   3e-119   Gossypium raimondii
gb|AEA72280.1|  phenylalanine ammonia-lyase                             368   3e-119   Angelica gigas
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            369   3e-119   Gynura bicolor
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     365   4e-119   Solanum tuberosum [potatoes]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          369   4e-119   Vitis vinifera
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             369   4e-119   Gossypium arboreum [tree cotton]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        369   4e-119   Nicotiana sylvestris
gb|ACF94716.1|  phenylalanine ammonia lyase                             369   4e-119   Robinia pseudoacacia [black locust]
emb|CAA34715.1|  unnamed protein product                                364   4e-119   Petroselinum crispum
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   369   4e-119   Populus tremuloides
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            358   4e-119   Phaseolus vulgaris [French bean]
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            368   5e-119   Populus sieboldii x Populus grandidentata
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     369   5e-119   Nicotiana tomentosiformis
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             368   5e-119   Perilla frutescens [beefsteak-mint]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             368   5e-119   Gossypium arboreum [tree cotton]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   368   5e-119   Populus tremuloides
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           365   6e-119   Glycine soja [wild soybean]
gb|AEX32790.1|  phenylalanine ammonia-lyase                             368   6e-119   Vitis vinifera
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       368   6e-119   Nicotiana tabacum [American tobacco]
gb|AIA24411.1|  phenylalanine ammonia-lyase                             368   6e-119   Sinopodophyllum hexandrum [Himalayan mayapple]
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     368   7e-119   Petroselinum crispum
gb|ACT21093.1|  phenylalanine ammonia-lyase                             367   8e-119   Camellia oleifera [abura-tsubaki]
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           368   8e-119   Rhizophora mangle
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             368   8e-119   Nicotiana sylvestris
gb|AEE81750.1|  phenylalanine ammonia lyase                             368   9e-119   Morus alba var. multicaulis
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        367   9e-119   Eucalyptus grandis [rose gum]
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    368   9e-119   Solanum tuberosum [potatoes]
gb|AJO53273.1|  phenylalanine ammonia-lyase                             367   9e-119   Pogostemon cablin
gb|AGO01927.1|  phenylalanine ammonia-lyase 4                           363   1e-118   Lycium barbarum [Duke of Argyll's teatree]
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     367   1e-118   Petroselinum crispum
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             367   1e-118   Camellia japonica [common camellia]
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             367   1e-118   
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     367   1e-118   Nicotiana tomentosiformis
gb|KJB36583.1|  hypothetical protein B456_006G166000                    367   1e-118   Gossypium raimondii
gb|KJB46525.1|  hypothetical protein B456_007G373600                    367   1e-118   Gossypium raimondii
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           364   1e-118   Glycine soja [wild soybean]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             367   2e-118   Scutellaria viscidula [zhan mao huang qin]
gb|AJO53274.1|  phenylalanine ammonia-lyase                             367   2e-118   Pogostemon cablin
gb|AID16077.1|  phenylalanine ammonium lyase                            367   2e-118   Morus alba
gb|AHL27351.1|  phenylalanine ammonia-lyase                             349   2e-118   Glycine max [soybeans]
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       366   2e-118   Cucumis sativus [cucumbers]
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        366   2e-118   
gb|KGN52974.1|  hypothetical protein Csa_4G008770                       363   3e-118   Cucumis sativus [cucumbers]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             366   3e-118   Populus tomentosa [Chinese white poplar]
gb|AGU91428.1|  phenylalanine ammonia-lyase                             366   3e-118   Chrysanthemum boreale
emb|CAC81822.1|  phenylalanine ammonia-lyase                            356   3e-118   Beta vulgaris [beet]
gb|ABD42947.1|  phenylalanine ammonia lyase                             366   3e-118   Acacia auriculiformis x Acacia mangium
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             366   3e-118   Cucumis melo [Oriental melon]
gb|AFK43896.1|  unknown                                                 355   4e-118   Medicago truncatula
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    366   4e-118   
gb|AIB06732.1|  phenylalanine ammonia lyase                             366   4e-118   Mangifera indica
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        366   4e-118   
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            366   4e-118   Vigna radiata [mung bean]
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    366   4e-118   
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           365   5e-118   Glycine soja [wild soybean]
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           363   5e-118   Glycine soja [wild soybean]
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     366   5e-118   Nicotiana sylvestris
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            365   5e-118   Lactuca sativa [cultivated lettuce]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             366   5e-118   Gossypium arboreum [tree cotton]
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      365   5e-118   
gb|ACC63889.1|  phenylalanine ammonia-lyase                             365   6e-118   Populus trichocarpa [western balsam poplar]
gb|KGN52975.1|  hypothetical protein Csa_4G008780                       363   7e-118   Cucumis sativus [cucumbers]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             365   7e-118   Populus szechuanica
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        365   7e-118   Solanum tuberosum [potatoes]
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          365   7e-118   Cynara cardunculus var. scolymus [artichoke]
gb|ADO64252.1|  PAL                                                     365   7e-118   Epimedium sagittatum
gb|AIZ76766.1|  PAL2                                                    356   8e-118   Pyrus pyrifolia [sha li]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         365   8e-118   Populus trichocarpa [western balsam poplar]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           365   8e-118   Scutellaria baicalensis [Baikal skullcap]
gb|ACR15762.1|  phenylalanine ammonia-lyase                             365   9e-118   Litchi chinensis [litchi]
gb|AHL27357.1|  phenylalanine ammonia-lyase                             348   9e-118   Glycine soja [wild soybean]
gb|KJB46526.1|  hypothetical protein B456_007G373700                    363   1e-117   Gossypium raimondii
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           365   1e-117   Ageratina adenophora
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    365   1e-117   
gb|KJB73539.1|  hypothetical protein B456_011G238400                    365   1e-117   Gossypium raimondii
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      365   1e-117   
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     364   1e-117   Eucalyptus grandis [rose gum]
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             365   1e-117   Eucalyptus grandis [rose gum]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            364   1e-117   Melissa officinalis [sweet balm]
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        365   1e-117   Solanum tuberosum [potatoes]
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        364   2e-117   Cucumis melo [Oriental melon]
emb|CAN61378.1|  hypothetical protein VITISV_032212                     363   2e-117   Vitis vinifera
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        363   3e-117   Solanum tuberosum [potatoes]
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      363   3e-117   Glycine max [soybeans]
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         363   3e-117   Populus euphratica
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     363   4e-117   Daucus carota [carrots]
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    363   4e-117   
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             363   4e-117   Citrus clementina [clementine]
gb|AAG22550.1|AF304367_1  phenylalanine ammonia-lyase 2                 352   4e-117   Rubus idaeus [European raspberry]
gb|ABR14606.1|  phenylalanine ammonia-lyase                             363   4e-117   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    363   5e-117   Glycine max [soybeans]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             363   5e-117   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        363   5e-117   Cucumis sativus [cucumbers]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             363   5e-117   Vitis vinifera
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   363   5e-117   Citrus sinensis [apfelsine]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           363   5e-117   Coffea arabica [arabica coffee]
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        363   6e-117   
gb|AER58180.1|  phenylalanine ammonia lyase                             363   6e-117   Cucumis sativus [cucumbers]
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        363   6e-117   Cucumis melo [Oriental melon]
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      363   7e-117   Cucumis melo [Oriental melon]
gb|ACT32033.1|  phenylalanine ammonia-lyase                             362   7e-117   Glycine soja [wild soybean]
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    363   8e-117   Solanum tuberosum [potatoes]
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        362   8e-117   
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        362   8e-117   Solanum tuberosum [potatoes]
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             362   1e-116   Vitis vinifera
gb|AGA84059.1|  phenylalanine ammonia lyase                             362   1e-116   Picrorhiza kurrooa
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        363   1e-116   
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    362   1e-116   
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    362   1e-116   Lithospermum erythrorhizon
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        362   1e-116   
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        362   1e-116   Morus notabilis
gb|AGE10607.1|  phenylalanine amononia-lyase                            355   1e-116   Lonicera hypoglauca
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    361   1e-116   
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     362   2e-116   Solanum tuberosum [potatoes]
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     362   2e-116   Glycine max [soybeans]
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             362   2e-116   Eucalyptus grandis [rose gum]
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        362   2e-116   
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             362   2e-116   Citrus clementina [clementine]
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         361   2e-116   Jatropha curcas
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       362   2e-116   Cucumis sativus [cucumbers]
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            362   2e-116   Lotus japonicus
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           361   2e-116   Platycodon grandiflorus [balloon-flower]
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        361   3e-116   Cucumis melo [Oriental melon]
gb|AAQ74878.1|  phenylalanine ammonia lyase                             361   3e-116   Populus trichocarpa x Populus deltoides
gb|AAG22549.1|AF304366_1  phenylalanine ammonia-lyase 1                 350   3e-116   Rubus idaeus [European raspberry]
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        361   3e-116   Cucumis melo [Oriental melon]
gb|AAA34179.2|  phenylalanine ammonia lyase                             360   3e-116   Solanum lycopersicum
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   4e-116   
gb|AIZ76767.1|  PAL2                                                    356   4e-116   Pyrus pyrifolia [sha li]
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    360   4e-116   Solanum lycopersicum
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            360   4e-116   Lotus japonicus
gb|AAV98199.1|  phenylalanine ammonialyase 1                            361   4e-116   Petunia x hybrida [garden petunia]
gb|AEC11891.1|  PAL1                                                    361   4e-116   Petunia exserta
gb|ADI40166.1|  phenylalanine ammonia-lyase                             361   5e-116   Morus alba
emb|CDY66761.1|  BnaCnng52250D                                          355   5e-116   Brassica napus [oilseed rape]
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    360   5e-116   
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           362   5e-116   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007016787.1|  PHE ammonia lyase 1                                360   5e-116   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           360   5e-116   Tarenaya hassleriana [spider flower]
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 360   5e-116   Coffea canephora [robusta coffee]
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           360   6e-116   Coffea arabica [arabica coffee]
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              360   6e-116   Ricinus communis
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        360   6e-116   Cucumis melo [Oriental melon]
gb|AAZ29735.1|  phenylalanine ammonia lyase                             360   8e-116   Trifolium pratense [peavine clover]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             360   9e-116   Phaseolus vulgaris [French bean]
gb|AHA42445.1|  phenylalanine ammonia lyase                             354   9e-116   Cannabis sativa
gb|AFU90757.1|  phenylalanine ammonia-lyase                             360   1e-115   Epimedium sagittatum
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           360   1e-115   Coffea canephora [robusta coffee]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       360   1e-115   Citrus limon [lemon]
gb|AGE10617.1|  phenylalanine amononia-lyase                            355   1e-115   Lonicera macranthoides
gb|ABY51677.1|  phenylalanine ammonia lyase                             343   1e-115   Plagiochasma appendiculatum
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             359   2e-115   
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 356   2e-115   Coffea canephora [robusta coffee]
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    359   2e-115   Populus sieboldii x Populus grandidentata
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             359   2e-115   Eucalyptus grandis [rose gum]
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           359   2e-115   Astragalus membranaceus
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           359   2e-115   Platycodon grandiflorus [balloon-flower]
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            358   2e-115   Lotus japonicus
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      359   2e-115   Cucumis sativus [cucumbers]
gb|ACP28056.1|  phenylalanine amonnia lyase                             349   2e-115   Populus simonii x Populus nigra
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        359   2e-115   Eucalyptus grandis [rose gum]
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            358   2e-115   Lotus japonicus
gb|AGL81344.1|  phenylalanine ammonia lyase                             358   3e-115   Pyrus communis
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           358   3e-115   Ageratina adenophora
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      358   3e-115   Tarenaya hassleriana [spider flower]
gb|AGE10590.1|  phenylalanine amononia-lyase                            358   3e-115   Lonicera japonica [Japanese honeysuckle]
gb|AFP49807.1|  phenylalanine ammonialyase 4                            358   3e-115   Coffea arabica [arabica coffee]
gb|AFP49806.1|  phenylalanine ammonialyase 1                            358   3e-115   Coffea arabica [arabica coffee]
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 357   3e-115   Manihot esculenta [manioc]
gb|ACX31148.1|  phenylalanine ammonialyase                              356   4e-115   Brassica juncea subsp. napiformis [jie cai ge da]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           358   4e-115   Scutellaria baicalensis [Baikal skullcap]
gb|AAZ29732.1|  phenylalanine ammonia lyase                             358   4e-115   Trifolium pratense [peavine clover]
gb|AAZ29734.1|  phenylalanine ammonia lyase                             358   4e-115   Trifolium pratense [peavine clover]
gb|ABB70117.2|  phenylalanine ammonia lyase                             358   4e-115   Pyrus communis
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        358   5e-115   Cucumis melo [Oriental melon]
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             358   5e-115   Capsella rubella
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                358   6e-115   Erythranthe guttata [common monkey flower]
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    358   6e-115   Petroselinum crispum
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             358   6e-115   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        358   7e-115   Cicer arietinum [garbanzo]
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      357   8e-115   Arabidopsis lyrata subsp. lyrata
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             357   8e-115   Populus tomentosa [Chinese white poplar]
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   9e-115   Citrus sinensis [apfelsine]
gb|AFF60415.1|  phenylalanine ammonia lyase                             355   1e-114   Pyrus pyrifolia [sha li]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        357   1e-114   Medicago truncatula
gb|AGE10591.1|  phenylalanine amononia-lyase                            357   1e-114   Lonicera japonica [Japanese honeysuckle]
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             357   1e-114   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   357   1e-114   Citrus sinensis [apfelsine]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       357   1e-114   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_004173358.1|  PREDICTED: phenylalanine ammonia-lyase-like        353   1e-114   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            357   1e-114   Citrus clementina x Citrus reticulata
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   1e-114   Cucumis sativus [cucumbers]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           357   1e-114   Manihot esculenta [manioc]
gb|AGA19032.1|  phenylalanine ammonia-lyase                             349   2e-114   Boehmeria nivea [Chinese silk-plant]
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       357   2e-114   
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    352   2e-114   
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 357   2e-114   
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             358   2e-114   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             357   2e-114   
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   356   2e-114   
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            355   2e-114   
gb|AAZ29733.1|  phenylalanine ammonia lyase                             356   2e-114   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         356   2e-114   
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    356   2e-114   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    356   2e-114   
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    356   2e-114   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             356   2e-114   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      356   2e-114   
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        356   2e-114   
gb|AGZ59815.1|  phenylalanine ammonia lyase                             352   2e-114   
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           356   3e-114   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    356   3e-114   
gb|AGL50914.1|  phenylalanine ammonia lyase                             356   3e-114   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             356   3e-114   
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             356   3e-114   
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 356   3e-114   
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             356   3e-114   
gb|ADY02660.1|  phenylalanine ammonia lyase                             355   3e-114   
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            356   3e-114   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        355   3e-114   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        355   4e-114   
gb|ADY02662.1|  phenylalanine ammonia lyase                             355   4e-114   
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           356   4e-114   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             355   5e-114   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             355   6e-114   
gb|ACS71953.1|  phenylalanine ammonia-lyase                             355   6e-114   
emb|CDX76219.1|  BnaA04g04830D                                          349   6e-114   
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     352   6e-114   
gb|AHA42443.1|  phenylalanine ammonia lyase                             355   7e-114   
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       355   7e-114   
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            352   7e-114   
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    355   7e-114   
gb|AHC29062.1|  phenylalanine ammonia lyase                             351   8e-114   
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    355   9e-114   
gb|AGZ59813.1|  phenylalanine ammonia lyase                             351   9e-114   
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           355   9e-114   
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    355   9e-114   
gb|AAU08174.1|  phenylalanine ammonia-lyase                             355   1e-113   
gb|AHC29063.1|  phenylalanine ammonia lyase                             350   1e-113   
gb|AFR45307.1|  putative phenylalanine ammonia-lyase                    346   1e-113   
gb|AGZ59814.1|  phenylalanine ammonia lyase                             350   1e-113   
gb|AAX22055.1|  phenylalanine ammonia-lyase                             355   1e-113   
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            355   1e-113   
gb|AGZ59812.1|  phenylalanine ammonia lyase                             350   1e-113   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        354   1e-113   
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      354   1e-113   
gb|AAD45384.1|  phenylalanine ammonia-lyase                             352   1e-113   
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             354   2e-113   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             354   2e-113   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           354   2e-113   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             353   2e-113   
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                354   2e-113   
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                356   2e-113   
gb|ACM44926.1|  phenylalanine ammonia-lyase                             354   2e-113   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             353   2e-113   
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       354   2e-113   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      354   2e-113   
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        353   2e-113   
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   353   3e-113   
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                353   3e-113   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             353   3e-113   
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      353   3e-113   
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      353   3e-113   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             352   4e-113   
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   353   4e-113   
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           353   4e-113   
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        352   4e-113   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    353   4e-113   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      353   4e-113   
gb|AAX22053.1|  phenylalanine ammonia-lyase                             353   4e-113   
gb|AFG30054.1|  phenylalanine ammonialyase                              353   5e-113   
gb|ABC69916.1|  phenylalanine ammonia-lyase                             353   6e-113   
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           352   6e-113   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    353   6e-113   
gb|AAC18871.1|  phenylalanine ammonia lyase                             352   6e-113   
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    352   6e-113   
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           352   8e-113   
gb|AFP24940.1|  phenylalanine ammonia lyase                             352   8e-113   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             352   8e-113   
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     352   9e-113   
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             352   9e-113   
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             352   1e-112   
gb|ABF50788.1|  phenylalanine ammonia-lyase                             352   1e-112   
gb|AEJ88223.1|  phenylalanine ammonia lyase                             352   1e-112   
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      352   1e-112   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            352   1e-112   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             351   2e-112   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             351   2e-112   
gb|ACM62741.1|  phenylalanine ammonia-lyase                             351   2e-112   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    351   3e-112   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      351   3e-112   
gb|KGN48167.1|  hypothetical protein Csa_6G446290                       350   3e-112   
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           351   3e-112   
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        350   3e-112   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           350   4e-112   
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           351   4e-112   
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         351   4e-112   
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       350   4e-112   
gb|AAY82486.1|  phenylalanine ammonia-lyase                             347   5e-112   
gb|ABE03772.1|  phenylalanine ammonia-lyase                             350   5e-112   
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             350   6e-112   
gb|AAC18870.1|  phenylalanine ammonia lyase                             350   6e-112   
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       350   6e-112   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      350   6e-112   
gb|AJO53272.1|  phenylalanine ammonia-lyase                             350   6e-112   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             350   7e-112   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             349   7e-112   
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           350   8e-112   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           350   9e-112   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             349   1e-111   
gb|ACA30407.1|  phenylalanine ammonia-lyase                             349   1e-111   
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       347   1e-111   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    349   1e-111   
gb|AHY94892.1|  phenylalanine ammonia lyase                             349   1e-111   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             349   1e-111   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             349   1e-111   
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    348   1e-111   
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    349   1e-111   
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      349   1e-111   
gb|AIL23235.1|  phenylalanine ammonia-lyase                             348   2e-111   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      348   3e-111   
gb|AAW78932.1|  phenylalanine-ammonia lyase                             348   4e-111   
dbj|BAH20339.1|  AT3G53260                                              343   4e-111   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             347   5e-111   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        347   5e-111   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    347   5e-111   
gb|AHB18376.1|  phenylalanine ammonia-lyase 4                           345   6e-111   
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           345   7e-111   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           347   7e-111   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         347   8e-111   
prf||2001451A  Phe ammonia lyase                                        347   1e-110
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             347   1e-110   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             345   1e-110   
gb|ACG80828.1|  phenylalanine ammonia lyase                             343   1e-110   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    346   1e-110   
ref|XP_004171092.1|  PREDICTED: phenylalanine ammonia-lyase-like        346   1e-110   
gb|AAX84839.1|  phenylalanine ammonia-lyase                             346   2e-110   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           346   2e-110   
emb|CAB97358.1|  phenylalanine ammonia-lyase                            332   2e-110   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             345   2e-110   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             345   2e-110   
prf||2006271A  Phe ammonia lyase                                        346   3e-110
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              345   3e-110   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             345   3e-110   
gb|ADD82537.1|  phenylalanine ammonia-lyase                             342   3e-110   
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase-like        345   4e-110   
ref|XP_008456500.1|  PREDICTED: phenylalanine ammonia-lyase G4          345   4e-110   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             345   4e-110   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           344   7e-110   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             344   7e-110   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          344   8e-110   
emb|CDY00922.1|  BnaC05g42780D                                          344   1e-109   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            344   1e-109   
gb|ABS58596.1|  phenylalanine ammonia-lyase                             328   1e-109   
gb|ADD12041.1|  phenylalanine ammonia lyase                             343   2e-109   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             343   2e-109   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            344   2e-109   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            343   2e-109   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 343   4e-109   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        342   4e-109   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                342   4e-109   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             342   6e-109   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           342   6e-109   
emb|CDY08611.1|  BnaA05g28470D                                          341   1e-108   
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            337   1e-108   
gb|ACG80829.1|  phenylalanine ammonia lyase                             337   2e-108   
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            328   2e-108   
gb|ACZ36441.1|  phenylalanine ammonialyase                              340   3e-108   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            339   5e-108   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            339   6e-108   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            340   6e-108   
ref|XP_009421282.1|  PREDICTED: phenylalanine ammonia-lyase-like        339   7e-108   
emb|CAA53733.1|  phenylanaline ammonia-lyase                            337   7e-108   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           339   8e-108   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             340   9e-108   
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        338   2e-107   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        338   2e-107   
gb|ACZ44833.1|  phenylalanine ammonia-lyase                             338   2e-107   
gb|AAL14120.1|  phenylalanine ammonia-lyase                             323   2e-107   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             337   5e-107   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             337   6e-107   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        337   1e-106   
gb|AHF20178.1|  phenylalanine ammonia lyase                             333   2e-106   
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             335   2e-106   
gb|ACM47229.1|  phenylalanine ammonia-lyase                             335   2e-106   
ref|XP_004953155.1|  PREDICTED: phenylalanine ammonia-lyase-like        335   3e-106   
ref|XP_004953156.1|  PREDICTED: phenylalanine ammonia-lyase-like        335   3e-106   
ref|XP_004953157.1|  PREDICTED: phenylalanine ammonia-lyase-like        335   3e-106   
gb|ACM45574.1|  phenylalanine ammonia-lyase                             335   4e-106   
gb|ACM45590.1|  phenylalanine ammonia-lyase                             335   4e-106   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        335   4e-106   
gb|ACG56647.1|  phenylalanine ammonia lyase                             335   5e-106   
ref|NP_001047483.2|  Os02g0626600                                       334   5e-106   
gb|ACM45573.1|  phenylalanine ammonia-lyase                             334   5e-106   
ref|XP_007143725.1|  hypothetical protein PHAVU_007G096100g             334   6e-106   
gb|ACG56648.1|  phenylalanine ammonia lyase                             334   7e-106   
ref|XP_002454200.1|  hypothetical protein SORBIDRAFT_04g026530          334   8e-106   
gb|EAY86765.1|  hypothetical protein OsI_08145                          334   8e-106   
ref|XP_002452479.1|  hypothetical protein SORBIDRAFT_04g026560          334   9e-106   
gb|AGC23439.1|  phenylalanine ammonia-lyase                             333   1e-105   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        333   1e-105   
emb|CDO99754.1|  unnamed protein product                                332   1e-105   
ref|NP_001047484.1|  Os02g0627100                                       333   2e-105   
sp|A2X7F7.1|PAL2_ORYSI  RecName: Full=Phenylalanine ammonia-lyase       333   2e-105   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       333   2e-105   
gb|ACT22906.1|  phenylalanine ammonia-lyase                             329   2e-105   
ref|XP_009383964.1|  PREDICTED: phenylalanine ammonia-lyase-like        332   2e-105   
gb|AAR24505.1|  phenylalanine ammonia-lyase                             333   3e-105   
gb|AIC66437.1|  phenylalanine ammonia lyase                             332   4e-105   
ref|XP_006647544.1|  PREDICTED: phenylalanine ammonia-lyase-like        332   4e-105   
dbj|BAJ87762.1|  predicted protein                                      332   6e-105   
ref|XP_007142542.1|  hypothetical protein PHAVU_008G289500g             332   6e-105   
prf||1807329B  Phe ammonia lyase                                        332   7e-105
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        332   7e-105   
gb|EMT07760.1|  Phenylalanine ammonia-lyase                             332   8e-105   



