BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047K18

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010658537.1|  PREDICTED: probable phosphoribosylformylglyc...    236   2e-67   Vitis vinifera
ref|XP_009630454.1|  PREDICTED: probable phosphoribosylformylglyc...    235   3e-67   Nicotiana tomentosiformis
ref|XP_009788513.1|  PREDICTED: probable phosphoribosylformylglyc...    234   7e-67   Nicotiana sylvestris
ref|XP_004233026.1|  PREDICTED: probable phosphoribosylformylglyc...    232   4e-66   Solanum lycopersicum
ref|XP_006362398.1|  PREDICTED: probable phosphoribosylformylglyc...    232   4e-66   Solanum tuberosum [potatoes]
ref|XP_009371080.1|  PREDICTED: probable phosphoribosylformylglyc...    231   5e-66   
ref|XP_009373601.1|  PREDICTED: probable phosphoribosylformylglyc...    231   6e-66   Pyrus x bretschneideri [bai li]
ref|XP_009371075.1|  PREDICTED: probable phosphoribosylformylglyc...    231   6e-66   Pyrus x bretschneideri [bai li]
ref|XP_009371082.1|  PREDICTED: probable phosphoribosylformylglyc...    231   7e-66   
ref|XP_011002631.1|  PREDICTED: probable phosphoribosylformylglyc...    229   2e-65   Populus euphratica
gb|KDO69154.1|  hypothetical protein CISIN_1g000572mg                   228   3e-65   Citrus sinensis [apfelsine]
ref|XP_008337483.1|  PREDICTED: LOW QUALITY PROTEIN: probable pho...    229   4e-65   
ref|XP_011085040.1|  PREDICTED: probable phosphoribosylformylglyc...    229   4e-65   Sesamum indicum [beniseed]
ref|XP_008352301.1|  PREDICTED: probable phosphoribosylformylglyc...    229   4e-65   
ref|XP_002315209.2|  phosphoribosylformylglycinamidine synthase f...    229   4e-65   
ref|XP_007200335.1|  hypothetical protein PRUPE_ppa000243mg             229   5e-65   Prunus persica
emb|CDP12696.1|  unnamed protein product                                226   5e-65   Coffea canephora [robusta coffee]
ref|XP_008237658.1|  PREDICTED: probable phosphoribosylformylglyc...    228   6e-65   
ref|XP_004170044.1|  PREDICTED: LOW QUALITY PROTEIN: probable pho...    228   6e-65   
ref|XP_004148187.1|  PREDICTED: probable phosphoribosylformylglyc...    228   6e-65   Cucumis sativus [cucumbers]
gb|KJB62495.1|  hypothetical protein B456_009G419700                    228   7e-65   Gossypium raimondii
ref|XP_002312111.2|  hypothetical protein POPTR_0008s05880g             228   1e-64   Populus trichocarpa [western balsam poplar]
gb|KHG19255.1|  hypothetical protein F383_23948                         228   1e-64   Gossypium arboreum [tree cotton]
ref|XP_008454828.1|  PREDICTED: LOW QUALITY PROTEIN: probable pho...    228   1e-64   Cucumis melo [Oriental melon]
ref|XP_010027660.1|  PREDICTED: probable phosphoribosylformylglyc...    227   1e-64   Eucalyptus grandis [rose gum]
ref|XP_006486399.1|  PREDICTED: probable phosphoribosylformylglyc...    227   2e-64   
ref|XP_006435635.1|  hypothetical protein CICLE_v10030516mg             227   2e-64   Citrus clementina [clementine]
gb|KDO69155.1|  hypothetical protein CISIN_1g000572mg                   227   2e-64   Citrus sinensis [apfelsine]
ref|XP_007027277.1|  Purine biosynthesis 4                              227   2e-64   
gb|EYU19934.1|  hypothetical protein MIMGU_mgv1a000220mg                226   3e-64   Erythranthe guttata [common monkey flower]
ref|XP_008219161.1|  PREDICTED: probable phosphoribosylformylglyc...    226   3e-64   Prunus mume [ume]
gb|KDP35259.1|  hypothetical protein JCGZ_09418                         216   4e-64   Jatropha curcas
ref|XP_007225512.1|  hypothetical protein PRUPE_ppa000246mg             225   7e-64   Prunus persica
gb|KHN07581.1|  Putative phosphoribosylformylglycinamidine syntha...    225   9e-64   Glycine soja [wild soybean]
ref|XP_002524208.1|  Phosphoribosylformylglycinamidine synthase, ...    224   2e-63   Ricinus communis
ref|XP_009420338.1|  PREDICTED: probable phosphoribosylformylglyc...    224   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010242666.1|  PREDICTED: probable phosphoribosylformylglyc...    224   2e-63   Nelumbo nucifera [Indian lotus]
gb|AAO23951.1|  phosphoribosylformylglycinamidine synthase              223   3e-63   Glycine max [soybeans]
ref|XP_003538419.1|  PREDICTED: probable phosphoribosylformylglyc...    223   4e-63   
ref|XP_007135941.1|  hypothetical protein PHAVU_009G004700g             223   4e-63   Phaseolus vulgaris [French bean]
ref|XP_010668487.1|  PREDICTED: probable phosphoribosylformylglyc...    223   5e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004301174.1|  PREDICTED: probable phosphoribosylformylglyc...    221   2e-62   Fragaria vesca subsp. vesca
gb|KDP44919.1|  hypothetical protein JCGZ_01419                         221   4e-62   Jatropha curcas
ref|NP_001130959.1|  uncharacterized protein LOC100192064               205   7e-62   
gb|KEH21294.1|  phosphoribosylformylglycinamidine synthase              218   3e-61   Medicago truncatula
gb|KEH24969.1|  phosphoribosylformylglycinamidine synthase              218   3e-61   Medicago truncatula
ref|XP_004503568.1|  PREDICTED: probable phosphoribosylformylglyc...    217   6e-61   Cicer arietinum [garbanzo]
ref|XP_010543774.1|  PREDICTED: probable phosphoribosylformylglyc...    217   9e-61   Tarenaya hassleriana [spider flower]
ref|XP_008788295.1|  PREDICTED: probable phosphoribosylformylglyc...    216   1e-60   Phoenix dactylifera
ref|XP_010908309.1|  PREDICTED: probable phosphoribosylformylglyc...    216   2e-60   
ref|XP_010428408.1|  PREDICTED: probable phosphoribosylformylglyc...    216   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010471513.1|  PREDICTED: probable phosphoribosylformylglyc...    215   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010416277.1|  PREDICTED: probable phosphoribosylformylglyc...    215   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006390444.1|  hypothetical protein EUTSA_v10018011mg             215   3e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006300588.1|  hypothetical protein CARUB_v10019663mg             215   3e-60   Capsella rubella
ref|NP_177566.3|  phosphoribosylformylglycinamidine synthase            215   4e-60   Arabidopsis thaliana [mouse-ear cress]
gb|ABW87767.1|  phosphoribosylformylglycinamidine synthase              215   4e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52403.1|AC020579_5  putative phosphoribosylformylglycinamid...    214   4e-60   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA35603.1|  TPA: hypothetical protein ZEAMMB73_742845              207   6e-60   
ref|XP_008671054.1|  PREDICTED: probable phosphoribosylformylglyc...    207   6e-60   
ref|XP_002888969.1|  hypothetical protein ARALYDRAFT_476563             214   1e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_007163437.1|  hypothetical protein PHAVU_001G234500g             213   1e-59   Phaseolus vulgaris [French bean]
emb|CDX68192.1|  BnaA07g22320D                                          213   1e-59   
emb|CDX85818.1|  BnaC06g23160D                                          213   2e-59   
gb|AAL55431.1|  formylglycinamide ribonucleotide amidotransferase       213   2e-59   Vigna unguiculata
gb|KFK41873.1|  hypothetical protein AALP_AA2G182400                    213   2e-59   Arabis alpina [alpine rockcress]
ref|XP_009104771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pho...    213   2e-59   Brassica rapa
emb|CDX96528.1|  BnaA07g31390D                                          213   2e-59   
ref|XP_009106086.1|  PREDICTED: probable phosphoribosylformylglyc...    213   2e-59   Brassica rapa
ref|XP_010912732.1|  PREDICTED: probable phosphoribosylformylglyc...    211   6e-59   Elaeis guineensis
ref|XP_008675958.1|  PREDICTED: uncharacterized protein LOC100192...    211   1e-58   Zea mays [maize]
ref|NP_001045039.1|  Os01g0888500                                       207   1e-58   
ref|XP_008781955.1|  PREDICTED: probable phosphoribosylformylglyc...    211   1e-58   Phoenix dactylifera
gb|EMT12667.1|  Putative phosphoribosylformylglycinamidine syntha...    210   2e-58   
ref|XP_002463993.1|  hypothetical protein SORBIDRAFT_01g010140          209   4e-58   
gb|EMS66042.1|  putative phosphoribosylformylglycinamidine syntha...    209   5e-58   Triticum urartu
gb|EMT12449.1|  Putative phosphoribosylformylglycinamidine syntha...    209   7e-58   
ref|XP_004981981.1|  PREDICTED: probable phosphoribosylformylglyc...    208   7e-58   Setaria italica
ref|XP_004982886.1|  PREDICTED: probable phosphoribosylformylglyc...    208   7e-58   Setaria italica
gb|EAY76767.1|  hypothetical protein OsI_04723                          208   8e-58   Oryza sativa Indica Group [Indian rice]
gb|EMS48506.1|  putative phosphoribosylformylglycinamidine syntha...    208   9e-58   Triticum urartu
ref|XP_006645145.1|  PREDICTED: probable phosphoribosylformylglyc...    208   9e-58   
gb|EMT04637.1|  Putative phosphoribosylformylglycinamidine syntha...    207   1e-57   
dbj|BAD82369.1|  putative formylglycineamide ribotide amidotransf...    207   2e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EMS53942.1|  putative phosphoribosylformylglycinamidine syntha...    207   2e-57   Triticum urartu
gb|ADE77010.1|  unknown                                                 197   3e-57   Picea sitchensis
ref|XP_010240021.1|  PREDICTED: probable phosphoribosylformylglyc...    206   4e-57   
gb|EEE62020.1|  hypothetical protein OsJ_16802                          205   9e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006845743.1|  hypothetical protein AMTR_s00019p00246290          202   8e-56   Amborella trichopoda