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   383 bits (983),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 200/216 (93%), Positives = 209/216 (97%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFGTGT  G+ HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  126  RFLNAGIFGTGT--GASHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  183

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GEALTAEEA KLAGVQGGFFELQ
Sbjct  184  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALTAEEAFKLAGVQGGFFELQ  243

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LAVLSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  244  PKEGLALVNGTAVGSGMASMVLFEANVLAVLSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  303

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILD S++MKAAQKLHEMDPLQKP+
Sbjct  304  PGQIEAAAIMEHILDRSYYMKAAQKLHEMDPLQKPK  339



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   382 bits (981),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/216 (90%), Positives = 206/216 (95%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGL+TGRPNSKAVGP GE L AEEAL+LAGV GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLITGRPNSKAVGPNGETLNAEEALRLAGVNGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LAVLSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGMASMVLFEANVLAVLSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYVKAAQKMHEMDPLQKPK  342



>emb|CAL91171.1| phenylalanine ammonia-lyase 2 [Cynara cardunculus var. scolymus]
Length=373

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN ++T
Sbjct  46   RFLNAGIFGSGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNVT  103

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AE+A  LAGV GGFF+LQ
Sbjct  104  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGDLLNAEKAFSLAGVSGGFFDLQ  163

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  164  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  223

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQ +HEMDPLQKP+
Sbjct  224  PGQIEAAAIMEYILDGSDYVKAAQMVHEMDPLQKPK  259



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   379 bits (973),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 205/216 (95%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT  GSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  135  RFLNAGVFGNGT--GSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPN+KAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNAKAVGPNGEKLNAEEAFRVAGVSGGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  348



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   379 bits (972),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 205/216 (95%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT  GSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  135  RFLNAGVFGNGT--GSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPN+KAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNAKAVGPNGEKLNAEEAFRVAGVSGGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  348



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   378 bits (971),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 205/216 (95%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  132  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE++ A EA +LAG++ GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESMDALEAFRLAGIESGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  345



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   377 bits (969),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 205/216 (95%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  132  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE++ A EA +LAG++ GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESMDALEAFRLAGIESGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  345



>gb|AAU85591.1| phenylalanine ammonia-lyase [Olea europaea]
Length=226

 Score =   361 bits (926),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 199/215 (93%), Gaps = 2/215 (1%)
 Frame = +1

Query  121  FLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITP  300
            FLNAGIFG G    SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+ITP
Sbjct  1    FLNAGIFGNGIE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITP  58

Query  301  CLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQP  480
            CLPLRG+I++SGD+VPLSYIAG+LTGRPNSKAVGP GE L A+EA KLAGV G FFELQP
Sbjct  59   CLPLRGTISSSGDLVPLSYIAGMLTGRPNSKAVGPTGETLNAKEAFKLAGVDGDFFELQP  118

Query  481  KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  660
            KEGLALVNGTAVGSG+AS+VL+EAN+L V SEVLSAIFAEVM+GKPEFTDHL HKLKHHP
Sbjct  119  KEGLALVNGTAVGSGLASIVLYEANVLTVFSEVLSAIFAEVMNGKPEFTDHLTHKLKHHP  178

Query  661  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            GQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  179  GQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  213



>dbj|BAF96940.1| phenylalanine ammonia lyase [Nicotiana tabacum]
Length=410

 Score =   367 bits (941),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLP S TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  85   RFLNAGVFGNGTE--SCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  142

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE L AEEA ++AGV  GFFELQ
Sbjct  143  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLNAEEAFRVAGVNSGFFELQ  202

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAV SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  203  PKEGLALVNGTAVGSGLASMVLFDANILAVFSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  262

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KA QKLHE DPLQKP+
Sbjct  263  PGQIEAAAIMEHILDGSSYVKAPQKLHETDPLQKPK  298



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   376 bits (966),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/216 (91%), Positives = 205/216 (95%), Gaps = 4/216 (2%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFGTGT     HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  127  RFLNAGIFGTGT----GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  182

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LTAEEA KLAGV GGFFELQ
Sbjct  183  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLTAEEAFKLAGVNGGFFELQ  242

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LAVLSEVLSAIFAE M+GKPEFTDHL HKLKHH
Sbjct  243  PKEGLALVNGTAVGSGMASMVLFEANVLAVLSEVLSAIFAEAMNGKPEFTDHLTHKLKHH  302

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS++MKAAQKLHEMDPLQKP+
Sbjct  303  PGQIEAAAIMEHILDGSYYMKAAQKLHEMDPLQKPK  338



>gb|ABV26012.1| phenylalanine ammonia-lyase [Musa acuminata]
Length=501

 Score =   369 bits (948),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 200/216 (93%), Gaps = 4/216 (2%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  45   RFLNAGVFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  102

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A+EA + AG   GFFELQ
Sbjct  103  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGETLDAKEASQRAGF--GFFELQ  160

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  161  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  220

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  221  PGQIEAAAIMEHILDGSSYIKAAKKLHEMDPLQKPK  256



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   374 bits (959),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN++IT
Sbjct  129  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AE A   AGV+GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEVLNAESAFAQAGVEGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  307  PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  342



>gb|ACR10243.1| phenylalanine ammonia-lyase [Canarium album]
Length=639

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   +CHTLPHSATRAAMLVR NTLLQGYSGIRF+ILEAITK LNH+IT
Sbjct  84   RFLNAGVFGNGTE--TCHTLPHSATRAAMLVRTNTLLQGYSGIRFDILEAITKFLNHNIT  141

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L   EA +LAGV GGFFELQ
Sbjct  142  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGRVLNPTEAFQLAGVNGGFFELQ  201

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LA+LSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  202  PKEGLALVNGTAVGSGLASMVLFEANVLAILSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  261

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  262  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  297



>gb|ABI93975.1| putative phenylalanine ammonia-lyase, partial [Rhizophora mangle]
Length=579

 Score =   370 bits (949),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  136  RFLNAGIFGHGT--DSCHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD++PLSYIAGLLTGRPNSKA+GP G++L A EA +LAG++ GFFELQ
Sbjct  194  PCLPLRGTITASGDLIPLSYIAGLLTGRPNSKAIGPDGQSLNAGEAFRLAGIESGFFELQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVL+E+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  254  PKEGLALVNGTAVGSGLASMVLFEANILAVLAEMLSAIFAEVMNGKPEFTDHLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+++HEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILDGSSYMKEAKRIHEMDPLQKPK  349



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   374 bits (960),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G   G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  135  RFLNAGIFGSGAEAGN-NTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEA KLAGV+GGFFELQ
Sbjct  194  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSPEEAFKLAGVEGGFFELQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  254  PKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  349



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN ++T
Sbjct  131  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AE+A  LAGV GGFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEILNAEKAFSLAGVSGGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQKLHEMDPLQKP+
Sbjct  309  PGQIEAAAIMEYILDGSDYVKAAQKLHEMDPLQKPK  344



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|AGO01926.1| phenylalanine ammonia-lyase 3, partial [Lycium barbarum]
Length=561

 Score =   369 bits (947),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  29   RFLNAGVFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINTNIT  86

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  87   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVSGGFFELQ  146

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+N+LAV+SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  147  PKEGLALVNGTAVGSGMASMVLFESNVLAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  206

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  207  PGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  242



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G   G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  132  RFLNAGIFGSGAEAGN-NTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEA KLAGV+GGFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSPEEAFKLAGVEGGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  346



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 203/216 (94%), Gaps = 1/216 (0%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G   G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  132  RFLNAGIFGSGAEAGN-NTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEA KLAGV+GGFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSPEEAFKLAGVEGGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  346



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   374 bits (959),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLP S TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  130  RFLNAGVFGNGTE--SCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAV SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFDANILAVFSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  343



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   373 bits (957),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLP S TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  130  RFLNAGVFGNGTE--SCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+AN+LAV SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFDANVLAVFSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  343



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   373 bits (957),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLP S TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  130  RFLNAGVFGNGTE--SCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+AN+LAV SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFDANVLAVFSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  343



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG+Q GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIQSGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEV SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVSSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  125  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  182

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYI GLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  183  PCLPLRGTVTASGDLVPLSYIXGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  242

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  243  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  302

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  303  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  338



>gb|AGO01924.1| phenylalanine ammonia-lyase 1, partial [Lycium barbarum]
Length=561

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  29   RFLNAGVFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINTNIT  86

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  87   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVSGGFFELQ  146

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+N+LAV+SEVLSA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  147  PKEGLALVNGTAVGSGMASMVLFESNVLAVMSEVLSAVFAEVMNGKPEFTDHLTHKLKHH  206

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  207  PGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  242



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  140  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  197

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L A+EA  +AG+  GFF LQ
Sbjct  198  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGESLDAQEAFCVAGIDTGFFVLQ  257

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  258  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  317

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  318  PGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  353



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLP+SATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNGTE--SCHTLPYSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|AGO01925.1| phenylalanine ammonia-lyase 2, partial [Lycium barbarum]
Length=561

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  29   RFLNAGVFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINTNIT  86

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  87   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVSGGFFELQ  146

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+N+LAV+SEVLSA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  147  PKEGLALVNGTAVGSGMASMVLFESNVLAVMSEVLSAVFAEVMNGKPEFTDHLTHKLKHH  206

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  207  PGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  242



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G  + SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNG--RESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--STHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A EA  LAG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  342



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   372 bits (955),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLP S+TRAAMLVRINTLLQGYSGIRFEILEAITKL+NH++T
Sbjct  129  RFLNAGVFGNGTE--SCHTLPQSSTRAAMLVRINTLLQGYSGIRFEILEAITKLINHNVT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA  +AGV GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFHVAGVNGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLF+AN+LAV SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIVLFDANVLAVFSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  342



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   372 bits (955),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNGT--DSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PSLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFEANVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   372 bits (954),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--STHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A EA  LAG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  342



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   372 bits (954),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G  + SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNG--RESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   372 bits (954),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT     HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  135  RFLNAGVFGNGTETN--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  348



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG  T   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  129  RFLNAGIFGNATE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GEAL A+EA KLAGV GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALNADEAFKLAGVHGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EAN+LAVLSEV+SA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIALYEANVLAVLSEVMSAVFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  342



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  133  RFLNAGVFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVNGGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  346



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  133  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A EA + AG++ GFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFEAAGIESGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  346



>pir||S60043 phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanese aspen x 
large-toothed aspen (fragment)
Length=582

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 199/215 (93%), Gaps = 2/215 (1%)
 Frame = +1

Query  121  FLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITP  300
            FLNAGIFG GT   S HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNH+ITP
Sbjct  1    FLNAGIFGNGTE--STHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITP  58

Query  301  CLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQP  480
            CLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE + A EA  LAG+ GGFFELQP
Sbjct  59   CLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETMAAAEAFTLAGINGGFFELQP  118

Query  481  KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  660
            KEGLALVNGTAVGSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  119  KEGLALVNGTAVGSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHP  178

Query  661  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            GQIEAAA+MEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  179  GQIEAAAVMEHILDGSSYVKAAQKLHEIDPLQKPK  213



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G  + SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNG--RESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  146  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  203

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L AEEA ++AG+  GFF LQ
Sbjct  204  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDSGFFVLQ  263

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  264  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  323

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  324  PGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  359



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN +IT
Sbjct  131  RFLNAGIFGNGVE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNSNIT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNS AVGP G+ L A EA  LAG+ GGFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSVAVGPDGQNLNAAEAFSLAGINGGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+L VLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASMVLFEANVLGVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS+++KAAQKLHE+DPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSYYIKAAQKLHEIDPLQKPK  344



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+++T
Sbjct  135  RFLNAGIFGNGTE--ASHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LTAE+A   AGV+GGFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEILTAEKAFAQAGVEGGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  313  PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  348



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  139  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L AEEA ++AG+  GFF LQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDSGFFVLQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  352



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  139  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L AEEA ++AG+  GFF LQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDSGFFVLQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  352



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  132  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A EA K AG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   371 bits (952),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPH+ATRAAMLVRINTLLQGYSGIRFEI+EAITK LNH+IT
Sbjct  127  RFLNAGIFGNGTE--SCHTLPHTATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNIT  184

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L A +A +LAG+ GGFFELQ
Sbjct  185  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDATKAFELAGIDGGFFELQ  244

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+ AV +EVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  245  PKEGLALVNGTAVGSGLASMVLFEANVQAVFAEVLSAIFAEVMQGKPEFTDHLTHKLKHH  304

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  305  PGQIEAAAIMEHILDGSAYIKAAQKLHEIDPLQKPK  340



>ref|XP_004239660.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=709

 Score =   371 bits (952),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  133  RFLNAGVFGKGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A  A + AG++ GFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLDAINAFQQAGIESGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASMVLFEANILAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+K+HEMDPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSSYVKEAKKIHEMDPLQKPK  346



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   371 bits (952),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  130  RFLNAGIFGQGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GEAL AEEA KLAGV GGFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALNAEEAFKLAGVVGGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EANILAVLSEV+SA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASIALYEANILAVLSEVMSAVFAEVMNGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+K+HEMDPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYVKAAEKMHEMDPLQKPK  343



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   371 bits (952),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  132  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A EA K AG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  140  RFLNAGVFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  197

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV GGFFELQ
Sbjct  198  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTGGFFELQ  257

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  258  PKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  317

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  318  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  353



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   371 bits (952),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYI+GLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYISGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHE+DPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEIDPLQKPK  341



>gb|ABN79671.2| phenylalanine ammonia-lyase [Rudbeckia hirta]
Length=720

 Score =   371 bits (953),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN++IT
Sbjct  138  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNIT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE L AE A   AGV+GGFFELQ
Sbjct  196  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAMGPTGEILNAETAFAQAGVKGGFFELQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  316  PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  351



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   370 bits (951),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG  T   SCHTL HSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  130  RFLNAGIFGNKTE--SCHTLSHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L A++A   AG+  GFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAQQAFHSAGIDSGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFEANVLAVLSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHE+DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYIKAAKKLHEIDPLQKPK  343



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   370 bits (951),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN++IT
Sbjct  133  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L A EA  LAGV  GFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGHILNASEAFNLAGVNDGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE NILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASMVLFETNILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQK+HE+DPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSSYVKAAQKIHEIDPLQKPK  346



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   370 bits (951),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN +IT
Sbjct  131  RFLNAGVFGQGTE--SCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNIT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GEAL   EA   AG+ GGFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEALNPTEAFSRAGINGGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEAN+ AVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASLVLFEANVQAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYIKAAQKLHEMDPLQKPK  344



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   370 bits (950),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG GT   S HTLPHSATRAAMLVRINTLLQGYSG RFEILEAITK LNH++T
Sbjct  132  RFLNSGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGXRFEILEAITKFLNHNVT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LTAE A  LAGV GGFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEILTAEAAFGLAGVTGGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGMASMVLFEANILALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKAAEKLHEMDPLQKPK  345



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   370 bits (950),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT+LLN++IT
Sbjct  133  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITRLLNNNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A EA K AG++ GFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFKAAGIESGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  346



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   370 bits (950),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  139  RFLNAGVFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV  GFFELQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTSGFFELQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  352



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   370 bits (950),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  139  RFLNAGVFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV  GFFELQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTSGFFELQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  352



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   370 bits (950),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  129  RFLNAGIFGKGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L AEEA KLAGV GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGSELNAEEAFKLAGVSGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EANIL+VLS V+SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIALYEANILSVLSVVISAIFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  342



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLP S TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  130  RFLNAGVFGNGTE--SCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE L AEEA  +AGV  GFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLNAEEAFGVAGVNSGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAV SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFDANILAVFSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  343



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT+LLN++IT
Sbjct  133  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITRLLNNNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A EA K AG++ GFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFKAAGIESGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  346



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--STHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A EA  LAG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAAQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILNGSSYVKAAQKLHEIDPLQKPK  342



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  132  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A EA K AG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  345



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  131  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE+L A EA  LAG+  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPTGESLDAVEAFCLAGIDSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASMVLFEANVLAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA++ HE+DPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYIKAAKQSHEIDPLQKPK  344



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   + HTLPHSATRAAM+VRINTLLQGYSGIRFEILEAITK LN++IT
Sbjct  129  RFLNAGIFGNGTE--TSHTLPHSATRAAMIVRINTLLQGYSGIRFEILEAITKFLNNNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AE+A   AGV+GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEVLNAEKAFAAAGVEGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLF+AN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGMASMVLFDANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  307  PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  342



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G  + SCHTLPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNG--RESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  139  RFLNAGVFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEE  ++AGV  GFFELQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEERFRVAGVTSGFFELQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  352



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G  + SCHTLPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNG--RESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  133  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A EA K AG++ GFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPSGEVLDAVEAFKTAGIESGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  346



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LNH+IT
Sbjct  92   RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTFLNHNIT  149

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GEA  AEEA +LAG+ GGFFELQ
Sbjct  150  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEAFNAEEAFRLAGLSGGFFELQ  209

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEAN+LAVLS VLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  210  PKEGLALVNGTAVGSGLASIVLFEANVLAVLSVVLSAIFAEVMNGKPEFTDHLTHKLKHH  269

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  270  PGQIEAAAIMEHILDGSSYVKAAQKLHELDPLQKPK  305



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLP SATRAAMLVRINTLLQGYSGIRFEILEAI+K LN++IT
Sbjct  132  RFLNAGIFGNGTE--SCHTLPQSATRAAMLVRINTLLQGYSGIRFEILEAISKFLNNNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKAVGP GE L  +EA +LAGV+GGFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAVGPTGEILHPKEAFRLAGVEGGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  345



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   370 bits (949),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  134  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  191

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE +  E+A K+AGV  G FELQ
Sbjct  192  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEIVNPEQAFKMAGVNDGLFELQ  251

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  252  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  311

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA KLHEMDPLQKP+
Sbjct  312  PGQIEAAAIMEHILDGSGYVKAAHKLHEMDPLQKPK  347



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  130  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLP RG+ITASGD+VPLSYIAG+LTGRPNSKAVGP G+ LT ++A KLAGV GGFFELQ
Sbjct  188  PCLPPRGTITASGDLVPLSYIAGMLTGRPNSKAVGPSGQTLTPKDAFKLAGVNGGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFE N+LAVLSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASIVLFETNVLAVLSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSFYVKAAQKLHEMDPLQKPK  343



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  131  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE+L A EA +LA +  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPSGESLDAVEAFRLADIDSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASMVLFEANVLAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA++LHE+DPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYIKAAKQLHEIDPLQKPK  344



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH IT
Sbjct  133  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHGIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LAG+  GFF LQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAQEAFRLAGIDSGFFVLQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKE LALVNGTAVGSG+ASMVLFEANIL+VLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  251  PKESLALVNGTAVGSGLASMVLFEANILSVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAAQKLHEMDPLQKP+
Sbjct  311  PGQIEAAAIMEHILEGSSYVKAAQKLHEMDPLQKPK  346



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  128  RFLNAGIFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA +LAG+  GFFELQ
Sbjct  186  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEKINAEEAFRLAGISTGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVL+EANILAVLSEV+SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGMASMVLYEANILAVLSEVISAIFAEVMNGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSGYVKAAQKLHEMDPLQKPK  341



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G  + SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNG--RESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLL GRPNSKAVGP G+ + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLIGRPNSKAVGPSGDVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SC+TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  136  RFLNAGIFGNGTE--SCNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G++L AEEA ++AG+  GFF LQ
Sbjct  194  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLNAEEAFRVAGIDSGFFMLQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSE+LSA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  254  PKEGLALVNGTAVGSGLASMVLFEANVLAVLSEILSAVFAEVMNGKPEFTDHLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  349



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  140  RFLNAGVFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  197

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA   AGV GGFFELQ
Sbjct  198  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFCAAGVSGGFFELQ  257

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  258  PKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  317

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  318  PGQIEAAAIMEHILDGSSYVKEAQKLHEMDPLQKPK  353



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRF+ILEAITK LNH+IT
Sbjct  125  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHNIT  182

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L A EA +LAG+  GFFELQ
Sbjct  183  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQVLDASEAFQLAGITSGFFELQ  242

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LA+LSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  243  PKEGLALVNGTAVGSGLASMVLFEANVLAILSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  302

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL GS ++KAAQKLHE+DPLQKP+
Sbjct  303  PGQIEAAAIMEHILAGSGYVKAAQKLHEIDPLQKPK  338



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LNH+IT
Sbjct  129  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTFLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GEA  AEEA +LAG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEAFNAEEAFRLAGLSGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEAN+LAVLS VLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIVLFEANVLAVLSVVLSAIFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYVKAAQKLHELDPLQKPK  342



>dbj|BAL49995.1| phenylalanine ammonia-lyase [Eucalyptus robusta]
 dbj|BAL63070.1| phenylalanine ammonia-lyase [Eucalyptus robusta]
Length=715

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLP S+TRAAMLVR+NTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  133  RFLNAGIFGNGTE--SCHTLPQSSTRAAMLVRVNTLLQGYSGIRFEILEAITKFLNHNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G++L A EA +LAG+  GFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLDAVEAFRLAGIDTGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSAYVKAAKKLHEMDPLQKPK  346



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  139  RFLNAGIFGNGIE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA  +AG+  GFF LQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAQEAFHVAGIDSGFFVLQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  352



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   368 bits (945),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 200/216 (93%), Gaps = 4/216 (2%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    S +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  119  RFLNAGIFGNG----SDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNIT  174