ref|XP_002448676.1|  hypothetical protein SORBIDRAFT_06g031310          201   1e-55   
gb|KHG14750.1|  hypothetical protein F383_18060                         200   2e-55   Gossypium arboreum [tree cotton]
gb|EAY96218.1|  hypothetical protein OsI_18107                          201   4e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_010099731.1|  putative phosphoribosylformylglycinamidine s...    194   6e-53   
ref|XP_002981506.1|  hypothetical protein SELMODRAFT_114727             192   2e-52   
gb|EPS62326.1|  hypothetical protein M569_12463                         192   4e-52   Genlisea aurea
ref|XP_002963575.1|  hypothetical protein SELMODRAFT_165866             191   6e-52   
ref|XP_003601752.1|  Phosphoribosylformylglycinamidine synthase         186   5e-51   
gb|AES72003.2|  CobB/CobQ-like glutamine amidotransferase domain ...    186   6e-51   Medicago truncatula
ref|XP_001784004.1|  predicted protein                                  181   2e-48   
gb|KDD75098.1|  CobB/CobQ-like glutamine amidotransferase domain-...    160   8e-44   Helicosporidium sp. ATCC 50920
ref|XP_005648260.1|  AIR synthase-related protein                       162   1e-41   Coccomyxa subellipsoidea C-169
ref|XP_005844442.1|  hypothetical protein CHLNCDRAFT_139160             159   9e-41   Chlorella variabilis
ref|XP_002948800.1|  hypothetical protein VOLCADRAFT_58690              157   6e-40   Volvox carteri f. nagariensis
ref|XP_001696039.1|  AIR synthase-related protein                       156   9e-40   Chlamydomonas reinhardtii
ref|WP_038065041.1|  phosphoribosylformylglycinamidine synthase         153   1e-38   
ref|XP_002177389.1|  predicted protein                                  153   2e-38   Phaeodactylum tricornutum CCAP 1055/1
gb|EWM30331.1|  phosphoribosylformylglycinamidine synthase              152   3e-38   Nannochloropsis gaditana
ref|XP_002294498.1|  phosphoribosylformylglycinamidine synthase         151   7e-38   Thalassiosira pseudonana CCMP1335
ref|WP_012544968.1|  phosphoribosylformylglycinamidine synthase         149   3e-37   Thermodesulfovibrio yellowstonii
gb|EJK51092.1|  hypothetical protein THAOC_29768                        149   3e-37   Thalassiosira oceanica
ref|WP_038059314.1|  phosphoribosylformylglycinamidine synthase         149   3e-37   
ref|XP_002611349.1|  hypothetical protein BRAFLDRAFT_278091             148   7e-37   Branchiostoma floridae
ref|XP_004341600.1|  phosphoribosylformylglycinamidine synthase         147   1e-36   Acanthamoeba castellanii str. Neff
ref|XP_002741156.1|  PREDICTED: phosphoribosylformylglycinamidine...    144   1e-36   Saccoglossus kowalevskii
ref|XP_007513321.1|  predicted protein                                  146   3e-36   Bathycoccus prasinos
ref|XP_781955.3|  PREDICTED: phosphoribosylformylglycinamidine sy...    145   5e-36   
ref|XP_001641660.1|  predicted protein                                  145   5e-36   Nematostella vectensis
ref|XP_008118599.1|  PREDICTED: phosphoribosylformylglycinamidine...    144   2e-35   Anolis carolinensis [Carolina anole]
ref|WP_020256263.1|  hypothetical protein                               144   2e-35   
ref|XP_001418300.1|  predicted protein                                  144   2e-35   Ostreococcus lucimarinus CCE9901
ref|XP_004351784.1|  phosphoribosylformylglycinamide synthase           144   2e-35   Cavenderia fasciculata
ref|XP_008174296.1|  PREDICTED: phosphoribosylformylglycinamidine...    139   4e-35   
ref|XP_010785341.1|  PREDICTED: phosphoribosylformylglycinamidine...    143   4e-35   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006007111.1|  PREDICTED: phosphoribosylformylglycinamidine...    142   4e-35   
emb|CEF98481.1|  Glutamine amidotransferase                             142   6e-35   Ostreococcus tauri
ref|XP_005784999.1|  hypothetical protein EMIHUDRAFT_456050             138   7e-35   Emiliania huxleyi CCMP1516
ref|XP_002112809.1|  hypothetical protein TRIADDRAFT_56338              141   9e-35   Trichoplax adhaerens
emb|CAG01685.1|  unnamed protein product                                141   1e-34   Tetraodon nigroviridis
ref|XP_001745292.1|  hypothetical protein                               141   2e-34   Monosiga brevicollis MX1
ref|XP_002533184.1|  Phosphoribosylformylglycinamidine synthase, ...    141   2e-34   
ref|XP_010738061.1|  PREDICTED: phosphoribosylformylglycinamidine...    140   3e-34   
ref|XP_008175180.1|  PREDICTED: phosphoribosylformylglycinamidine...    140   4e-34   
ref|XP_011453116.1|  PREDICTED: phosphoribosylformylglycinamidine...    139   8e-34   Crassostrea gigas
ref|XP_005923257.1|  PREDICTED: phosphoribosylformylglycinamidine...    139   8e-34   
ref|XP_011453120.1|  PREDICTED: phosphoribosylformylglycinamidine...    139   9e-34   Crassostrea gigas
ref|XP_003062214.1|  predicted protein                                  139   1e-33   Micromonas pusilla CCMP1545
ref|XP_011453121.1|  PREDICTED: phosphoribosylformylglycinamidine...    139   1e-33   Crassostrea gigas
gb|EKC33036.1|  Phosphoribosylformylglycinamidine synthase              139   1e-33   
ref|XP_008175179.1|  PREDICTED: phosphoribosylformylglycinamidine...    138   2e-33   Chrysemys picta bellii
ref|XP_005710774.1|  phosphoribosylformylglycinamidine synthase         138   2e-33   Chondrus crispus [carageen]
gb|KDR16414.1|  Phosphoribosylformylglycinamidine synthase              138   2e-33   Zootermopsis nevadensis
ref|XP_003974141.1|  PREDICTED: phosphoribosylformylglycinamidine...    138   2e-33   
gb|EFA75406.1|  phosphoribosylformylglycinamide synthase                138   2e-33   Heterostelium album PN500
ref|XP_008405530.1|  PREDICTED: phosphoribosylformylglycinamidine...    137   4e-33   Poecilia reticulata
ref|XP_008405528.1|  PREDICTED: phosphoribosylformylglycinamidine...    137   4e-33   Poecilia reticulata
ref|XP_007259559.1|  PREDICTED: phosphoribosylformylglycinamidine...    137   5e-33   
ref|XP_005795740.1|  PREDICTED: phosphoribosylformylglycinamidine...    137   6e-33   Xiphophorus maculatus
ref|XP_004557308.1|  PREDICTED: phosphoribosylformylglycinamidine...    137   6e-33   
ref|XP_008305437.1|  PREDICTED: phosphoribosylformylglycinamidine...    136   7e-33   
ref|XP_005479005.1|  PREDICTED: phosphoribosylformylglycinamidine...    136   7e-33   
ref|XP_002507834.1|  predicted protein                                  136   9e-33   Micromonas commoda
ref|XP_011332505.1|  PREDICTED: phosphoribosylformylglycinamidine...    136   9e-33   
ref|XP_625036.3|  PREDICTED: phosphoribosylformylglycinamidine sy...    136   1e-32   
ref|XP_011332506.1|  PREDICTED: phosphoribosylformylglycinamidine...    136   1e-32   
ref|XP_005732481.1|  PREDICTED: phosphoribosylformylglycinamidine...    135   1e-32   
ref|XP_006132850.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    135   1e-32   
gb|EFN81618.1|  Phosphoribosylformylglycinamidine synthase              133   1e-32   Harpegnathos saltator
ref|WP_035228399.1|  phosphoribosylformylglycinamidine synthase         135   2e-32   
ref|WP_028579477.1|  phosphoribosylformylglycinamidine synthase         135   2e-32   Desulfobulbus japonicus
ref|XP_007550599.1|  PREDICTED: phosphoribosylformylglycinamidine...    135   2e-32   Poecilia formosa
ref|XP_006790584.1|  PREDICTED: phosphoribosylformylglycinamidine...    135   2e-32   Neolamprologus brichardi [lyretail cichlid]
gb|ENN76633.1|  hypothetical protein YQE_06853                          135   2e-32   Dendroctonus ponderosae
ref|XP_003696360.1|  PREDICTED: phosphoribosylformylglycinamidine...    135   2e-32   
ref|WP_023408324.1|  hypothetical protein                               135   2e-32   
emb|CDQ90799.1|  unnamed protein product                                134   3e-32   Oncorhynchus mykiss
ref|XP_009034351.1|  hypothetical protein AURANDRAFT_22512              135   3e-32   Aureococcus anophagefferens
ref|XP_636865.1|  phosphoribosylformylglycinamide synthase              134   3e-32   Dictyostelium discoideum AX4
ref|XP_004068232.1|  PREDICTED: phosphoribosylformylglycinamidine...    134   6e-32   Oryzias latipes [Japanese rice fish]
ref|XP_006635368.1|  PREDICTED: phosphoribosylformylglycinamidine...    133   9e-32   
ref|XP_003080020.1|  putative formylglycineamide ribotide am (ISS)      133   9e-32   
ref|XP_007893212.1|  PREDICTED: phosphoribosylformylglycinamidine...    133   1e-31   Callorhinchus milii [Australian ghost shark]
emb|CBN75952.1|  conserved unknown protein                              123   1e-31   Ectocarpus siliculosus
ref|XP_002422737.1|  Phosphoribosylformylglycinamidine synthase, ...    133   1e-31   Pediculus humanus corporis [human body lice]
ref|XP_011144014.1|  PREDICTED: phosphoribosylformylglycinamidine...    132   1e-31   
ref|XP_002901032.1|  phosphoribosylformylglycinamidine synthase         132   1e-31   Phytophthora infestans T30-4
gb|ETM46329.1|  phosphoribosylformylglycinamidine synthase              132   2e-31   Phytophthora parasitica
gb|ETP44396.1|  phosphoribosylformylglycinamidine synthase              132   2e-31   Phytophthora parasitica P10297
gb|ETL93031.1|  phosphoribosylformylglycinamidine synthase              132   2e-31   Phytophthora parasitica
gb|ETK86489.1|  phosphoribosylformylglycinamidine synthase              132   2e-31   Phytophthora parasitica
gb|ELT92693.1|  hypothetical protein CAPTEDRAFT_187787                  132   2e-31   Capitella teleta
ref|XP_006623325.1|  PREDICTED: phosphoribosylformylglycinamidine...    132   2e-31   