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEA KLAGV+GGFFELQ
Sbjct  175  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVILSPEEAFKLAGVEGGFFELQ  234

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  235  PKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHH  294

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  295  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  330



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+++T
Sbjct  144  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVT  201

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKAVGP GE L AE+A   AGV+GGFFELQ
Sbjct  202  PCLPLRGTITASGDLVPLSYIAGLLTGRSNSKAVGPTGEILNAEQAFAKAGVEGGFFELQ  261

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  262  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  321

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  322  PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  357



>sp|P31426.1|PAL2_SOLTU RecName: Full=Phenylalanine ammonia-lyase 2, partial [Solanum 
tuberosum]
Length=590

 Score =   365 bits (936),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +I+
Sbjct  141  RFLNAGVFGIGTE--STHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIS  198

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP G  L AEEA ++AGV GGFFELQ
Sbjct  199  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPTGSKLDAEEAFRVAGVTGGFFELQ  258

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGS MAS+VLFE+NILAV+ EVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  259  PKEGLALVNGTAVGSAMASIVLFESNILAVMFEVLSAIFAEVMNGKPEFTDYLTHKLKHH  318

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  319  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  354



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   369 bits (947),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRA+MLVRINTLLQGYSGIRFEILEAITKL+NH+IT
Sbjct  141  RFLNAGIFGNGTE--SCHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLINHNIT  198

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+I+ASGD+VPLSYIAGLL GR + KAVGP GE L+AEEA ++AG++GGFFELQ
Sbjct  199  PCLPLRGTISASGDLVPLSYIAGLLLGRSSCKAVGPNGEPLSAEEAFRVAGIKGGFFELQ  258

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  259  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSALFAEVMQGKPEFTDHLTHKLKHH  318

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  319  PGQIEAAAIMEHILDGSSYIKAAQKLHEMDPLQKPK  354



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   369 bits (946),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCH+LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN +IT
Sbjct  128  RFLNAGVFGQGTE--SCHSLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PC+PLRGSITASGD+VPLSYIAGLLTGRPNSKA+GP GE L   EA   AG+ GGFFELQ
Sbjct  186  PCVPLRGSITASGDLVPLSYIAGLLTGRPNSKALGPNGETLNPTEAFSKAGINGGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLA+VNGTAVGSG+AS+VLFEAN+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLAMVNGTAVGSGLASLVLFEANVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYIKAAQKLHELDPLQKPK  341



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   369 bits (946),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN +IT
Sbjct  135  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNSNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A ++ + AG++ GFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPDGELLDAVQSFQRAGIETGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSALFAEVMQGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+K+HE+DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYVKEAKKIHEVDPLQKPK  348



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   369 bits (946),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  137  RFLNAGIFGNGAV--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  194

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LAG+   FFELQ
Sbjct  195  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFQLAGINSEFFELQ  254

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  255  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  314

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  315  PGQIEAAAIMEHILDGSSYMKDAKKLHEMDPLQKPK  350



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   364 bits (935),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 188/215 (87%), Positives = 199/215 (93%), Gaps = 4/215 (2%)
 Frame = +1

Query  121  FLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITP  300
            FLNAGIFG G    S +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN +ITP
Sbjct  1    FLNAGIFGNG----SDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNITP  56

Query  301  CLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQP  480
            CLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEA KLAGV+GGFFELQP
Sbjct  57   CLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVILSPEEAFKLAGVEGGFFELQP  116

Query  481  KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  660
            KEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  117  KEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHHP  176

Query  661  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            GQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  177  GQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  211



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   369 bits (946),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  132  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTG PNSKA GP GE L A EA K AG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGSPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   358 bits (920),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE+ITKLLN+++T
Sbjct  133  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILESITKLLNNNVT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LTA++A +LA +   F+ELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLTAKQAFELANINSEFYELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMAS+VLF+ANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGMASIVLFDANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHE+DPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSSYMKDAKKLHEIDPLQKPK  346



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   368 bits (945),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  132  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTG PNSKA GP GE L A EA K AG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGSPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   369 bits (946),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN +IT
Sbjct  135  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNSNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A +A + AG++ GFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPDGELLDAVQAFQRAGIETGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSALFAEVMQGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+K+HE+DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYVKEAKKIHEVDPLQKPK  348



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   368 bits (945),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEI+EAITK LNH+IT
Sbjct  129  RFLNAGIFGNGTE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L+AEEA KLAGV GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLSAEEAFKLAGVSGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EANIL VLSEV+SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIALYEANILGVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  342



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   368 bits (945),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  138  RFLNAGIFGHGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AG+  GFF LQ
Sbjct  196  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAEEAFRVAGIDSGFFVLQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  316  PGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  351



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   368 bits (945),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--STHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE LTA EA  LAG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKALGPNGEPLTAAEAFTLAGINGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAA+MEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAVMEHILDGSSYVKAAQKLHEIDPLQKPE  342



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   365 bits (937),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEI+EAI+K LNH+IT
Sbjct  37   RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAISKFLNHNIT  94

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSY+AGLL GRPNSK++GP G+ L A+EA +LAG+ GGFFELQ
Sbjct  95   PCLPLRGTITASGDLVPLSYVAGLLIGRPNSKSIGPNGQVLNAKEAFQLAGIDGGFFELQ  154

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEAN+L +LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  155  PKEGLALVNGTAVGSGLASVVLFEANLLVILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  214

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  215  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  250



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   368 bits (944),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G  + SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RFLNAGIFGNG--RESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLS IAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSDIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   368 bits (944),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLP S TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  130  RFLNAGVFGNGTE--SCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE L AEEA ++AGV  GFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLNAEEAFRVAGVNSGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAV SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFDANILAVFSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KA QKLHE DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYVKAPQKLHETDPLQKPK  343



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   368 bits (944),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA+TK L+H+IT
Sbjct  129  RFLNAGVFGNGTE--STHTLPHSATRAAMLVRINTLLQGYSGIRFEILEALTKFLDHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA  LAG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGETLNAEEAFTLAGINGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVISAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  342



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   368 bits (944),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 200/216 (93%), Gaps = 4/216 (2%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    S +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  136  RFLNAGIFGNG----SDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNIT  191

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEA KLAGV+GGFFELQ
Sbjct  192  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVILSPEEAFKLAGVEGGFFELQ  251

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  252  PKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHH  311

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  312  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  347



>gb|ACT21093.1| phenylalanine ammonia-lyase [Camellia oleifera]
Length=706

 Score =   367 bits (943),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHS+TRAAMLVRINTLLQGYSGIRFEILEA+TKL+NH+IT
Sbjct  124  RFLNAGIFGNGTE--SCHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEALTKLINHNIT  181

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAG+LTGRPNSK VGP GE L A EA + AG+ GGFFELQ
Sbjct  182  PCLPLRGTITASGDLVPLSYIAGVLTGRPNSKCVGPTGEPLDATEAFRRAGIDGGFFELQ  241

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLF+AN+LAVLS VLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  242  PKEGLALVNGTAVGSGLASIVLFDANVLAVLSVVLSAIFAEVMQGKPEFTDHLTHKLKHH  301

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEH+LDGS ++KAAQKLHEMDPLQKP+
Sbjct  302  PGQIEAAAIMEHVLDGSSYVKAAQKLHEMDPLQKPK  337



>gb|AAW51923.2| phenylalanine ammonia-lyase 2 [Rhizophora mangle]
Length=723

 Score =   368 bits (945),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 204/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  136  RFLNAGIFGHGT--DSCHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD++PLSYIAGLLTGRPNSKA+GP G++L A EA +LAG++ GFFELQ
Sbjct  194  PCLPLRGTITASGDLIPLSYIAGLLTGRPNSKAIGPDGQSLNAGEAFRLAGIESGFFELQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVL+E+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  254  PKEGLALVNGTAVGSGLASMVLFEANILAVLAEMLSAIFAEVMNGKPEFTDHLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+++HEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILDGSSYMKEAKRIHEMDPLQKPK  349



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   368 bits (944),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI KL+N +IT
Sbjct  135  RFLNAGVFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIAKLINSNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAV P GE L AEEA ++AGV GGFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVSPNGETLNAEEAFRVAGVNGGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  348



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   368 bits (944),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPH+ TRAA+LVRINTLLQGYSGIRFEILEA+TKLLN ++T
Sbjct  144  RFLNAGIFGNGTE--SCHTLPHTTTRAALLVRINTLLQGYSGIRFEILEAMTKLLNSNVT  201

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE+LTA +A K+AG+  GFFELQ
Sbjct  202  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQ  261

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  262  PKEGLALVNGTAVGSGLASMVLFDANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  321

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  322  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  357



>ref|XP_010032174.1| PREDICTED: phenylalanine ammonia-lyase-like [Eucalyptus grandis]
 gb|KCW51577.1| hypothetical protein EUGRSUZ_J01079 [Eucalyptus grandis]
Length=715

 Score =   367 bits (943),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLP S+TRAAMLVR+NTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  133  RFLNAGIFGNGTE--SCHTLPQSSTRAAMLVRVNTLLQGYSGIRFEILEAITKFLNHNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G++L A EA +LAG+  GFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLDAVEAFRLAGIDTGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLF+ANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASIVLFDANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSAYVKAAKKLHEMDPLQKPK  346



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   368 bits (944),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  137  RFLNAGVFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  194

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA ++AGV GGFFELQ
Sbjct  195  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLDADEAFRVAGVSGGFFELQ  254

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMAS+VL+++NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  255  PKEGLALVNGTAVGSGMASIVLYDSNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  314

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  315  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  350



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   367 bits (943),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH++T
Sbjct  129  RFLNAGIFGKGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNVT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L +EEA KLAGV GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEDLNSEEAFKLAGVTGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EAN+L++L+EV+SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIALYEANVLSLLAEVMSAIFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDG+ ++KAAQK+HEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGNSYVKAAQKMHEMDPLQKPK  342



>gb|AGO01927.1| phenylalanine ammonia-lyase 4, partial [Lycium barbarum]
Length=554

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHS TRAAM+VRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  29   RFLNAGIFGNGTE--SCHTLPHSTTRAAMVVRINTLLQGYSGIRFEILEAITKLLNNNIT  86

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA GP GE L A +A + AG+  GFFELQ
Sbjct  87   PCLPLRGTITASGDLVPLSYIAGLLTGRANSKATGPNGELLDAVKAFQRAGIDTGFFELQ  146

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  147  PKEGLALVNGTAVGSGLASMVLFDANILAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  206

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+K+HEMDPLQKP+
Sbjct  207  PGQIEAAAIMEHILDGSSYVKEAKKIHEMDPLQKPK  242



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/216 (88%), Positives = 200/216 (93%), Gaps = 4/216 (2%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    S +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  136  RFLNAGIFGNG----SDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNIT  191

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEA KLAGV+GGFFELQ
Sbjct  192  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVILSPEEAFKLAGVEGGFFELQ  251

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  252  PKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHH  311

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  312  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  347



>gb|AFJ80777.1| phenylalanine ammonia-lyase [Camellia japonica]
Length=706

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHS+TRAAMLVRINTLLQGYSGIRFEILEA+TKL+NH+IT
Sbjct  124  RFLNAGIFGNGTE--SCHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEALTKLINHNIT  181

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAG+LTGRPNSK VGP GE L A EA + AG+ GGFFELQ
Sbjct  182  PCLPLRGTITASGDLVPLSYIAGVLTGRPNSKCVGPTGEPLDATEAFRRAGIDGGFFELQ  241

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLF+AN+LAVLS VLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  242  PKEGLALVNGTAVGSGLASIVLFDANVLAVLSVVLSAIFAEVMQGKPEFTDHLTHKLKHH  301

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEH+LDGS ++KAAQKLHEMDPLQKP+
Sbjct  302  PGQIEAAAIMEHVLDGSSYVKAAQKLHEMDPLQKPK  337



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  139  RFLNAGVFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA  +AGV  GFFELQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFHVAGVTSGFFELQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILDGSSYVKEAQKLHEMDPLQKPK  352



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  137  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  194

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA G  GE L A  A +LAG+  GFFELQ
Sbjct  195  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGANGELLDAVMAFQLAGIDTGFFELQ  254

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  255  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  314

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+K+HEMDPLQKP+
Sbjct  315  PGQIEAAAIMEHILDGSSYVKEAKKIHEMDPLQKPK  350



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  138  RFLNAGVFGHGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AG+  GFF LQ
Sbjct  196  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAEEAFRVAGIDSGFFVLQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  316  PGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  351



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 203/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SC+TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  136  RFLNAGIFGNGTE--SCNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G++L AEEA ++AG+  GFF LQ
Sbjct  194  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLNAEEAFRVAGIDSGFFMLQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+L VLSE+LSA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  254  PKEGLALVNGTAVGSGLASMVLFEANVLVVLSEILSAVFAEVMNGKPEFTDHLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  349



>gb|KHN02334.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=619

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  37   RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  94

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LA +   FFELQ
Sbjct  95   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELASINSEFFELQ  154

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  155  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  214

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  215  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  250



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT    CHTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA+TK LNH+IT
Sbjct  129  RFLNAGIFGKGTE--GCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKFLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA KLAGV GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEELNAEEAFKLAGVSGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EAN+LA+L+EV+SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIALYEANVLALLAEVMSAIFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKAAQKMHEMDPLQKPK  342



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            R LNAGIFG+GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  133  RSLNAGIFGSGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNKNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G  L AEEA KL GV GGFFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGATLNAEEAFKLVGVNGGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EANILA+LSEV+SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASIALYEANILALLSEVMSAIFAEVMNGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSSYVKAAQKVHEMDPLQKPK  346



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPH+ TRAA+LVRINTLLQGYSGIRFEILEA+TKLLN ++T
Sbjct  144  RFLNAGIFGNGTE--SCHTLPHTTTRAALLVRINTLLQGYSGIRFEILEAMTKLLNGNVT  201

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE+LTA +A K+AG+  GFFELQ
Sbjct  202  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQ  261

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  262  PKEGLALVNGTAVGSGLASMVLFDANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  321

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  322  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  357



>gb|AHL27351.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27352.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27353.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27354.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27355.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27356.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27358.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27359.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27360.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27361.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27362.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27363.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27364.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27365.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27366.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27367.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27368.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27369.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27370.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27371.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27372.1| phenylalanine ammonia-lyase, partial [Glycine soja]
 gb|AHL27373.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27374.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27375.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27376.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27377.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27378.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27379.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27380.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27381.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27382.1| phenylalanine ammonia-lyase, partial [Glycine max]
 gb|AHL27383.1| phenylalanine ammonia-lyase, partial [Glycine max]
Length=208

 Score =   349 bits (896),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 194/210 (92%), Gaps = 2/210 (1%)
 Frame = +1

Query  121  FLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITP  300
            FLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++TP
Sbjct  1    FLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTP  58

Query  301  CLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQP  480
            CLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LA +   FFELQP
Sbjct  59   CLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELASINSEFFELQP  118

Query  481  KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  660
            KEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  119  KEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHP  178

Query  661  GQIEAAAIMEHILDGSHFMKAAQKLHEMDP  750
            GQIEAAAIMEHILDGS +MKAA+KLHE+DP
Sbjct  179  GQIEAAAIMEHILDGSSYMKAAKKLHEIDP  208



>gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  126  RFLNAGIFGSGAE--SDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  183