ref|XP_005097983.1|  PREDICTED: phosphoribosylformylglycinamidine...    131   2e-31   
ref|XP_006271916.1|  PREDICTED: phosphoribosylformylglycinamidine...    132   3e-31   
gb|AAI68641.1|  Unknown (protein for MGC:186503)                        132   3e-31   Xenopus tropicalis [western clawed frog]
ref|NP_001135692.2|  phosphoribosylformylglycinamidine synthase         132   3e-31   
ref|XP_002405859.1|  phosphoribosylformylglycinamidine synthase, ...    131   4e-31   
ref|XP_002788692.1|  Phosphoribosylformylglycinamidine synthase, ...    131   4e-31   Perkinsus marinus ATCC 50983
ref|XP_011311335.1|  PREDICTED: phosphoribosylformylglycinamidine...    131   4e-31   Fopius arisanus
ref|XP_008905954.1|  hypothetical protein PPTG_22971                    131   4e-31   Phytophthora parasitica INRA-310
ref|XP_009047509.1|  hypothetical protein LOTGIDRAFT_172386             131   5e-31   Lottia gigantea
ref|XP_005827926.1|  hypothetical protein GUITHDRAFT_159919             131   5e-31   Guillardia theta CCMP2712
ref|XP_003399743.1|  PREDICTED: phosphoribosylformylglycinamidine...    131   5e-31   Bombus terrestris [large earth bumblebee]
gb|ETO75251.1|  phosphoribosylformylglycinamidine synthase              131   6e-31   Phytophthora parasitica P1976
gb|ETI46549.1|  phosphoribosylformylglycinamidine synthase              131   6e-31   Phytophthora parasitica P1569
ref|NP_001038667.1|  phosphoribosylformylglycinamidine synthase         131   6e-31   Danio rerio [leopard danio]
ref|XP_003493767.1|  PREDICTED: phosphoribosylformylglycinamidine...    131   6e-31   Bombus impatiens
ref|XP_003704098.1|  PREDICTED: phosphoribosylformylglycinamidine...    130   8e-31   Megachile rotundata
ref|WP_015403497.1|  phosphoribosylformylglycinamidine synthase, ...    130   1e-30   Desulfocapsa sulfexigens
ref|XP_001605732.2|  PREDICTED: phosphoribosylformylglycinamidine...    129   2e-30   Nasonia vitripennis
ref|XP_009527762.1|  hypothetical protein PHYSODRAFT_544320             129   3e-30   Phytophthora sojae
ref|XP_008870446.1|  phosphoribosylformylglycinamidine synthase         129   4e-30   Aphanomyces invadans
ref|XP_006038090.1|  PREDICTED: phosphoribosylformylglycinamidine...    128   5e-30   
ref|XP_010870190.1|  PREDICTED: phosphoribosylformylglycinamidine...    128   6e-30   Esox lucius
ref|XP_011156619.1|  PREDICTED: phosphoribosylformylglycinamidine...    127   8e-30   Solenopsis invicta [imported red fire ant]
ref|XP_008275697.1|  PREDICTED: phosphoribosylformylglycinamidine...    127   9e-30   Stegastes partitus
ref|XP_011156621.1|  PREDICTED: phosphoribosylformylglycinamidine...    127   9e-30   Solenopsis invicta [imported red fire ant]
dbj|GAM20022.1|  hypothetical protein SAMD00019534_031970               127   9e-30   Acytostelium subglobosum LB1
ref|XP_011500809.1|  PREDICTED: phosphoribosylformylglycinamidine...    127   2e-29   Ceratosolen solmsi marchali
ref|XP_009841639.1|  phosphoribosylformylglycinamidine synthase         127   2e-29   Aphanomyces astaci
dbj|BAD93902.1|  putative phosphoribosylformylglycinamidine synthase    115   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011069258.1|  PREDICTED: phosphoribosylformylglycinamidine...    126   2e-29   Acromyrmex echinatior
ref|XP_011395662.1|  putative phosphoribosylformylglycinamidine s...    126   2e-29   Auxenochlorella protothecoides
ref|XP_005704110.1|  phosphoribosylformylglycinamidine synthase i...    126   3e-29   Galdieria sulphuraria
ref|XP_005704111.1|  phosphoribosylformylglycinamidine synthase i...    126   3e-29   Galdieria sulphuraria
gb|EFA11871.1|  hypothetical protein TcasGA2_TC005250                   119   5e-29   Tribolium castaneum [rust-red flour beetle]
ref|XP_008546689.1|  PREDICTED: phosphoribosylformylglycinamidine...    125   6e-29   
gb|ERG82296.1|  putative phosphoribosylformylglycinamidine synthase     125   6e-29   
gb|KFM75369.1|  Phosphoribosylformylglycinamidine synthase              125   7e-29   Stegodyphus mimosarum
emb|CDP12877.1|  unnamed protein product                                124   2e-28   Coffea canephora [robusta coffee]
emb|CBK22815.2|  unnamed protein product                                124   2e-28   Blastocystis hominis
ref|XP_008615067.1|  phosphoribosylformylglycinamidine synthase         124   2e-28   Saprolegnia diclina VS20
gb|ADW16679.1|  phosphoribosylformylglycinamidine synthase              124   2e-28   Desulfobulbus propionicus DSM 2032
ref|WP_043769564.1|  phosphoribosylformylglycinamidine synthase         124   2e-28   
ref|XP_002051449.1|  GJ12184                                            123   3e-28   Drosophila virilis
ref|WP_028317064.1|  phosphoribosylformylglycinamidine synthase         123   3e-28   Desulfobulbus elongatus
ref|XP_008482177.1|  PREDICTED: phosphoribosylformylglycinamidine...    123   5e-28   
gb|KDO20696.1|  phosphoribosylformylglycinamidine synthase              122   5e-28   Saprolegnia parasitica CBS 223.65
ref|XP_002089136.1|  GE18953                                            122   5e-28   
ref|XP_005177836.1|  PREDICTED: phosphoribosylformylglycinamidine...    122   6e-28   Musca domestica
gb|EKD40334.1|  hypothetical protein ACD_75C00086G0001                  119   7e-28   uncultured bacterium
ref|XP_008191757.1|  PREDICTED: phosphoribosylformylglycinamidine...    121   1e-27   
gb|EFA02192.1|  hypothetical protein TcasGA2_TC007848                   121   1e-27   
ref|XP_002078316.1|  GD22605                                            121   2e-27   
gb|KIZ03655.1|  phosphoribosylformylglycinamidinesynthase               111   3e-27   Monoraphidium neglectum
ref|WP_028584169.1|  phosphoribosylformylglycinamidine synthase         120   3e-27   Desulfobulbus mediterraneus
ref|XP_008191211.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    120   4e-27   
ref|XP_004931911.1|  PREDICTED: phosphoribosylformylglycinamidine...    120   4e-27   Bombyx mori [silk moth]
ref|XP_003293198.1|  phosphoribosylformylglycinamide synthase           119   5e-27   Dictyostelium purpureum
dbj|BAC36269.1|  unnamed protein product                                115   6e-27   Mus musculus [mouse]
ref|XP_002038039.1|  GM17967                                            119   6e-27   Drosophila sechellia
ref|NP_477212.1|  adenosine 2, isoform A                                119   8e-27   Drosophila melanogaster
ref|XP_011194055.1|  PREDICTED: phosphoribosylformylglycinamidine...    119   8e-27   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_001969506.1|  GG10143                                            119   8e-27   Drosophila erecta
gb|AAR82811.1|  GM01721p                                                119   8e-27   Drosophila melanogaster
gb|AAC46468.1|  formylglycineamide ribotide amidotransferase            119   8e-27   Drosophila melanogaster
ref|XP_001357193.2|  GA21563                                            119   1e-26   Drosophila pseudoobscura pseudoobscura
ref|XP_002014228.1|  GL19084                                            118   2e-26   Drosophila persimilis
ref|XP_002002285.1|  GI13543                                            118   2e-26   Drosophila mojavensis
ref|XP_001962326.1|  GF15410                                            118   2e-26   Drosophila ananassae
gb|KFD49934.1|  LOW QUALITY PROTEIN: hypothetical protein M513_09148    117   3e-26   Trichuris suis
gb|KHJ46666.1|  phosphoribosylformylglycinamidine synthase              117   3e-26   Trichuris suis
ref|XP_011201847.1|  PREDICTED: phosphoribosylformylglycinamidine...    117   3e-26   Bactrocera dorsalis [papaya fruit fly]
emb|CBK24395.2|  unnamed protein product                                117   4e-26   Blastocystis hominis
ref|XP_007166413.1|  PREDICTED: phosphoribosylformylglycinamidine...    117   4e-26   Balaenoptera acutorostrata scammoni
dbj|BAD32216.1|  mKIAA0361 protein                                      115   7e-26   Mus musculus [mouse]
ref|XP_006246673.1|  PREDICTED: phosphoribosylformylglycinamidine...    116   7e-26   Rattus norvegicus [brown rat]
ref|WP_006787962.1|  phosphoribosylformylglycinamidine synthase         116   7e-26   Thiorhodospira sibirica
ref|XP_006246672.1|  PREDICTED: phosphoribosylformylglycinamidine...    116   8e-26   Rattus norvegicus [brown rat]
ref|NP_001099261.1|  phosphoribosylformylglycinamidine synthase         116   9e-26   Rattus norvegicus [brown rat]
ref|XP_004212171.1|  PREDICTED: phosphoribosylformylglycinamidine...    115   9e-26   
ref|WP_035384028.1|  phosphoribosylformylglycinamidine synthase         115   1e-25   Ferriphaselus sp. R-1
ref|WP_011187949.1|  phosphoribosylformylglycinamidine synthase         115   1e-25   Desulfotalea psychrophila
emb|CCA20895.1|  predicted protein putative                             115   1e-25   Albugo laibachii Nc14
ref|XP_003747373.1|  PREDICTED: phosphoribosylformylglycinamidine...    115   1e-25   Galendromus occidentalis
ref|NP_001152991.1|  phosphoribosylformylglycinamidine synthase         115   1e-25   Mus musculus [mouse]
gb|AAI14998.1|  Pfas protein                                            115   1e-25   Mus musculus [mouse]
ref|WP_009522589.1|  phosphoribosylformylglycinamidine synthase         115   1e-25   
ref|WP_029407779.1|  phosphoribosylformylglycinamidine synthase         115   2e-25   Thiomicrorhabdus sp. Milos-T2
ref|XP_002065341.1|  GK15397                                            115   2e-25   Drosophila willistoni