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+  A+EA + AG+  GFFELQ
Sbjct  184  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESFDAKEAFQQAGIPSGFFELQ  243

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  244  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  303

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  304  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  339



>ref|XP_004143256.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=712

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  130  RFLNAGIFGSGAE--SDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE+L A+EA + AG+  GFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESLDAKEAFQQAGIPSGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  343



>gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG G+   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNH++T
Sbjct  131  RFLNSGIFGNGSE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L A+ A + AG+  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRAAMLVRINTLLQGYSGI FEILEAITKLLN++IT
Sbjct  132  RFLNAGIFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGICFEILEAITKLLNNNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A EA K AG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGIDSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIE AAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  310  PGQIETAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>gb|AGU91428.1| phenylalanine ammonia-lyase [Chrysanthemum boreale]
Length=709

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN ++T
Sbjct  127  RFLNAGIFGNGTE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNVT  184

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AE+A  LAGV GGFFELQ
Sbjct  185  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGQILNAEKAFSLAGVDGGFFELQ  244

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  245  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  304

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAA K+HEMDPLQKP+
Sbjct  305  PGQIEAAAIMEYILDGSDYVKAAAKVHEMDPLQKPK  340



>emb|CAC81822.1| phenylalanine ammonia-lyase [Beta vulgaris]
Length=396

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT LLN++IT
Sbjct  40   RFLNAGVFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITGLLNNNIT  97

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AE+A K A +  GFFELQ
Sbjct  98   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAEQAFKAAQISSGFFELQ  157

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMAS+VLFE NILAVL+EV+SA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  158  PKEGLALVNGTAVGSGMASIVLFETNILAVLAEVISAVFAEVMNGKPEFTDHLTHKLKHH  217

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+ LHE+DPLQKP+
Sbjct  218  PGQIEAAAIMEHILDGSSYMKAAKALHELDPLQKPK  253



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  133  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+IT SGD+VPLSYIAGLLTGRPNSKAVG  GE LT +EA +LAG+   FF LQ
Sbjct  191  PCLPLRGTITTSGDLVPLSYIAGLLTGRPNSKAVGTSGELLTPKEAFQLAGIDSDFFGLQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIF EVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFTEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAAQKLHE+DPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSSYMKAAQKLHEIDPLQKPK  346



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  126  RFLNAGIFGSGAE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  183

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE   A+EA + AG+  GFFELQ
Sbjct  184  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGENFDAKEAFQQAGIPSGFFELQ  243

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  244  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  303

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  304  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  339



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT + +C TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  130  RFLNAGIFGNGT-ESNC-TLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LAG+   FFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQLAGIGSDFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEAN+LAVLSEV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASIVLFEANVLAVLSEVMSAIFAEVMQGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSAYVKAAKKLHETDPLQKPK  343



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   366 bits (940),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+ G GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  139  RFLNAGVLGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV  GFFELQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTSGFFELQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+NIL V+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGMASMVLFESNILVVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  352



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRF+ILEAITK LNH+IT
Sbjct  125  RFLNAGIFGSGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHNIT  182

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYI GLLTGRPNSKAVGP G+ L A  A +LAG+  GFFELQ
Sbjct  183  PCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPNGQVLNASAAFQLAGISSGFFELQ  242

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFEANILA+LSEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  243  PKEGLALVNGTAVGSGLASTVLFEANILAILSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  302

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL GS ++KAAQKLHE+DPLQKP+
Sbjct  303  PGQIEAAAIMEHILAGSGYVKAAQKLHEIDPLQKPK  338



>ref|XP_004143257.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156292.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=710

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  128  RFLNAGIFGSGAE--SDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+  A+EA + AG+  GFFELQ
Sbjct  186  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESFDAKEAFQQAGIPSGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  341



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  133  RFLNAGIFGNGTE--SCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A++A + A +   FFELQ
Sbjct  191  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGELLNAKQAFQSANINSDFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLF+ANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGSGLASIVLFDANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHE+DPLQKP+
Sbjct  311  PGQIEAAAIMEHILDGSSYMKDAKKLHEIDPLQKPK  346



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+ G GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  140  RFLNAGVLGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  197

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA ++AGV  GFFELQ
Sbjct  198  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRVAGVTSGFFELQ  257

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE+NIL V+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  258  PKEGLALVNGTAVGSGMASMVLFESNILVVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  317

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  318  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  353



>gb|KHN09507.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=701

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  119  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  176

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LA +   FFELQ
Sbjct  177  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEFFELQ  236

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  237  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  296

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  297  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  332



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEI+EAITK LNH+IT
Sbjct  37   RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNIT  94

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSY+AGLL GRPNSK++GP G+ L A+EA +LAG+ GGFFELQ
Sbjct  95   PCLPLRGTITASGDLVPLSYVAGLLIGRPNSKSIGPNGQVLNAKEAFQLAGIDGGFFELQ  154

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFEAN+L +LSEVLSAIFAEVM GK EFTDHL HKLKHH
Sbjct  155  PKEGLALVNGTAVGSGLASTVLFEANLLVILSEVLSAIFAEVMQGKQEFTDHLTHKLKHH  214

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  215  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  250



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   366 bits (939),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  136  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A +A + AG+  GFFELQ
Sbjct  194  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLDAVKAFQWAGIDTGFFELQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLA+VNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  254  PKEGLAMVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+K+HEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILDGSSYVKEAKKIHEMDPLQKPK  349



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH++T
Sbjct  134  RFLNAGIFGNGTE--STHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNVT  191

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRG+ITASGD+VPLSYIAGLLTGR NSKAVGP GE L AE+A   AGV+GGFFELQ
Sbjct  192  PFLPLRGTITASGDLVPLSYIAGLLTGRANSKAVGPTGEVLNAEKAFAEAGVEGGFFELQ  251

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLF+AN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  252  PKEGLALVNGTAVGSGMASMVLFDANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  311

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  312  PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  347



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   366 bits (939),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  139  RFLNAGIFGNGIE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  196

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP  E L A+EA  +AG+  GFF LQ
Sbjct  197  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNEEPLDAQEAFHVAGINSGFFVLQ  256

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  257  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHH  316

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  317  PGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  352



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  134  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  191

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LA +   FFELQ
Sbjct  192  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEFFELQ  251

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  252  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  311

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  312  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  347



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   365 bits (938),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--SSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L+  EA   AG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYVKEAQKLHEIDPLQKPK  342



>gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   363 bits (932),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG G+   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNH++T
Sbjct  131  RFLNSGIFGNGSE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L A+ A + AG+  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   365 bits (937),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--SSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L+  EA   AG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKEAQKLHEIDPLQKPK  342



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   365 bits (938),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  141  RFLNAGVFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  198

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSK VGP GE L AEEA ++AGV GGFFELQ
Sbjct  199  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKVVGPNGEKLNAEEAFRVAGVTGGFFELQ  258

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGS MAS+VLFE+NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  259  PKEGLALVNGTAVGSAMASIVLFESNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  318

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  319  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  354



>emb|CAL91037.1| phenylalanine ammonia-lyase 1 [Cynara cardunculus var. scolymus]
Length=694

 Score =   365 bits (936),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH++T
Sbjct  112  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNVT  169

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L AE+A   AGV+GGFFELQ
Sbjct  170  PFLPLRGTITASGDLVPLSYIAGLLTGRSNSKAIGPTGEVLNAEKAFAEAGVEGGFFELQ  229

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  230  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAMFAEVMQGKPEFTDHLTHKLKHH  289

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  290  PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  325



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   365 bits (937),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  126  RFLNAGVFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  183

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA  LAG+  GFFELQ
Sbjct  184  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEPLNAQEAFTLAGIDTGFFELQ  243

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  244  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVISAIFAEVMQGKPEFTDHLTHKLKHH  303

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL GS ++KAA+KLHEMDPLQKP+
Sbjct  304  PGQIEAAAIMEHILAGSSYVKAAEKLHEMDPLQKPK  339



>gb|AIZ76766.1| PAL2, partial [Pyrus pyrifolia]
Length=433

 Score =   356 bits (914),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 195/216 (90%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG+ T  G  HTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN+++T
Sbjct  94   RFLNAGVFGSATESG--HTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVT  151

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L A EA +L G+  GFFELQ
Sbjct  152  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSGFFELQ  211

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  212  PKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTHKLKHH  271

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  272  PGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  307



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   365 bits (937),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--SSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L+  EA   AG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKEAQKLHEIDPLQKPK  342



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   365 bits (937),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT    CHTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA+TK LNH+IT
Sbjct  129  RFLNAGIFGKGTE--GCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKFLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA KLAGV GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEELNAEEAFKLAGVSGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EAN+LA+L+EV+SAIFAEVM+GKPEFTDHL H+LKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIALYEANVLALLAEVMSAIFAEVMNGKPEFTDHLTHELKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKAAQKMHEMDPLQKPK  342



>gb|ACR15762.1| phenylalanine ammonia-lyase [Litchi chinensis]
Length=723

 Score =   365 bits (937),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 199/216 (92%), Gaps = 4/216 (2%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  144  RFLNAGVFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  201

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A+EA + AG   GFFELQ
Sbjct  202  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGETLDAKEASQRAGF--GFFELQ  259

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  260  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  319

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHEMD LQKP+
Sbjct  320  PGQIEAAAIMEHILDGSSYIKAAKKLHEMDLLQKPK  355



>gb|AHL27357.1| phenylalanine ammonia-lyase, partial [Glycine soja]
Length=208

 Score =   348 bits (892),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 193/210 (92%), Gaps = 2/210 (1%)
 Frame = +1

Query  121  FLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITP  300
            FLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++TP
Sbjct  1    FLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTP  58

Query  301  CLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQP  480
            CLPLRG+ITASGD+VPLSYI GLLTGRPNSKAVGP GE L A+EA +LA +   FFELQP
Sbjct  59   CLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPNGEVLNAKEAFELASINSEFFELQP  118

Query  481  KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  660
            KEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  119  KEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHP  178

Query  661  GQIEAAAIMEHILDGSHFMKAAQKLHEMDP  750
            GQIEAAAIMEHILDGS +MKAA+KLHE+DP
Sbjct  179  GQIEAAAIMEHILDGSSYMKAAKKLHEIDP  208



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SC+TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  88   RFLNAGIFGNGTE--SCNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  145

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G++L AEEA ++AG+  GFF L+
Sbjct  146  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLNAEEAFRVAGIDSGFFMLR  205

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEG ALVNGTAVGSG+ASMVLFEAN+L VLSE+LSA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  206  PKEGFALVNGTAVGSGLASMVLFEANVLVVLSEILSAVFAEVMNGKPEFTDHLTHKLKHH  265

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  266  PGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  301



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN++IT
Sbjct  138  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNIT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASG +VPLSYIAGLLTGRPNSKAVGP GE L AE A   AGV+GGFFELQ
Sbjct  196  PCLPLRGTITASGGLVPLSYIAGLLTGRPNSKAVGPTGEILNAETAFARAGVEGGFFELQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVL AIFAEVM GKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLPAIFAEVMQGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQ+EAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  316  PGQMEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  351



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  130  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LA +   FFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELASINSEFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  343



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCH+LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN +IT
Sbjct  128  RFLNAGVFGQGTE--SCHSLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PC+PLRGSITASGD+VPLSYIAGLLTGRPNSKA+GP GE L   EA   AG+ GGFFELQ
Sbjct  186  PCVPLRGSITASGDLVPLSYIAGLLTGRPNSKALGPNGETLNPTEAFSKAGINGGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLA+VNGTAVGSG+AS+VLFEAN+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGLAMVNGTAVGSGLASLVLFEANVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL GS ++KAAQKLHE+DPLQKP+
Sbjct  306  PGQIEAAAIMEHILGGSSYIKAAQKLHELDPLQKPK  341



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  131  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LA +   FFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  344



>gb|KCW65428.1| hypothetical protein EUGRSUZ_G02848 [Eucalyptus grandis]
Length=701

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILE + KLLN +IT
Sbjct  132  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L A EA +LAG++ GFF+LQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIEHGFFDLQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VL+EANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASIVLYEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKDAQKLHEMDPLQKPK  345



>ref|XP_010067315.1| PREDICTED: phenylalanine ammonia-lyase [Eucalyptus grandis]
 gb|KCW65427.1| hypothetical protein EUGRSUZ_G02848 [Eucalyptus grandis]
Length=714

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILE + KLLN +IT
Sbjct  132  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+L A EA +LAG++ GFF+LQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIEHGFFDLQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VL+EANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASIVLYEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKDAQKLHEMDPLQKPK  345



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   + HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  127  RFLNAGIFGNGTE--TNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNIT  184

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LTAE+A KLAGV GGFFELQ
Sbjct  185  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLTAEQAFKLAGVNGGFFELQ  244

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ LFEANILAVLSEV+SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  245  PKEGLALVNGTAVGSGLASIALFEANILAVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHH  304

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLH+MDPLQKP+
Sbjct  305  PGQIEAAAIMEHILDGSGYVKAAQKLHDMDPLQKPK  340



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 202/216 (94%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  141  RFLNAGVFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  198

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP  E L AEEA ++AGV GGFFELQ
Sbjct  199  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNREKLNAEEAFRVAGVTGGFFELQ  258

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMAS+VL+++NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  259  PKEGLALVNGTAVGSGMASIVLYDSNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  318

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  319  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  354



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   364 bits (935),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G    S H LPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  129  RFLNAGIFGSGAE--SNHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE+L A+EA + AG+  GFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESLDAKEAFQQAGIPSGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  342



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            R LNAGIFG G  + SCHTLPHSATRAAMLVRIN+LLQGYSGIRFEILEAITKLLNH+IT
Sbjct  104  RVLNAGIFGNG--RESCHTLPHSATRAAMLVRINSLLQGYSGIRFEILEAITKLLNHNIT  161

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  162  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  221

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEG ALVNGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  222  PKEGFALVNGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHH  281

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDG  ++K A+KLHEMDPLQKP+
Sbjct  282  PGQIEAAAIMEHILDGISYVKEAKKLHEMDPLQKPK  317



>ref|XP_006345786.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=707

 Score =   363 bits (933),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   SCH LPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  131  RFLNAGVFGNGTE--SCHMLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA GP GE L A  A + AG++ GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRTNSKATGPNGELLDAVNAFQRAGIESGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASMVLFEANILAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+K+HEMDPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYVKEAKKIHEMDPLQKPK  344



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   363 bits (933),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEI+EAI+K LNH+IT
Sbjct  135  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAISKFLNHNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSY+AGLL GRPNSK++GP G+ L A+EA +LAG+ GGFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYVAGLLIGRPNSKSIGPNGQVLNAKEAFQLAGIDGGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEAN+L +LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGLASVVLFEANLLVILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS + KAA+KLHE+DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYCKAARKLHEIDPLQKPK  348



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   363 bits (933),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNGTE--SSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L+  EA   A + GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPHGEPLSPAEAFTQARIDGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKEAQKLHEIDPLQKPK  342



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   363 bits (932),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G    S + LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  126  RFLNAGIFGSGN--DSSNILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNIT  183

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LTA EA KLAGV GGFFELQ
Sbjct  184  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGENLTAAEAFKLAGVDGGFFELQ  243

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFE NILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  244  PKEGLALVNGTAVGSGMASMVLFETNILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHH  303