ref|WP_041522575.1|  phosphoribosylformylglycinamidine synthase         115   2e-25   Gilvimarinus agarilyticus
ref|WP_040728361.1|  phosphoribosylformylglycinamidine synthase         114   2e-25   Thiomicrorhabdus sp. Kp2
ref|WP_012435846.1|  MULTISPECIES: phosphoribosylformylglycinamid...    114   3e-25   Ralstonia pickettii
ref|WP_012376515.1|  phosphoribosylformylglycinamidine synthase         114   3e-25   Opitutus terrae
gb|EKE11616.1|  hypothetical protein ACD_15C00047G0014                  112   3e-25   uncultured bacterium
ref|WP_004180222.1|  Phosphoribosylformylglycinamidine synthase,s...    114   3e-25   Nitrosospira lacus
gb|KHN83776.1|  putative phosphoribosylformylglycinamidine synthase     114   3e-25   Toxocara canis
ref|XP_004329217.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    114   4e-25   
ref|XP_004266915.1|  PREDICTED: phosphoribosylformylglycinamidine...    114   5e-25   Orcinus orca [Orca]
dbj|BAH72555.1|  hypothetical protein                                   110   5e-25   Acyrthosiphon pisum
ref|XP_008853975.1|  PREDICTED: phosphoribosylformylglycinamidine...    114   5e-25   
gb|EWM22060.1|  phosphoribosylformylglycinamidine synthase              113   6e-25   
ref|WP_021194563.1|  phosphoribosylformylglycinamidine synthase         113   7e-25   
ref|XP_002921212.1|  PREDICTED: phosphoribosylformylglycinamidine...    113   8e-25   
ref|XP_011225706.1|  PREDICTED: phosphoribosylformylglycinamidine...    113   8e-25   
ref|WP_039374024.1|  phosphoribosylformylglycinamidine synthase         113   8e-25   
ref|XP_011225708.1|  PREDICTED: phosphoribosylformylglycinamidine...    113   8e-25   
gb|EFB18789.1|  hypothetical protein PANDA_010062                       113   8e-25   
ref|WP_004626994.1|  phosphoribosylformylglycinamidine synthase         113   8e-25   
ref|NP_001156565.1|  phosphoribosylformylglycinamidine synthase         113   8e-25   
ref|WP_009238069.1|  MULTISPECIES: phosphoribosylformylglycinamid...    113   8e-25   
ref|WP_016957635.1|  phosphoribosylformylglycinamidine synthase         113   8e-25   
gb|ETE69596.1|  Phosphoribosylformylglycinamidine synthase              113   9e-25   
ref|WP_024972671.1|  phosphoribosylformylglycinamidine synthase         113   9e-25   
ref|WP_039597402.1|  phosphoribosylformylglycinamidine synthase         113   9e-25   
ref|XP_002806843.2|  PREDICTED: phosphoribosylformylglycinamidine...    113   9e-25   
ref|XP_007457880.1|  PREDICTED: phosphoribosylformylglycinamidine...    112   9e-25   
ref|WP_035014763.1|  phosphoribosylformylglycinamidine synthase         113   9e-25   
ref|WP_012762042.1|  phosphoribosylformylglycinamidine synthase         113   9e-25   
gb|ETN79122.1|  hypothetical protein NECAME_10012                       110   1e-24   
ref|XP_007457879.1|  PREDICTED: phosphoribosylformylglycinamidine...    113   1e-24   
ref|WP_011902781.1|  phosphoribosylformylglycinamidine synthase         113   1e-24   
ref|WP_024850762.1|  phosphoribosylformylglycinamidine synthase         113   1e-24   
ref|WP_038637556.1|  phosphoribosylformylglycinamidine synthase         112   1e-24   
ref|WP_009512412.1|  phosphoribosylformylglycinamidine synthase         112   1e-24   
ref|WP_026609887.1|  phosphoribosylformylglycinamidine synthase         112   1e-24   
ref|WP_007363960.1|  phosphoribosylformylglycinamidine synthase         112   1e-24   
gb|EDL10468.1|  mCG11230                                                112   1e-24   
emb|CEN55644.1|  phosphoribosylformyl-glycineamide synthetase           112   1e-24   
ref|WP_024975607.1|  phosphoribosylformylglycinamidine synthase         112   2e-24   
ref|WP_010562078.1|  phosphoribosylformylglycinamidine synthase         112   2e-24   
ref|WP_010383035.1|  phosphoribosylformylglycinamidine synthase         112   2e-24   
ref|WP_027681392.1|  phosphoribosylformylglycinamidine synthase         112   2e-24   
ref|WP_043345959.1|  phosphoribosylformylglycinamidine synthase         112   2e-24   
ref|WP_009832997.1|  phosphoribosylformylglycinamidine synthase         112   2e-24   
ref|XP_007632767.1|  PREDICTED: phosphoribosylformylglycinamidine...    112   2e-24   
ref|WP_016708370.1|  phosphoribosylformylglycinamidine synthase         112   2e-24   
ref|XP_007086055.1|  PREDICTED: phosphoribosylformylglycinamidine...    112   2e-24   
ref|XP_004594959.1|  PREDICTED: phosphoribosylformylglycinamidine...    112   2e-24   
ref|XP_004013351.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   2e-24   
ref|XP_850167.2|  PREDICTED: phosphoribosylformylglycinamidine sy...    112   2e-24   
ref|XP_004663137.1|  PREDICTED: phosphoribosylformylglycinamidine...    112   3e-24   
ref|WP_026035439.1|  phosphoribosylformylglycinamidine synthase         111   3e-24   
ref|WP_026685627.1|  phosphoribosylformylglycinamidine synthase         111   3e-24   
emb|CCA86487.1|  phosphoribosylformyl-glycineamide synthetase (FG...    111   3e-24   
ref|XP_003996245.1|  PREDICTED: phosphoribosylformylglycinamidine...    111   3e-24   
ref|WP_013212437.1|  phosphoribosylformylglycinamidine synthase         111   3e-24   
ref|WP_029938442.1|  phosphoribosylformylglycinamidine synthase         111   3e-24   
ref|WP_033076181.1|  phosphoribosylformylglycinamidine synthase         111   3e-24   
ref|WP_012357864.1|  phosphoribosylformylglycinamidine synthase         111   4e-24   
ref|XP_006863468.1|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|XP_006062968.1|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|XP_010594903.1|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|XP_005894884.1|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|WP_015767745.1|  phosphoribosylformylglycinamidine synthase         111   4e-24   
gb|ELR57043.1|  Phosphoribosylformylglycinamidine synthase              111   4e-24   
ref|WP_026921870.1|  phosphoribosylformylglycinamidine synthase         111   4e-24   
ref|XP_005220416.2|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|XP_010841344.1|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|XP_005959831.1|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|XP_001988021.1|  GH10940                                            111   4e-24   
ref|XP_005220417.2|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|NP_001243493.1|  phosphoribosylformylglycinamidine synthase         111   4e-24   
ref|XP_003358324.2|  PREDICTED: phosphoribosylformylglycinamidine...    111   4e-24   
ref|WP_039611745.1|  phosphoribosylformylglycinamidine synthase         111   5e-24   
gb|EHP40251.1|  phosphoribosylformylglycinamidine synthase              110   5e-24   
ref|XP_006102662.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    111   5e-24   
ref|WP_013030151.1|  phosphoribosylformylglycinamidine synthase         111   5e-24   
ref|WP_020203689.1|  phosphoribosylformylglycinamidine synthase         110   5e-24   
ref|XP_010994785.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   5e-24   
ref|XP_006922428.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   5e-24   
gb|ELK03850.1|  Phosphoribosylformylglycinamidine synthase              110   5e-24   
ref|XP_010994784.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   5e-24   
ref|WP_043943575.1|  hypothetical protein                               104   5e-24   
ref|WP_026196481.1|  phosphoribosylformylglycinamidine synthase         110   5e-24   
ref|WP_011297559.1|  phosphoribosylformylglycinamidine synthase         110   5e-24   
ref|XP_011357232.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   6e-24   
ref|XP_010994778.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   6e-24   
ref|WP_011287673.1|  phosphoribosylformylglycinamidine synthase         110   6e-24   
ref|XP_011357233.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   6e-24   
ref|WP_038137127.1|  phosphoribosylformylglycinamidine synthase         110   6e-24   
ref|XP_004760271.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   6e-24   
ref|WP_019556412.1|  phosphoribosylformylglycinamidine synthase         110   6e-24   
ref|XP_002719027.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   6e-24   
emb|CDL60750.1|  Phosphoribosylformylglycinamidine synthase,synth...    104   6e-24   
ref|XP_003497221.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   7e-24   
ref|XP_004462480.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    110   7e-24   
ref|XP_004760270.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   7e-24   
ref|XP_004760272.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   7e-24   
ref|XP_004604897.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   7e-24   
emb|CCA79870.1|  phosphoribosylformyl-glycineamide synthetase (FG...    110   7e-24   
ref|XP_008268968.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   7e-24   
ref|WP_034925519.1|  phosphoribosylformylglycinamidine synthase         110   7e-24   
emb|CEP11831.1|  hypothetical protein                                   110   8e-24   
ref|WP_035550284.1|  phosphoribosylformylglycinamidine synthase         110   8e-24   
ref|WP_028196580.1|  phosphoribosylformylglycinamidine synthase         110   8e-24   
gb|ETN63588.1|  adenosine 2                                             110   8e-24   
ref|WP_028989314.1|  phosphoribosylformylglycinamidine synthase         110   8e-24   
ref|XP_006217842.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   8e-24   
ref|WP_044618112.1|  phosphoribosylformylglycinamidine synthase         110   8e-24   