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+K HEMDPLQKP+
Sbjct  304  PGQIEAAAIMEHILDGSSYVKAAEKQHEMDPLQKPK  339



>ref|XP_004156293.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Cucumis sativus]
Length=712

 Score =   363 bits (932),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  130  RFLNAGIFGSGAE--SDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE+L A+EA + AG+  G FELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESLDAKEAFQQAGIPSGXFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  343



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   363 bits (933),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG GT   S HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK LNH+IT
Sbjct  138  RFLNSGIFGNGTE--SSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHNIT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L   EA  LAGV  GFFELQ
Sbjct  196  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQVLNPTEAFNLAGVTSGFFELQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+A+ VLFEANILA++SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGLAATVLFEANILAIMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  316  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  351



>gb|AAG22550.1|AF304367_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=362

 Score =   352 bits (903),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 191/216 (88%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+   GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI+K LNH+IT
Sbjct  19   RFLNAGVLRNGTE--SAHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAISKFLNHNIT  76

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAG LTGRPNSKAVGP GE L A EA    G+  GFFELQ
Sbjct  77   PCLPLRGTITASGDLVPLSYIAGPLTGRPNSKAVGPKGETLNAAEAFAQVGISSGFFELQ  136

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFE NILA+LSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  137  PKEGLALVNGTAVGSGLASTVLFETNILALLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  196

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  197  PGQIEAAAIMEHILDGSSYVKAAEKLHEQDPLQKPK  232



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   363 bits (932),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  129  RFLNAGIFGNGTE--SNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNENIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA KLAGV+GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLNAEEAFKLAGVKGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ LF+ANILAVLSEV+SA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIALFDANILAVLSEVMSAVFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSGYVKAAQKLHEQDPLQKPK  342



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   363 bits (932),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEI+EAITK LNH+IT
Sbjct  135  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSY+AGLL GRPNSK++GP G+ L A+EA +LAG+ GGFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYVAGLLIGRPNSKSIGPNGQVLNAKEAFQLAGIDGGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFEAN+L +LSEVLSAIFAEVM GK EFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGLASTVLFEANLLVILSEVLSAIFAEVMQGKQEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  348



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   363 bits (932),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  129  RFLNAGIFGNGTE--SNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNENIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA KLAGV+GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLNAEEAFKLAGVKGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ LF+ANILAVLSEV+SA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIALFDANILAVLSEVMSAVFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSGYVKAAQKLHEQDPLQKPK  342



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156291.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   363 bits (932),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  131  RFLNAGIFGSGAE--SDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE +TA+EA + A +  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGERITAKEAFQQADIPSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHE+DPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKTAKKLHEIDPLQKPK  344



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   363 bits (931),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            R LNAGIFG G  + SCHTLPHSATRAAMLVRIN+LLQGYSGIRFEILEAITKLLNH+IT
Sbjct  128  RVLNAGIFGNG--RESCHTLPHSATRAAMLVRINSLLQGYSGIRFEILEAITKLLNHNIT  185

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE + AEEA K+AG++ GFFELQ
Sbjct  186  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQ  245

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEG ALVNGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  246  PKEGFALVNGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHH  305

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDG  ++K A+KLHEMDPLQKP+
Sbjct  306  PGQIEAAAIMEHILDGISYVKEAKKLHEMDPLQKPK  341



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   363 bits (932),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG GT   S HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK LNH+IT
Sbjct  138  RFLNSGIFGNGTE--SSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHNIT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L   EA  LAGV  GFFELQ
Sbjct  196  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQVLNPTEAFNLAGVTSGFFELQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+A+ VLFEANILA++SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGLAATVLFEANILAIMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  316  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  351



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   363 bits (931),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CH LPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LNH+IT
Sbjct  129  RFLNAGIFGNGTE--TCHMLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTFLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GEA  AEEA +LAG+ GGFF LQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEAFNAEEAFRLAGLSGGFFLLQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEAN+LAVLS VLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASIVLFEANVLAVLSVVLSAIFAEVMNGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSSYVKAAQKLHELDPLQKPK  342



>ref|XP_004152158.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   363 bits (931),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG G+   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNH++T
Sbjct  131  RFLNSGIFGNGSE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L A+ A   AG+  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFTQAGIDSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>gb|AER58180.1| phenylalanine ammonia lyase [Cucumis sativus]
Length=713

 Score =   363 bits (931),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG G+   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNH++T
Sbjct  131  RFLNSGIFGNGSE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L A+ A + AG+  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   363 bits (931),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLN ++T
Sbjct  135  RFLNAGIFGNGAE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNENVT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE L AE A K AG+  GFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQAGIPSGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPE+TDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEYTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  348



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   363 bits (931),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPHS+TRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  132  RFLNAGVFGRGTE--SSHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE+L A+EA K AG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRSNSKAIGPNGESLDAKEAFKQAGIPSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVL+E++SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASIVLFEANILAVLAEIMSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  345



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   362 bits (930),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA TKLLN+++T
Sbjct  130  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEANTKLLNNNVT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LA +   FFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELASINSEFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  343



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   363 bits (931),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT     HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  141  RFLNAGVFGNGTELS--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  198

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRGSITASGD+VPLSYI GLLTGRPNSKAVGP GE L AEEAL++AGV GGFFELQ
Sbjct  199  PCLPLRGSITASGDLVPLSYIVGLLTGRPNSKAVGPNGEKLNAEEALRVAGVSGGFFELQ  258

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAV SGMAS+V+FE+NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  259  PKEGLALVNGTAVASGMASIVVFESNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  318

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  319  PGQIEAAAIMEHILDGSSYVKEAQKLHEMDPLQKPK  354



>ref|XP_004152155.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   362 bits (930),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG G+   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNH++T
Sbjct  131  RFLNSGIFGNGSE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L A+ A + AG+  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   362 bits (930),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   +CHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N++IT
Sbjct  127  RFLNAGVFGNGTE--TCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINNNIT  184

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLL GRPNSKAVGP GE L AEEA ++AG+ GGFFE Q
Sbjct  185  PCLPLRGTLTASGDLVPLSYIAGLLIGRPNSKAVGPNGEILNAEEAFRVAGISGGFFEFQ  244

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEG A+ N TAVGSGMAS+VLFE+NILAV+SEVLSAIFAEVM+GKPEFTDHL HKLK+H
Sbjct  245  PKEGFAITNSTAVGSGMASIVLFESNILAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKYH  304

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  305  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  340



>ref|XP_002285277.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 emb|CAN74850.1| hypothetical protein VITISV_000789 [Vitis vinifera]
Length=717

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  KLLN +I+
Sbjct  135  RFLNAGIFGKGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEATVKLLNANIS  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+I+ASGD+VPLSYIAGLLTGRPNS+AVGP GE+L AEEA +LAG+ GGFFELQ
Sbjct  193  PCLPLRGTISASGDLVPLSYIAGLLTGRPNSRAVGPNGESLNAEEAFRLAGIDGGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGLASTVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQ LHE+DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSAYVKAAQMLHEIDPLQKPK  348



>gb|AGA84059.1| phenylalanine ammonia lyase [Picrorhiza kurrooa]
Length=713

 Score =   362 bits (929),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 2/219 (1%)
 Frame = +1

Query  109  LDCRFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  288
            L+  FLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN 
Sbjct  129  LNLLFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNT  186

Query  289  SITPCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFF  468
            ++TPCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AE+A  LAGV GGFF
Sbjct  187  NVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEILNAEKAFNLAGVTGGFF  246

Query  469  ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  648
            ELQPKEGLALVNGTAVGSG+AS+ L+EAN+L+VLSEV+SAIFAEVM+GKPEFTDHL HKL
Sbjct  247  ELQPKEGLALVNGTAVGSGLASIALYEANVLSVLSEVMSAIFAEVMNGKPEFTDHLTHKL  306

Query  649  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            KHHPGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  307  KHHPGQIEAAAIMEHILDGSSYVKAAQKMHEMDPLQKPK  345



>ref|XP_010107518.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16200.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=769

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 207/232 (89%), Gaps = 2/232 (1%)
 Frame = +1

Query  70   FTQINL*QSSNLYLDCRFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIR  249
              +IN  Q   L    +FLN GIFG GT   SCHTLPH+ATR+A+LVRINTLLQGYSGIR
Sbjct  171  LVRINTLQVQRLPSIFKFLNVGIFGNGTE--SCHTLPHTATRSALLVRINTLLQGYSGIR  228

Query  250  FEILEAITKLLNHSITPCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtae  429
            FEILEA+TKLLN ++TPCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE+LTA 
Sbjct  229  FEILEAMTKLLNSNVTPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTAT  288

Query  430  ealklaGVQGGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMH  609
            +A K+AG+  GFFELQPKEGLALVNGTAVGSG+ASMVLF+ANIL+VLSE+LSAIFAEVM 
Sbjct  289  QAFKVAGINSGFFELQPKEGLALVNGTAVGSGLASMVLFDANILSVLSEILSAIFAEVMQ  348

Query  610  GKPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            GKPEFTDHL HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  349  GKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  400



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT     HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  137  RFLNAGVFGNGTELS--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  194

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRGSITASGD+VPLSYI GLLTGRPNSKAVGP GE L AEEAL++AGV GGFFELQ
Sbjct  195  PCLPLRGSITASGDLVPLSYIVGLLTGRPNSKAVGPNGEKLNAEEALRVAGVSGGFFELQ  254

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAV SGMAS+V+FE+NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  255  PKEGLALVNGTAVASGMASIVVFESNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHH  314

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  315  PGQIEAAAIMEHILDGSSYVKEAQKLHEMDPLQKPK  350



>sp|O49836.1|PAL2_LITER RecName: Full=Phenylalanine ammonia-lyase 2; Short=PAL-2 [Lithospermum 
erythrorhizon]
 dbj|BAA24929.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=705

 Score =   362 bits (929),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  123  RFLNAGIFGNGTE--TSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNIT  180

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA +LAG+  GFFELQ
Sbjct  181  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEKLNAEEAFRLAGISSGFFELQ  240

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVL+EANIL V+SEVLSA+FAEVM+GKPEFTDHL HKLKHH
Sbjct  241  PKEGLALVNGTAVGSGMASMVLYEANILGVMSEVLSAVFAEVMNGKPEFTDHLTHKLKHH  300

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+ LHEMDPLQKP+
Sbjct  301  PGQIEAAAIMEHILDGSGYVKAAELLHEMDPLQKPK  336



>ref|XP_004143259.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156290.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=705

 Score =   362 bits (929),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    SCHTL  SATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  123  RFLNAGIFGNGAE--SCHTLSRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  180

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP  E+L A EA + AG+  GFFELQ
Sbjct  181  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNEESLDANEAFQRAGIPSGFFELQ  240

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  241  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  300

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS +MK A+KLHEMDPLQKP+
Sbjct  301  PGQIEAAAIMEYILDGSSYMKTAKKLHEMDPLQKPK  336



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 3/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPH+ATR+A+LVRINTLLQGYSGIRFEILEA+TKLLN ++T
Sbjct  144  RFLNAGIFGNGTE--SCHTLPHTATRSALLVRINTLLQGYSGIRFEILEAMTKLLNSNVT  201

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE+LTA +A K+AG+  GFFELQ
Sbjct  202  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQ  261

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANIL+VLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  262  PKEGLALVNGTAVGSGLASMVLFDANILSVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  321

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA KLHE+DPLQKP+
Sbjct  322  PGQIEAAAIMEHILDGSSYMKAA-KLHEIDPLQKPK  356



>gb|AGE10607.1| phenylalanine amononia-lyase, partial [Lonicera hypoglauca]
Length=483

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 195/216 (90%), Gaps = 3/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  1    RFLNAGIFGNGTE--SAHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  58

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ LT  EA  LAG  G FFELQ
Sbjct  59   PTLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGQTLTPGEAFALAGA-GDFFELQ  117

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  118  PKEGLALVNGTAVGSGLASMVLFEANTLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  177

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+K HEMDPLQKP+
Sbjct  178  PGQIEAAAIMEHILDGSSYVKAAEKFHEMDPLQKPK  213



>ref|XP_004167356.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like, 
partial [Cucumis sativus]
Length=673

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 195/216 (90%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG G+   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNH++T
Sbjct  91   RFLNSGIFGNGSE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHNVT  148

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L A+ A   AG+  GFFELQ
Sbjct  149  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFTQAGIDSGFFELQ  208

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM G PEFTDHL HKLKHH
Sbjct  209  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGXPEFTDHLTHKLKHH  268

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  269  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  304



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            +FLNAG+FG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  138  KFLNAGVFGNGTE--STHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP G  L A+EA ++A V GGFFELQ
Sbjct  196  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGSKLDADEAFRVAAVSGGFFELQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMAS+VL+++NILAV+ EVLSAIFAEVM+GKPEFTD+L HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGMASIVLYDSNILAVMFEVLSAIFAEVMNGKPEFTDYLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  316  PGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  351



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  131  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCL LRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LA +   FFELQ
Sbjct  189  PCLDLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  344



>ref|XP_010067316.1| PREDICTED: phenylalanine ammonia-lyase [Eucalyptus grandis]
 gb|KCW65429.1| hypothetical protein EUGRSUZ_G02849 [Eucalyptus grandis]
Length=714

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCH LPHSATRAAMLVRINTLLQGYSGIRFEILE + KLLN +IT
Sbjct  132  RFLNAGIFGNGTE--SCHMLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE+L A EA +LAG++ GFF+LQ
Sbjct  190  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIKHGFFDLQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLA+VNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLAIVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKDAQKLHEMDPLQKPK  345



>ref|XP_004143356.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156338.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=717

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLN ++T
Sbjct  135  RFLNAGIFGNGAE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNENVT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE L AE A K AG+   FFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQAGIPSSFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  348



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 194/216 (90%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCH LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  132  RFLNAGIFGKGTE--SCHMLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNRNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLR SITASGD+VP SYIAGLLTGRPNS AVGP GE+L A EA   AG+ GGFFELQ
Sbjct  190  PCLPLRASITASGDLVPFSYIAGLLTGRPNSVAVGPNGESLNAAEAFSQAGIDGGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGT VG+G+AS+VLFEANIL VLSEVLSAIFAE MHGKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTGVGAGLASIVLFEANILTVLSEVLSAIFAEAMHGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  345



>gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   361 bits (927),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CH LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK +NH+IT
Sbjct  130  RFLNAGIFGNGTE--TCHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFINHNIT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLL GRPNSK+VGP GE+L   EA +LAG+  GFFELQ
Sbjct  188  PCLPLRGTITASGDLVPLSYIAGLLIGRPNSKSVGPNGESLDPSEAFELAGIDSGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LA+L+EVLS IFAEVM GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGTAVGSGLASMVLFEANVLAILAEVLSGIFAEVMQGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHE+DPLQKP+
Sbjct  308  PGQIEAAAIMEHILDGSAYVKAAKKLHELDPLQKPK  343



>gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLN ++T
Sbjct  135  RFLNAGIFGNGAE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNENVT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA+GP GE L AE A K AG+   FFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQAGIPSSFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  253  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  348



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/222 (82%), Positives = 202/222 (91%), Gaps = 2/222 (1%)
 Frame = +1

Query  100  NLYLDCRFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  279
            N++L  RFLNAGIFG GT   + HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  142  NMFLFFRFLNAGIFGNGTE--TSHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKL  199