gb|KIH65642.1|  hypothetical protein ANCDUO_04031                       107   8e-24   
ref|XP_007653938.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    110   8e-24   
gb|AAH06522.4|  PFAS protein                                            108   8e-24   
ref|XP_003466209.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    110   8e-24   
ref|WP_011615127.1|  phosphoribosylformylglycinamidine synthase         110   8e-24   
ref|WP_025223916.1|  phosphoribosylformylglycinamidine synthase         110   9e-24   
ref|WP_028995660.1|  phosphoribosylformylglycinamidine synthase         110   9e-24   
ref|XP_005332906.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   9e-24   
ref|XP_004857549.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   9e-24   
ref|WP_029773558.1|  phosphoribosylformylglycinamidine synthase         110   9e-24   
dbj|GAM51834.1|  phosphoribosylformylglycinamidine synthase, synt...    110   1e-23   
ref|WP_020184045.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|XP_007522516.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   1e-23   
ref|WP_001709342.1|  phosphoribosylformylglycinamidine synthase         104   1e-23   
ref|WP_039549095.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|XP_001650832.1|  AAEL005384-PA                                      110   1e-23   
ref|WP_013205937.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_010810062.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_043944323.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|XP_004376265.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   1e-23   
ref|WP_042589660.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_030103143.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|XP_001918417.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    110   1e-23   
ref|WP_003267822.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_014616981.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_024872627.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_015002623.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
emb|CDL13058.1|  Phosphoribosylformylglycinamidine synthase,synth...    103   1e-23   
ref|XP_010964259.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoribos...    110   1e-23   
emb|CDL23648.1|  Phosphoribosylformylglycinamidine synthase,synth...    103   1e-23   
ref|WP_039571515.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_023399500.1|  phosphoribosylformylglycinamidine synthase, ...    110   1e-23   
ref|XP_008579932.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   1e-23   
ref|XP_006176991.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   1e-23   
ref|XP_004531096.1|  PREDICTED: phosphoribosylformylglycinamidine...    110   1e-23   
ref|WP_008489350.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_042153164.1|  phosphoribosylformylglycinamidine synthase         109   1e-23   
ref|WP_035477682.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_039013772.1|  phosphoribosylformylglycinamidine synthase         110   1e-23   
ref|WP_043583797.1|  phosphoribosylformylglycinamidine synthase         109   1e-23   
gb|EXI91522.1|  Phosphoribosylformylglycinamidine synthase              108   1e-23   
dbj|GAN11340.1|  phosphoribosylformylglycinamidin                       109   1e-23   
ref|WP_013262293.1|  phosphoribosylformylglycinamidine synthase         109   1e-23   
ref|XP_005332905.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   1e-23   
gb|AAH63538.1|  PFAS protein                                            108   1e-23   
ref|WP_012400425.1|  phosphoribosylformylglycinamidine synthase         109   1e-23   
ref|WP_028363176.1|  phosphoribosylformylglycinamidine synthase         109   1e-23   
ref|WP_024569848.1|  MULTISPECIES: phosphoribosylformylglycinamid...    109   1e-23   
ref|XP_003929265.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   1e-23   
ref|WP_011516594.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_042551158.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_029846669.1|  hypothetical protein                               102   2e-23   
ref|WP_004588574.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|XP_007126682.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   2e-23   
ref|WP_004377585.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|XP_007126683.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   2e-23   
ref|XP_005067900.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   2e-23   
emb|CDL02505.1|  Phosphoribosylformylglycinamidine synthase,synth...    102   2e-23   
ref|WP_024034370.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|XP_006899247.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   2e-23   
ref|WP_013464273.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
emb|CEJ19072.1|  phosphoribosylformylglycinamidine synthase (fgam...    109   2e-23   
ref|WP_007585919.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_032303177.1|  hypothetical protein                               102   2e-23   
ref|WP_007746850.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|XP_004684670.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   2e-23   
ref|WP_005490987.1|  Phosphoribosylformylglycinamidine synthase,s...    109   2e-23   
ref|WP_016900247.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|XP_010613241.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   2e-23   
ref|WP_004582864.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_029148417.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_011370971.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_008130634.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
dbj|GAL23722.1|  phosphoribosylformylglycinamidine synthase synth...    103   2e-23   
ref|XP_005349865.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   2e-23   
ref|WP_013220670.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_006791595.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_006048953.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|WP_043427414.1|  hypothetical protein                               101   2e-23   
ref|XP_004712989.1|  PREDICTED: phosphoribosylformylglycinamidine...    108   2e-23   
gb|EHH57705.1|  Phosphoribosylformylglycinamidine synthase              109   2e-23   
ref|WP_036005222.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|NP_001126965.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
ref|XP_005582900.1|  PREDICTED: phosphoribosylformylglycinamidine...    109   2e-23   
ref|WP_008932805.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
gb|EPQ15504.1|  Phosphoribosylformylglycinamidine synthase              109   2e-23   
ref|WP_034877539.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
ref|WP_035870937.1|  phosphoribosylformylglycinamidine synthase         109   2e-23   
gb|EHH24505.1|  Phosphoribosylformylglycinamidine synthase              108   2e-23   
ref|WP_042312283.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
ref|WP_028835528.1|  MULTISPECIES: phosphoribosylformylglycinamid...    108   2e-23   
ref|WP_036979842.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
ref|WP_001734727.1|  phosphoribosylformylglycinamidine synthase         103   2e-23   
ref|WP_018315366.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
ref|WP_024601838.1|  MULTISPECIES: phosphoribosylformylglycinamid...    108   2e-23   
ref|XP_001112405.1|  PREDICTED: phosphoribosylformylglycinamidine...    108   2e-23   
ref|WP_001391226.1|  phosphoribosylformylglycinamidine synthase         102   2e-23   
emb|CDK95229.1|  Phosphoribosylformylglycinamidine synthase,synth...    103   2e-23   
ref|WP_018005905.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
ref|XP_005878850.1|  PREDICTED: phosphoribosylformylglycinamidine...    108   2e-23   
ref|WP_012432925.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
ref|WP_018985854.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
ref|WP_009142424.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
ref|WP_017229523.1|  phosphoribosylformylglycinamidine synthase         108   2e-23   
emb|CDL41239.1|  Phosphoribosylformylglycinamidine synthase, synt...    107   2e-23   
ref|XP_009187913.1|  PREDICTED: phosphoribosylformylglycinamidine...    108   3e-23   
gb|EAW90069.1|  phosphoribosylformylglycinamidine synthase (FGAR ...    108   3e-23   
ref|WP_011488310.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
ref|WP_035820211.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
ref|WP_010321837.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
ref|WP_007181998.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
ref|XP_010360732.1|  PREDICTED: phosphoribosylformylglycinamidine...    108   3e-23   
emb|CEJ03172.1|  Putative Phosphoribosylformylglycinamidine synthase    104   3e-23   
ref|WP_013956517.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
ref|WP_029908139.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
emb|CDJ84174.1|  AIR synthase related protein domain containing p...    107   3e-23   
ref|WP_029968377.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
ref|WP_006578285.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
ref|XP_008008473.1|  PREDICTED: phosphoribosylformylglycinamidine...    108   3e-23   
ref|WP_008900517.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   
ref|WP_025822005.1|  phosphoribosylformylglycinamidine synthase         108   3e-23   