Query  280  LNHSITPCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQG  459
            +N++ITPCLPLRG++TASGD+VPLSYIAGLLTGR NSKAVGP G+ L A+EA + AG+  
Sbjct  200  INNNITPCLPLRGTVTASGDLVPLSYIAGLLTGRQNSKAVGPSGKVLNAKEAFQSAGIDS  259

Query  460  GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  639
            GFFELQPKEGLALVNGTAVGSG+AS+VLF+ANILA+LSEVLSAIFAEVM GKPEFTDHL 
Sbjct  260  GFFELQPKEGLALVNGTAVGSGLASIVLFDANILAILSEVLSAIFAEVMQGKPEFTDHLT  319

Query  640  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  320  HKLKHHPGQIEAAAIMEHILDGSSYMKAAKKLHEVDPLQKPK  361



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   361 bits (927),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHS TRA+MLVRINTLLQGYSGIRFEILEAIT+ LNH+IT
Sbjct  126  RFLNAGIFGNGTE--SSHTLPHSTTRASMLVRINTLLQGYSGIRFEILEAITEFLNHNIT  183

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G++LTA EA +LAG+  GFFELQ
Sbjct  184  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGQSLTAAEAFELAGLSSGFFELQ  243

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMAS+VLFEANILAVLSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  244  PKEGLALVNGTAVGSGMASVVLFEANILAVLSEVLSALFAEVMQGKPEFTDHLTHKLKHH  303

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A K+HEMDPLQKP+
Sbjct  304  PGQIEAAAIMEHILDGSAYVKEAAKIHEMDPLQKPK  339



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   361 bits (926),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG G+   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  LLNH++T
Sbjct  126  RFLNSGIFGNGSE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHNVT  183

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L A+ A + AG+  GFFELQ
Sbjct  184  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGIDSGFFELQ  243

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  244  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  303

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  304  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  339



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   361 bits (926),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 195/216 (90%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG  T   S HTLP SATRAAMLVR NTLLQGYSGIRFE+LEAITKLLNH+IT
Sbjct  129  RFLNAGIFGNDTE--SSHTLPRSATRAAMLVRFNTLLQGYSGIRFEMLEAITKLLNHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L+  EA   AG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHE+DPLQKP+
Sbjct  307  PGQIEAAAIMEHILDGSAYVKEAQKLHEIDPLQKPK  342



>gb|AAG22549.1|AF304366_1 phenylalanine ammonia-lyase 1 [Rubus idaeus]
Length=363

 Score =   350 bits (897),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 195/216 (90%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+     S H LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN +IT
Sbjct  19   RFLNAGIFGSSL--DSTHKLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNGNIT  76

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLL GRPNSK+VGP GE L+  EA KLAG+ GGFFELQ
Sbjct  77   PCLPLRGTITASGDLVPLSYIAGLLIGRPNSKSVGPKGETLSPAEAFKLAGIDGGFFELQ  136

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLF+AN LAVLSEV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  137  PKEGLALVNGTAVGSGMASMVLFDANTLAVLSEVMSAIFAEVMQGKPEFTDHLTHKLKHH  196

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHIL+GS ++K A+K+HEMDPLQKP+
Sbjct  197  PGQIEAAAIMEHILEGSSYVKEAKKVHEMDPLQKPK  232



>ref|XP_008454138.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   361 bits (926),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG G+   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  LLNH++T
Sbjct  131  RFLNSGIFGNGSE--SNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHNVT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE L A+ A + AG+  GFFELQ
Sbjct  189  PCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGIDSGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  309  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   360 bits (925),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  122  RFLNAGVFGNGIE--SFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  179

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA  +AG+ GGFFELQ
Sbjct  180  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFCVAGISGGFFELQ  239

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGS MAS+VLFE+NI AV+SEVLSAIF EVM+GKPEFTD+L HKLKHH
Sbjct  240  PKEGLALVNGTAVGSAMASIVLFESNIFAVMSEVLSAIFTEVMNGKPEFTDYLTHKLKHH  299

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  300  PGQIEAAAIMEHILDGSSYVKVAQKLHEMDPLQKPK  335



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 197/215 (92%), Gaps = 2/215 (1%)
 Frame = +1

Query  121  FLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITP  300
            FLNAG+FG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +ITP
Sbjct  1    FLNAGVFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITP  58

Query  301  CLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQP  480
            CLPLRG++TASGD+VPLSYIAGLL GRPNSKAVGP GE L AEEA ++AG+ GGFFE QP
Sbjct  59   CLPLRGTLTASGDLVPLSYIAGLLIGRPNSKAVGPNGEILNAEEAFRVAGISGGFFEFQP  118

Query  481  KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  660
            KEG A+ N TAVGSGMAS+VLFE+NIL V+SEVLSAIFAEVM+GKPEFTDHL HKLK+HP
Sbjct  119  KEGFAITNSTAVGSGMASIVLFESNILVVMSEVLSAIFAEVMNGKPEFTDHLTHKLKYHP  178

Query  661  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            GQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  179  GQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  213



>gb|AIZ76767.1| PAL2, partial [Pyrus pyrifolia]
Length=569

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG+ T  G  HTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN+++T
Sbjct  1    RFLNAGVFGSATESG--HTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVT  58

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L+A EA +L G+  GFFELQ
Sbjct  59   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGQTLSASEAFELVGINCGFFELQ  118

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  119  PKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTHKLKHH  178

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  179  PGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  214



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   360 bits (925),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG G    S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N +IT
Sbjct  122  RFLNAGVFGNGIE--SFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNIT  179

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L AEEA  +AG+ GGFFELQ
Sbjct  180  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFCVAGISGGFFELQ  239

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGS MAS+VLFE+NI AV+SEVLSAIF EVM+GKPEFTD+L HKLKHH
Sbjct  240  PKEGLALVNGTAVGSAMASIVLFESNIFAVMSEVLSAIFTEVMNGKPEFTDYLTHKLKHH  299

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  300  PGQIEAAAIMEHILDGSSYVKVAQKLHEMDPLQKPK  335



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   360 bits (925),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N++IT
Sbjct  122  RFLNAGIFGNGTE--STHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLINNNIT  179

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+ A +LAG+  GFFELQ
Sbjct  180  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKNAFQLAGIDSGFFELQ  239

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLF+AN+LA+L+EVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  240  PKEGLALVNGTAVGSGLASIVLFDANVLAILAEVLSAIFAEVMQGKPEFTDHLTHKLKHH  299

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  300  PGQIEAAAIMEHILDGSSYMKAAKKLHEVDPLQKPK  335



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   361 bits (926),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  136  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A +A + AG+  GFFELQ
Sbjct  194  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLDAVKAFQRAGIDTGFFELQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAVLSEVLSAIFAEVM GKPEFTD+L HKLKHH
Sbjct  254  PKEGLALVNGTAVGSGLASMVLFDANILAVLSEVLSAIFAEVMQGKPEFTDYLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+ +HEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILDGSSYVKEAKIVHEMDPLQKPK  349



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   361 bits (926),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  136  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A +A + AG+  GFFELQ
Sbjct  194  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLNAVKAFQRAGIDTGFFELQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAVLSEVLSAIFAEVM GKPEFTD+L HKLKHH
Sbjct  254  PKEGLALVNGTAVGSGLASMVLFDANILAVLSEVLSAIFAEVMQGKPEFTDYLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+ +HEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILDGSSYVKEAKIVHEMDPLQKPK  349



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   361 bits (926),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPH+ T AA+LVRINTLLQGYSGIRFEILEA+TKLLN ++T
Sbjct  144  RFLNAGIFGNGTE--SCHTLPHTTTGAALLVRINTLLQGYSGIRFEILEAMTKLLNGNVT  201

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE+LTA +A K+AG+  GFFELQ
Sbjct  202  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQ  261

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  262  PKEGLALVNGTAVGSGLASMVLFDANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  321

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILD S +MKAA+KLHE+DPLQKP+
Sbjct  322  PGQIEAAAIMEHILDDSSYMKAAKKLHEIDPLQKPK  357



>emb|CDY66761.1| BnaCnng52250D [Brassica napus]
Length=519

 Score =   355 bits (910),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG    K +CHTLP SATRAAMLVR+NTLLQGYSGIRFEILEAIT LLNH+I+
Sbjct  142  RFLNAGIFGN--TKETCHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNIS  199

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE+LTAEEA K AG+  GFF+LQ
Sbjct  200  PSLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGESLTAEEAFKKAGITSGFFDLQ  259

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMASMVLFEAN+ +VL+EVLSAIFAEVM GKPEFTDHL H+LKHH
Sbjct  260  PKEGLALVNGTAVGSGMASMVLFEANVQSVLAEVLSAIFAEVMSGKPEFTDHLTHRLKHH  319

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK AQKLHEMDPLQKP+
Sbjct  320  PGQIEAAAIMEHILDGSSYMKLAQKLHEMDPLQKPK  355



>ref|XP_011077265.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Sesamum indicum]
Length=714

 Score =   360 bits (925),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 195/216 (90%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRA+MLVRINTLLQGYSGIRFE+LEAITKLLNH+IT
Sbjct  132  RFLNAGIFGNGTE--SSHTLPHSATRASMLVRINTLLQGYSGIRFEVLEAITKLLNHNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLL GRPNSKA+GP GE L   +A  LAG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLLGRPNSKAIGPNGEVLDPAQAFTLAGIDTGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEAN+L VLSEV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASIVLFEANVLVVLSEVISAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQK HEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYIKEAQKTHEMDPLQKPK  345



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   362 bits (928),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHS+TRAAMLVRINTL+QGYSGIRFEILEA+ K LNH++T
Sbjct  178  RFLNAGIFGNGTE--SNHTLPHSSTRAAMLVRINTLMQGYSGIRFEILEALAKFLNHNVT  235

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LTAE A KLAGV GGFFELQ
Sbjct  236  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEPLTAEAAFKLAGVAGGFFELQ  295

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+ L+EANILA+L+EV+SAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  296  PKEGLALVNGTAVGSGLASIALYEANILALLAEVMSAIFAEVMNGKPEFTDHLTHKLKHH  355

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  356  PGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  391



>ref|XP_007016787.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY34406.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=713

 Score =   360 bits (925),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG+GT   SCHTLPH+A RAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  131  RFLNAGVFGSGTE--SCHTLPHTAARAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  188

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRGSI+ASGDIVP SYIAG L GRPNSKAVGP GEAL A EA  LAG+ GGFFELQ
Sbjct  189  PSLPLRGSISASGDIVPFSYIAGFLMGRPNSKAVGPKGEALGANEAFHLAGINGGFFELQ  248

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGT VGSG+AS+VLFEANIL VLSEVLSAIFAEVM GKPEFTDH+ HKLKHH
Sbjct  249  PKEGLALVNGTGVGSGLASIVLFEANILTVLSEVLSAIFAEVMQGKPEFTDHMTHKLKHH  308

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIM+HILDGS F+KAAQKLHE+DPLQKP+
Sbjct  309  PGQIEAAAIMQHILDGSAFVKAAQKLHEIDPLQKPK  344



>ref|XP_010528074.1| PREDICTED: phenylalanine ammonia-lyase 1 [Tarenaya hassleriana]
Length=720

 Score =   360 bits (925),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+   K   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNH+I 
Sbjct  138  RFLNAGIFGSAAEKS--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSLLNHNIA  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE LTAEEA KLAG+  GFF+LQ
Sbjct  196  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGETLTAEEAFKLAGITSGFFDLQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LAVL+EVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGLASMVLFEANVLAVLAEVLSAIFAEVMTGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK AQK+HEMDPLQKP+
Sbjct  316  PGQIEAAAIMEHILDGSSYMKLAQKIHEMDPLQKPK  351



>gb|AAN32866.1|AF460203_1 phenylalanine ammonia-lyase 1 [Coffea canephora]
 gb|AAZ04477.1| phenylalanine ammonia-lyase [Coffea canephora]
 gb|AEO92027.1| phenylalanine ammonia-lyase 1 [Coffea canephora]
Length=717

 Score =   360 bits (925),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRA+MLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  135  RFLNAGIFGNGTE--TCHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYI GLLTGRPNSKAVGP G+ + A EA  LAG+  GFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPDGKFVNATEAFSLAGIDTGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
             KEGLALVNGTAVGS +ASMVLFEANILAVL+EVLS IFAEVMHGKPEFTDHL HKLKHH
Sbjct  253  AKEGLALVNGTAVGSALASMVLFEANILAVLAEVLSGIFAEVMHGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS F+K AQ++HE DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSFVKEAQRVHEFDPLQKPK  348



>gb|AEL21616.1| phenylalanine ammonia lyase 1 [Coffea arabica]
Length=717

 Score =   360 bits (925),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   +CHTLPHSATRA+MLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  135  RFLNAGIFGNGTE--TCHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  192

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYI GLLTGRPNSKAVGP G+ + A EA  LAG+  GFFELQ
Sbjct  193  PCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPDGKFVNATEAFSLAGIDTGFFELQ  252

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
             KEGLALVNGTAVGS +ASMVLFEANILAVL+EVLS IFAEVMHGKPEFTDHL HKLKHH
Sbjct  253  AKEGLALVNGTAVGSALASMVLFEANILAVLAEVLSGIFAEVMHGKPEFTDHLTHKLKHH  312

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS F+K AQ++HE DPLQKP+
Sbjct  313  PGQIEAAAIMEHILDGSSFVKEAQRVHEFDPLQKPK  348



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   360 bits (925),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK +NH++T
Sbjct  137  RFLNAGIFGNGTE--SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFINHNVT  194

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRG+ITASGD+VPLSYIAGLL GRPNSK VGP GE+L   EA  LAG+  GFF+LQ
Sbjct  195  PSLPLRGTITASGDLVPLSYIAGLLIGRPNSKCVGPNGESLDPTEAFTLAGINSGFFDLQ  254

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+L +LSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  255  PKEGLALVNGTAVGSGLASMVLFEANVLGILSEVLSAVFAEVMQGKPEFTDHLTHKLKHH  314

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  315  PGQIEAAAIMEHILDGSSYIKAAQKLHEVDPLQKPK  350



>ref|XP_008449236.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=705

 Score =   360 bits (924),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG G    S HTL  SATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH+IT
Sbjct  123  RFLNAGIFGNGVE--SSHTLSRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  180

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP  E+L A EA + AG+  GFFELQ
Sbjct  181  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNEESLDANEAFQRAGIPSGFFELQ  240

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILA+LSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  241  PKEGLALVNGTAVGSGLASIVLFEANILAILSEILSAIFAEVMQGKPEFTDHLTHKLKHH  300

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  301  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  336



>gb|AAZ29735.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   360 bits (924),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+++T
Sbjct  143  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVT  200

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE L A++A +LAG+   FFELQ
Sbjct  201  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAHGPTGEVLNAKQAFQLAGINTEFFELQ  260

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  261  PKEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  320

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  321  PGQIEAAAIMEHILDGSAYVKDAKKLHEMDPLQKPK  356



>ref|XP_007162756.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
 gb|ESW34750.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
Length=714

 Score =   360 bits (923),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE+ITKLLN+++T
Sbjct  132  RFLNAGIFGNGTE--SSHTLPHTATRAAMLVRINTLLQGYSGIRFEILESITKLLNNNVT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LTA++A +LA +   F+ELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLTAKQAFELANINSEFYELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSGMAS+VLF+ANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGMASIVLFDANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHE+DPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYMKDAKKLHEIDPLQKPK  345



>gb|AHA42445.1| phenylalanine ammonia lyase, partial [Cannabis sativa]
Length=528

 Score =   354 bits (908),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHS+TRA +LVRINTLLQGYSGIRFEILEA+ KLLN+++T
Sbjct  125  RFLNAGIFGHGTE--SCHTLPHSSTRAGLLVRINTLLQGYSGIRFEILEAMAKLLNNNVT  182

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE+LTA+EA K+A +   FFELQ
Sbjct  183  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTAKEAFKVADINSSFFELQ  242

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFEANILAVL+EVLSAIFAEV+ GKPEFTDHL HKLKHH
Sbjct  243  PKEGLALVNGTAVGSGVASTVLFEANILAVLAEVLSAIFAEVIQGKPEFTDHLTHKLKHH  302

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  303  PGQIEAAAIMEHILDGSSYVKEAKKLHEMDPLQKPK  338



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLP +ATRAAMLVRINTLLQGYSGIRFEI+EAITK LN++IT
Sbjct  134  RFLNAGVFGNGTE--STHTLPQTATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNNNIT  191

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAG+LTGRPNSKAVGP GEALTA+EA  LAG++ GFFELQ
Sbjct  192  PCLPLRGTITASGDLVPLSYIAGILTGRPNSKAVGPKGEALTAQEAFNLAGIETGFFELQ  251

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+ANILA+LSEV+SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  252  PKEGLALVNGTAVGSGLASMVLFDANILALLSEVISAIFAEVMQGKPEFTDHLTHKLKHH  311

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K+AQKLHE DPLQKP+
Sbjct  312  PGQIEAAAIMEHILDGSSYVKSAQKLHETDPLQKPK  347



>gb|AEO92029.1| phenylalanine ammonia-lyase 3 [Coffea canephora]
 gb|AEO94541.1| phenylalanine ammonia-lyase 3 [Coffea canephora]
Length=713

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT  G  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA+TKLLNH+IT
Sbjct  132  RFLNAGIFGNGTESG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEALTKLLNHNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNS+ VGP G +L A EA ++AG+  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSRCVGPNGRSLDATEAFQIAGMNSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+L +LSEV SAIFAEVMHGKPEF DHL+HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASMVLFEANLLVILSEVFSAIFAEVMHGKPEFIDHLMHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+ LHE DPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKAAKALHETDPLQKPK  345



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 195/216 (90%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLN+GIFG GT   S HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK LNH+IT
Sbjct  138  RFLNSGIFGNGTE--SSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHNIT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVG  G+ L   EA  LAGV  GFFELQ
Sbjct  196  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGSNGQVLNPTEAFNLAGVTSGFFELQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+A+ VLFEANILA++SEVLSAIFAEVM+GKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGLAATVLFEANILAIMSEVLSAIFAEVMNGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  316  PGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  351



>gb|AGE10617.1| phenylalanine amononia-lyase, partial [Lonicera macranthoides]
Length=581

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = +1

Query  121  FLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITP  300
            FLNAGIFG GT   S HTL  SATRAAMLVRINTLLQGYSGIRFEILEA+TKLLNH ITP
Sbjct  1    FLNAGIFGNGTE--STHTLSQSATRAAMLVRINTLLQGYSGIRFEILEALTKLLNHDITP  58

Query  301  CLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQP  480
            CLPLRG+ITASGD+VPLSYIAG+LTGRPNSK VGP G+ L   EA +LAG++GGFFELQP
Sbjct  59   CLPLRGTITASGDLVPLSYIAGILTGRPNSKCVGPSGKPLGPTEAFQLAGIKGGFFELQP  118

Query  481  KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  660
            KEGLALVNGTAVGSG+AS+VLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHHP
Sbjct  119  KEGLALVNGTAVGSGLASIVLFEVNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHHP  178

Query  661  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            GQIEAAA+MEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  179  GQIEAAAVMEHILDGSSYVKEAKKLHEMDPLQKPK  213



>gb|ABY51677.1| phenylalanine ammonia lyase [Plagiochasma appendiculatum]
Length=217

 Score =   343 bits (879),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +1

Query  163  SCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITPCLPLRGSITASGDI  342
            S HTLP SATRAAMLVR NTLLQGYSGIRFE+LEAITKLLNH+ITPCLPLRG+ITASGD+
Sbjct  2    SSHTLPRSATRAAMLVRFNTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASGDL  61

Query  343  VPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQPKEGLALVNGTAVGS  522
            VPLSYIAGLLTGRPNSKAVGP GE L+  EA   AG+ GGFFELQPKEGLALVNGTAVGS
Sbjct  62   VPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQPKEGLALVNGTAVGS  121

Query  523  GMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHILD  702
            G+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHILD
Sbjct  122  GLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILD  181

Query  703  GSHFMKAAQKLHEMDPLQKPQ  765
            GS ++K AQKLHE+DPLQKP+
Sbjct  182  GSAYVKEAQKLHEIDPLQKPK  202



>ref|XP_002315309.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
 gb|EEF01480.2| hypothetical protein POPTR_0010s23110g [Populus trichocarpa]
Length=707

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP SATRAAMLVR NTLLQGYSGIRFE+LEAITKLLNH+IT
Sbjct  125  RFLNAGIFGNGTE--SSHTLPCSATRAAMLVRTNTLLQGYSGIRFEMLEAITKLLNHNIT  182

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L+  EA   AG+ GGFFELQ
Sbjct  183  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQ  242

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL H+LKHH
Sbjct  243  PKEGLALVNGTAVGSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHRLKHH  302

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKL+E+DPLQKP+
Sbjct  303  PGQIEAAAIMEHILDGSSYVKEAQKLNEIDPLQKPK  338



>gb|AAN32867.1|AF460204_1 phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=619

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 195/216 (90%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   + HTLPHSATRA+MLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  37   RFLNAGIFGNGTE--TSHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  94

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYI GLLTGRPNSKAVGP G+ + A EA  LAG+  GFFELQ
Sbjct  95   PCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPDGKFVNATEAFSLAGIDTGFFELQ  154

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
             KEGLALVNGTAVGS +ASMVLFEANILAVL+EVLS IFAEVMHGKPEFTDHL HKLKHH
Sbjct  155  AKEGLALVNGTAVGSALASMVLFEANILAVLAEVLSGIFAEVMHGKPEFTDHLTHKLKHH  214

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS F+K AQ++HE DPLQKP+
Sbjct  215  PGQIEAAAIMEHILDGSSFVKEAQRVHEFDPLQKPK  250



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP SATRAAMLVR NTLLQGYSGIRFE+LEAITK++NH+IT
Sbjct  129  RFLNAGIFGNGTE--SSHTLPRSATRAAMLVRTNTLLQGYSGIRFEMLEAITKMINHNIT  186

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE LT  EA   AG+ GGFFELQ
Sbjct  187  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLTPAEAFTQAGIDGGFFELQ  246

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247  PKEGLALVNGTAVGSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQI AAAIMEHILDGS ++K AQKLHE+DPLQKP+
Sbjct  307  PGQIVAAAIMEHILDGSAYVKEAQKLHEIDPLQKPK  342



>ref|XP_010067318.1| PREDICTED: phenylalanine ammonia-lyase [Eucalyptus grandis]
 gb|KCW65431.1| hypothetical protein EUGRSUZ_G02851 [Eucalyptus grandis]
Length=714

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCH LPHSATRAAMLVRINTLLQGYSGIRFEILE + KLLN +IT
Sbjct  132  RFLNAGIFGNGTE--SCHVLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE+L A EA +LAG++ GFF+LQ
Sbjct  190  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIKHGFFDLQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLA+VNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLAIVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQK+HE+DPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKDAQKVHEIDPLQKPK  345



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   359 bits (922),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP +ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN++IT
Sbjct  136  RFLNAGIFGNGTE--SSHTLPQTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  193

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A+EA +LAG+  GFFELQ
Sbjct  194  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFQLAGINDGFFELQ  253

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGS +AS+VLF+ANIL VLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  254  PKEGLALVNGTAVGSALASIVLFDANILVVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  313

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KA +KLHEMDPLQKP+
Sbjct  314  PGQIEAAAIMEHILDGSSYVKADKKLHEMDPLQKPK  349



>gb|AEM63670.1| phenylalanine ammonia lyase 1 [Platycodon grandiflorus]
Length=710

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLPHSATRAAMLVR+NTLLQGYSGIRFEILEAITK LNH++T
Sbjct  130  RFLNAGIFGNGTE--SSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILEAITKFLNHNVT  187

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AE+A  LAGV+ GFFELQ
Sbjct  188  PVLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGQVLNAEQAFGLAGVEDGFFELQ  247

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNG AVGSGMASMVLF+AN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  248  PKEGLALVNGAAVGSGMASMVLFDANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  307

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIME+ILDGS ++K A K+HEMDPLQKP+
Sbjct  308  PGQIEAAAIMEYILDGSDYVKEAAKVHEMDPLQKPK  343



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 199/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N++IT
Sbjct  102  RFLNAGIFGNGTE--STHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLINNNIT  159

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGR NSKAVGP GE + A+EA +LAG+  GFFELQ
Sbjct  160  PCLPLRGTVTASGDLVPLSYIAGLLTGRQNSKAVGPSGEVVNAKEAFQLAGIDSGFFELQ  219

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLF+AN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  220  PKEGLALVNGTAVGSGLASIVLFDANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  279

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  280  PGQIEAAAIMEHILDGSSYMKAAKKLHEVDPLQKPK  315



>ref|XP_004143255.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis sativus]
 gb|KGN48160.1| Phenylalanine ammonia-lyase [Cucumis sativus]
Length=714

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG GT   S HTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH++T
Sbjct  132  RFLNAGVFGNGTE--SSHTLPHLATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGR NSKA+GP GE+L A+EA K A +  GFFELQ
Sbjct  190  PCLPLRGTITASGDLVPLSYIAGLLTGRSNSKAIGPNGESLDAKEAFKQASIPSGFFELQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILAVL+E++SAIFAEVM GKPEFTDHL HKLKHH
Sbjct  250  PKEGLALVNGTAVGSGLASIVLFEANILAVLAEIMSAIFAEVMQGKPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  345



>gb|ACP28056.1| phenylalanine amonnia lyase [Populus simonii x Populus nigra]
Length=404

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 191/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  142  GTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSITPCLPLRGS  321
            G GT   S  TLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNH+ITPCLPLRG+
Sbjct  1    GNGTE--STQTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  58

Query  322  ITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQPKEGLALV  501
            ITASGD+VPLSYIAGLLTGRPNSKAVGP GE L A EA  LAG+ GGFFELQPKEGLALV
Sbjct  59   ITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALV  118

Query  502  NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  681
            NGTAVGSG+ASMVLFEAN+LA+LSEVLSAI AEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  119  NGTAVGSGLASMVLFEANVLAILSEVLSAISAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  178

Query  682  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            IMEHIL+GS ++KAAQKLHE+DPLQKP+
Sbjct  179  IMEHILNGSSYVKAAQKLHEIDPLQKPK  206



>ref|XP_010067319.1| PREDICTED: phenylalanine ammonia-lyase-like [Eucalyptus grandis]
 gb|KCW65432.1| hypothetical protein EUGRSUZ_G02852 [Eucalyptus grandis]
Length=714

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   SCHTLPHS TRAAMLVRINTLLQGYSGIRFEILE + KLLN +IT
Sbjct  132  RFLNAGIFGNGTE--SCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNIT  189

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGRPNSKAVGP GE+L A EA +LAG++ GFF+LQ
Sbjct  190  PCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIEHGFFDLQ  249

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLA+VNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM G PEFTDHL HKLKHH
Sbjct  250  PKEGLAIVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGNPEFTDHLTHKLKHH  309

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++K AQKLHE+DPLQKP+
Sbjct  310  PGQIEAAAIMEHILDGSSYVKDAQKLHEIDPLQKPK  345



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 198/216 (92%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG GT   S HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+SIT
Sbjct  106  RFLNAGIFGNGTE--SSHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNSIT  163

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG++TASGD+VPLSYIAGLLTGR NSKAVGP GE L A+EA +LA +  GFFELQ
Sbjct  164  PCLPLRGTVTASGDLVPLSYIAGLLTGRQNSKAVGPSGEVLNAKEAFQLASIDSGFFELQ  223

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS+VLFEANILA+L+EVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  224  PKEGLALVNGTAVGSGLASIVLFEANILAILAEVLSAIFAEVMQGKPEFTDHLTHKLKHH  283

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  284  PGQIEAAAIMEHILDGSSYMKAAKKLHEVDPLQKPK  319



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   358 bits (920),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAG+FG+ T  G  HTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN+++T
Sbjct  138  RFLNAGVFGSATESG--HTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVT  195

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L A EA +L G+  GFFELQ
Sbjct  196  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSGFFELQ  255

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVMHGKPEFTDHL HKLKHH
Sbjct  256  PKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMHGKPEFTDHLTHKLKHH  315

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  316  PGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>gb|ACT53398.1| phenylalanine ammonia-lyase 1 [Ageratina adenophora]
Length=715

 Score =   358 bits (920),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+GT   S HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNH+IT
Sbjct  133  RFLNAGIFGSGTE--SSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  190

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            P LPLRG+ITASGD+VPLSYIAGLLTGR NSKAVGP GE L AE+A   AGV  GFFELQ
Sbjct  191  PVLPLRGTITASGDLVPLSYIAGLLTGRSNSKAVGPAGEILNAEKAFSEAGVADGFFELQ  250

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVG GMAS+VLFEAN+LA+LSEVLSA+FAEVM GKPEFTDHL HKLKHH
Sbjct  251  PKEGLALVNGTAVGFGMASIVLFEANVLALLSEVLSAVFAEVMQGKPEFTDHLAHKLKHH  310

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIM++ILDGS F+KAAQK+HEMDPLQKP+
Sbjct  311  PGQIEAAAIMKYILDGSDFVKAAQKVHEMDPLQKPK  346



>ref|XP_010553331.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Tarenaya hassleriana]
Length=725

 Score =   358 bits (920),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +1

Query  118  RFLNAGIFGTGTRKGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHSIT  297
            RFLNAGIFG+ T K   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAIT LLNH+I 
Sbjct  143  RFLNAGIFGSATEKS--HTLPQSTTRAAMLVRINTLLQGYSGIRFEILEAITSLLNHNIA  200

Query  298  PCLPLRGSITASGDIVPLSYIAGLLTGRPNSKAVGPIGealtaeealklaGVQGGFFELQ  477
            PCLPLRG+ITASGD+VPLSYIAGLLTGRPNSKA GP GE LTAEEA + AG+  GFF+LQ
Sbjct  201  PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGETLTAEEAFRSAGITSGFFDLQ  260

Query  478  PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  657
            PKEGLALVNGTAVGSG+ASMVLF+AN+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  261  PKEGLALVNGTAVGSGLASMVLFDANVLAVLSEVLSAIFAEVMTGKPEFTDHLTHKLKHH  320

Query  658  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  765
            PGQIEAAAIMEHILDGS +MK AQK+HEMDPLQKP+
Sbjct  321  PGQIEAAAIMEHILDGSSYMKLAQKIHEMDPLQKPK  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360