>ref|XP_010658537.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Vitis vinifera]
Length=1412

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMFKGMEGS LGVWAA GEGRAYFPDGS+L+
Sbjct  1264  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDGSVLD  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D GKPTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1324  SVIDSNLAPIRYCDDDGKPTEVYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V K GP PWLRMF  A EW S
Sbjct  1384  PWYPKQWNVDKAGPSPWLRMFQNAREWCS  1412



>ref|XP_009630454.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630455.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630456.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630457.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630458.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana tomentosiformis]
Length=1407

 Score =   235 bits (599),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I+ESPAIMFKGMEGS LGVWAA GEGRAYFPD S+ N
Sbjct  1259  DPSQPRFVHNESGRFECRFTSVTIEESPAIMFKGMEGSTLGVWAAHGEGRAYFPDDSVFN  1318

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAPV+   D G+PT++YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1319  HIVGSNLAPVKYCDDDGRPTDIYPFNLNGSPLGVAAICSPDGRHLAIMPHPERCFLMWQF  1378

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1379  PWYPKNWDVEKKGPSPWLRMFQNAREWCS  1407



>ref|XP_009788513.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nicotiana sylvestris]
Length=1407

 Score =   234 bits (597),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I+ESPAIMFKGMEGS LGVWAA GEGRAYFPD ++ N
Sbjct  1259  DPSQPRFVHNESGRFECRFTSVTIEESPAIMFKGMEGSTLGVWAAHGEGRAYFPDDNVFN  1318

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAPV+   D G+PT++YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1319  HIVGSNLAPVKYCDDDGRPTDIYPFNLNGSPLGVAAICSPDGRHLAIMPHPERCFLMWQF  1378

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1379  PWYPKNWDVEKKGPSPWLRMFQNAREWCS  1407



>ref|XP_004233026.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Solanum lycopersicum]
 ref|XP_010316815.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Solanum lycopersicum]
Length=1410

 Score =   232 bits (591),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FT+V I+E+PAIMFKGMEGS LGVWAA GEGRAYFPD SI N
Sbjct  1262  DPSQPRFIHNESGRFECRFTNVTIEETPAIMFKGMEGSTLGVWAAHGEGRAYFPDDSIFN  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAPV+   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1322  HILGSNLAPVKYCNDDGTPTEVYPFNPNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1382  PWYPKNWDVEKKGPSPWLRMFQNAREWCS  1410



>ref|XP_006362398.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X1 [Solanum tuberosum]
 ref|XP_006362399.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X2 [Solanum tuberosum]
Length=1410

 Score =   232 bits (591),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FT+V I+E+PAIMFKGMEGS LGVWAA GEGRAYFPD SI N
Sbjct  1262  DPSQPRFIHNESGRFECRFTNVTIEETPAIMFKGMEGSTLGVWAAHGEGRAYFPDDSIFN  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAPV+   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1322  HILGSNLAPVKYCDDDGTPTEVYPFNPNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1382  PWYPKNWDVEKKGPSPWLRMFQNAREWCS  1410



>ref|XP_009371080.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial isoform X1 [Pyrus x bretschneideri]
 ref|XP_009371081.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial isoform X1 [Pyrus x bretschneideri]
 ref|XP_009371085.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
 ref|XP_009371087.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
Length=1412

 Score =   231 bits (590),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSVAI++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1264  DPSQPRFIHNESGRFECRFTSVAIKDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1324  RLLHSKLAPVRYCDDDGNETELYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1384  PWYPKQWDVEKKGPSPWLRMFQNAREWCS  1412



>ref|XP_009373601.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
 ref|XP_009373602.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
 ref|XP_009373603.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
Length=1414

 Score =   231 bits (590),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSVAI++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1266  DPSQPRFIHNESGRFECRFTSVAIKDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1325

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1326  RLLHSKLAPVRYCDDDGNETELYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1385

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1386  PWYPKQWDVEKKGPSPWLRMFQNAREWCS  1414



>ref|XP_009371075.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Pyrus x bretschneideri]
Length=1412

 Score =   231 bits (590),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSVAI++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1264  DPSQPRFIHNESGRFECRFTSVAIKDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1324  RLLHSKLAPVRYCDDDGNETELYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1384  PWYPKQWDVEKKGPSPWLRMFQNAREWCS  1412



>ref|XP_009371082.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=1365

 Score =   231 bits (589),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSVAI++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1217  DPSQPRFIHNESGRFECRFTSVAIKDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1276

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1277  RLLHSKLAPVRYCDDDGNETELYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1336

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1337  PWYPKQWDVEKKGPSPWLRMFQNAREWCS  1365



>ref|XP_011002631.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Populus euphratica]
 ref|XP_011002632.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Populus euphratica]
Length=1413

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DP+QPR  HNES RFEC FTSV I++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1265  DPAQPRFVHNESGRFECRFTSVTIEDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1324

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1325  RVIHSNLAPVRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1384

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  W+V KKGP PWLRMF  A EW S
Sbjct  1385  PWYPTQWNVDKKGPSPWLRMFQNAREWCS  1413



>gb|KDO69154.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
Length=1057

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC F+SV I++SPAIM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  909   DPSQPRFVHNESGRFECRFSSVTIEDSPAIMLKGMEGSTLGVWAAHGEGRAYFPDDGVLD  968

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  969   RILHSHLAPVRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1028

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWL+MF  A EW S
Sbjct  1029  PWYPKNWNVDKKGPSPWLKMFQNAREWCS  1057



>ref|XP_008337483.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphoribosylformylglycinamidine 
synthase, chloroplastic/mitochondrial [Malus domestica]
Length=1413

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSVAI++SPAIMFKGMEGS LGVWAA GEGRAYFP+  +L+
Sbjct  1265  DPSQPRFIHNESGRFECRFTSVAIKDSPAIMFKGMEGSTLGVWAAHGEGRAYFPBDGVLD  1324

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1325  RLLHSKLAPVRYCDDDGNETEXYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1384

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYPK WDV KKGP PWLRMF  A EW
Sbjct  1385  PWYPKQWDVEKKGPSPWLRMFQNAREW  1411



>ref|XP_011085040.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Sesamum indicum]
Length=1411

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPA+MFKGMEGS LGVWAA GEGRAYFPD  +LN
Sbjct  1263  DPSQPRFIHNESGRFECRFTSVKIEKSPALMFKGMEGSTLGVWAAHGEGRAYFPDDHVLN  1322

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAPV+   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1323  TILKSDLAPVKYCDDNGNPTEVYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1382

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A EW S
Sbjct  1383  PWYPKNWNVEKKGPSPWLRMFQNAREWCS  1411



>ref|XP_008352301.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Malus domestica]
 ref|XP_008352302.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Malus domestica]
Length=1412

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSVAI++SPAIMFKGMEGS LGVWAA GEGRAYFP+  +L+
Sbjct  1264  DPSQPRFIHNESGRFECRFTSVAIKDSPAIMFKGMEGSTLGVWAAHGEGRAYFPBDGVLD  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1324  RLLHSKLAPVRYCDDDGNETEXYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYPK WDV KKGP PWLRMF  A EW
Sbjct  1384  PWYPKQWDVEKKGPSPWLRMFQNAREW  1410



>ref|XP_002315209.2| phosphoribosylformylglycinamidine synthase family protein [Populus 
trichocarpa]
 gb|EEF01380.2| phosphoribosylformylglycinamidine synthase family protein [Populus 
trichocarpa]
Length=1413

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DP+QPR  HNES RFEC FTSV I++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1265  DPAQPRFVHNESGRFECRFTSVTIEDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1324

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1325  RVIHSNLAPVRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1384

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  W+V KKGP PWL+MF  A EW S
Sbjct  1385  PWYPTQWNVDKKGPSPWLKMFQNAREWCS  1413



>ref|XP_007200335.1| hypothetical protein PRUPE_ppa000243mg [Prunus persica]
 gb|EMJ01534.1| hypothetical protein PRUPE_ppa000243mg [Prunus persica]
Length=1412

 Score =   229 bits (583),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMF+GMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1264  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFRGMEGSTLGVWAAHGEGRAYFPDDGVLD  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1324  RVLHSKLAPVRYCDDDGNETELYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP+ WDV KKGP PWLRMF  A EW S
Sbjct  1384  PWYPQQWDVDKKGPSPWLRMFQNAREWCS  1412



>emb|CDP12696.1| unnamed protein product [Coffea canephora]
Length=914

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            DPSQPR  HNES RFEC FTSV I+ESPA+MFKGMEGS LGVWAA GEGRA+FPD  + N
Sbjct  766  DPSQPRFIHNESRRFECRFTSVRIEESPAMMFKGMEGSTLGVWAAHGEGRAFFPDEGVWN  825

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             V  S LAPVR   D GKPTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  826  SVLNSKLAPVRYCDDDGKPTEVYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  885

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
            PWYPK W V KKGP PWL+MF  A EW S
Sbjct  886  PWYPKHWSVDKKGPSPWLQMFQNAREWCS  914



>ref|XP_008237658.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Prunus mume]
Length=1400

 Score =   228 bits (582),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMF+GMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1252  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFRGMEGSTLGVWAAHGEGRAYFPDDGVLD  1311

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1312  RVLHSKLAPVRYCDDDGNETELYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1371

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP+ WDV KKGP PWLRMF  A EW S
Sbjct  1372  PWYPQQWDVDKKGPSPWLRMFQNAREWCS  1400



>ref|XP_004170044.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphoribosylformylglycinamidine 
synthase, chloroplastic/mitochondrial-like [Cucumis 
sativus]
Length=1413

 Score =   228 bits (582),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMF+GMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1262  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFRGMEGSSLGVWAAHGEGRAYFPDDGVLD  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1322  RLLHSNLAPLRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXSXDL  172
             PWYPK W+V K+GP PWLRMF  A EW S ++
Sbjct  1382  PWYPKQWNVSKEGPSPWLRMFQNAREWCSEEV  1413



>ref|XP_004148187.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like [Cucumis sativus]
Length=1413

 Score =   228 bits (582),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMF+GMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1262  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFRGMEGSSLGVWAAHGEGRAYFPDDGVLD  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1322  RLLHSNLAPLRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXSXDL  172
             PWYPK W+V K+GP PWLRMF  A EW S ++
Sbjct  1382  PWYPKQWNVSKEGPSPWLRMFQNAREWCSEEV  1413



>gb|KJB62495.1| hypothetical protein B456_009G419700 [Gossypium raimondii]
Length=1412

 Score =   228 bits (582),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPA+MFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1264  DPSQPRFVHNESGRFECRFTSVTIKDSPAMMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAP+R   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1324  RVLHSDLAPLRYCDDDGNPTEAYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A EW S
Sbjct  1384  PWYPKDWNVDKKGPSPWLRMFQNAREWCS  1412



>ref|XP_002312111.2| hypothetical protein POPTR_0008s05880g [Populus trichocarpa]
 gb|EEE89478.2| hypothetical protein POPTR_0008s05880g [Populus trichocarpa]
Length=1452

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1304  DPSQPRFVHNESGRFECRFTSVTIEDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1363

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1364  RVIHSNLAPVRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1423

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  W + KKGP PWL+MF  A EW S
Sbjct  1424  PWYPTHWSLDKKGPSPWLKMFQNAREWCS  1452



>gb|KHG19255.1| hypothetical protein F383_23948 [Gossypium arboreum]
Length=1353

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPA+MFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1205  DPSQPRFVHNESGRFECRFTSVTIKDSPAMMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1264

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1265  SVLHSDLAPLRYCDDDGNPTEAYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1324

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A EW S
Sbjct  1325  PWYPKDWNVDKKGPSPWLRMFQNAREWCS  1353



>ref|XP_008454828.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphoribosylformylglycinamidine 
synthase, chloroplastic/mitochondrial [Cucumis 
melo]
Length=1413

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMF+GMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1262  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFRGMEGSTLGVWAAHGEGRAYFPDDGVLD  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1322  RLLHSDLAPLRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXSXD  175
             PWYPK W+V K+GP PWLRMF  A EW S +
Sbjct  1382  PWYPKQWNVSKEGPSPWLRMFQNAREWCSEE  1412



>ref|XP_010027660.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Eucalyptus grandis]
 gb|KCW54226.1| hypothetical protein EUGRSUZ_I00206 [Eucalyptus grandis]
Length=1417

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1263  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1322

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S L P+R   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1323  RVLHSQLVPLRYCDDDGNPTEAYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1382

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYPK WDV KKGP PWLRMF  A  W
Sbjct  1383  PWYPKHWDVEKKGPSPWLRMFQNARAW  1409



>ref|XP_006486399.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X1 [Citrus sinensis]
 ref|XP_006486400.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X2 [Citrus sinensis]
 ref|XP_006486401.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X3 [Citrus sinensis]
Length=1414

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC F+SV I++SPAIM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1266  DPSQPRFVHNESGRFECRFSSVTIEDSPAIMLKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1325

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1326  RILHSHLAPVRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1385

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWL+MF  A EW S
Sbjct  1386  PWYPKNWNVDKKGPSPWLKMFQNAREWCS  1414



>ref|XP_006435635.1| hypothetical protein CICLE_v10030516mg [Citrus clementina]
 gb|ESR48875.1| hypothetical protein CICLE_v10030516mg [Citrus clementina]
Length=1414

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC F+SV I++SPAIM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1266  DPSQPRFVHNESGRFECRFSSVTIEDSPAIMLKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1325

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1326  RILHSHLAPVRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1385

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWL+MF  A EW S
Sbjct  1386  PWYPKNWNVDKKGPSPWLKMFQNAREWCS  1414



>gb|KDO69155.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
 gb|KDO69156.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
 gb|KDO69157.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
 gb|KDO69158.1| hypothetical protein CISIN_1g000572mg [Citrus sinensis]
Length=1414

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC F+SV I++SPAIM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1266  DPSQPRFVHNESGRFECRFSSVTIEDSPAIMLKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1325

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1326  RILHSHLAPVRYCDDDGNPTEVYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1385

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWL+MF  A EW S
Sbjct  1386  PWYPKNWNVDKKGPSPWLKMFQNAREWCS  1414



>ref|XP_007027277.1| Purine biosynthesis 4 [Theobroma cacao]
 gb|EOY07779.1| Purine biosynthesis 4 [Theobroma cacao]
Length=1412

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPA+MFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1264  DPSQPRFVHNESGRFECRFTSVTIKDSPAMMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAP+R   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1324  RVLHSDLAPLRYCDDDGNPTEAYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A EW S
Sbjct  1384  PWYPKDWNVDKKGPSPWLRMFQNAREWCS  1412



>gb|EYU19934.1| hypothetical protein MIMGU_mgv1a000220mg [Erythranthe guttata]
Length=1414

 Score =   226 bits (577),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I+ESPA+MFKGMEGS LGVWAA GEGRAYFPD ++  
Sbjct  1266  DPSQPRFIHNESGRFECRFTSVKIEESPALMFKGMEGSTLGVWAAHGEGRAYFPDDNVGG  1325

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1326  SIMKSKLAPVRYCDDDGNPTEVYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1385

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A EW S
Sbjct  1386  PWYPKDWNVEKKGPSPWLRMFQNAREWCS  1414



>ref|XP_008219161.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Prunus mume]
Length=1410

 Score =   226 bits (577),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMF+GMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1262  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFRGMEGSTLGVWAAHGEGRAYFPDDGVLD  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1322  RMLHSKLAPVRYCDDDGNETELYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A EW S
Sbjct  1382  PWYPKQWNVDKKGPSPWLRMFQNAREWCS  1410



>gb|KDP35259.1| hypothetical protein JCGZ_09418 [Jatropha curcas]
Length=437

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            DPSQPR  HNES RFEC FTSV I +SPAIMFKGMEGS LGVWAA GEGRAYFPD  + +
Sbjct  289  DPSQPRFIHNESGRFECRFTSVRINDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVFD  348

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
            ++  S LAPV    + G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  349  RMIHSNLAPVSYCDNDGNPTEVYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  408

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
            PWYPK W + KKGP PWL+MF  A EW S
Sbjct  409  PWYPKHWYLDKKGPSPWLKMFQNAREWCS  437



>ref|XP_007225512.1| hypothetical protein PRUPE_ppa000246mg [Prunus persica]
 gb|EMJ26711.1| hypothetical protein PRUPE_ppa000246mg [Prunus persica]
Length=1410

 Score =   225 bits (574),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I++SPAIMF+GMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1262  DPSQPRFIHNESGRFECRFTSVTIKDSPAIMFRGMEGSTLGVWAAHGEGRAYFPDDGVLD  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1322  LMLHSKLAPVRYCDDDGNETELYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A EW S
Sbjct  1382  PWYPKQWNVDKKGPSPWLRMFQNAREWCS  1410



>gb|KHN07581.1| Putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Glycine soja]
Length=1425

 Score =   225 bits (574),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SPAIMFKGM GS LG+WAA GEGRAYFPD  +L+
Sbjct  1277  DLSQPRFIHNESGRFECRFTSVTIKDSPAIMFKGMAGSTLGIWAAHGEGRAYFPDEGVLD  1336

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1337  RIVHSELAPIRYCDDAGNPTEAYPFNANGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1396

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1397  PWYPKQWDVEKKGPSPWLRMFQNAREWCS  1425



>ref|XP_002524208.1| Phosphoribosylformylglycinamidine synthase, putative [Ricinus 
communis]
 gb|EEF38132.1| Phosphoribosylformylglycinamidine synthase, putative [Ricinus 
communis]
Length=1414

 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FT+V I++SPAIM KGMEGS LGVWAA GEGRAYFPD  + +
Sbjct  1266  DPSQPRFIHNESGRFECRFTNVTIKDSPAIMLKGMEGSTLGVWAAHGEGRAYFPDDGVFD  1325

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1326  RVVHSDLAPVRYCDDDGNPTETYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1385

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV  KGP PWL+MF  A EW S
Sbjct  1386  PWYPKRWDVDGKGPSPWLKMFQNAREWCS  1414



>ref|XP_009420338.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Musa acuminata subsp. malaccensis]
Length=1421

 Score =   224 bits (571),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I ESPAIMFKGMEGS LGVWAA GEGRAYFPD  ILN
Sbjct  1273  DMSQPRFIHNESGRFECRFTSVTIGESPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGILN  1332

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D G  TE+YPFN NGSPLG  A+CSP+GR    MP PERCF+M QF
Sbjct  1333  NVLKSRLAPLRYCDDDGSITEIYPFNPNGSPLGVAALCSPDGRHLAMMPHPERCFMMWQF  1392

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV K+GP PWLRMF  A EW S
Sbjct  1393  PWYPKEWDVEKRGPSPWLRMFQNAREWCS  1421



>ref|XP_010242666.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nelumbo nucifera]
 ref|XP_010242667.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Nelumbo nucifera]
Length=1412

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I ESPAIM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1264  DPSQPRFIHNESGRFECRFTSVTISESPAIMLKGMEGSTLGVWAAHGEGRAYFPDSVVLD  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +   S LAP+R   D GK TEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1324  RTLQSNLAPLRYCDDDGKITEVYPFNPNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  W+V K+GP PWLRMF  A EW S
Sbjct  1384  PWYPTEWNVDKRGPSPWLRMFQNAREWCS  1412



>gb|AAO23951.1| phosphoribosylformylglycinamidine synthase [Glycine max]
Length=1313

 Score =   223 bits (569),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SPAIMFK M GS LG+WAA GEGRAYFPD  +L+
Sbjct  1165  DLSQPRFIHNESGRFECRFTSVTIKDSPAIMFKDMAGSTLGIWAAHGEGRAYFPDEGVLD  1224

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1225  RIVHSELAPIRYCDDAGNPTEAYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1284

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1285  PWYPKQWDVEKKGPSPWLRMFQNAREWCS  1313



>ref|XP_003538419.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X1 [Glycine max]
 ref|XP_006591348.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like isoform X2 [Glycine max]
 gb|KHN17907.1| Putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Glycine soja]
Length=1410

 Score =   223 bits (569),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SPAIMFK M GS LG+WAA GEGRAYFPD  +L+
Sbjct  1262  DLSQPRFIHNESGRFECRFTSVTIKDSPAIMFKDMAGSTLGIWAAHGEGRAYFPDEGVLD  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1322  RIVHSELAPIRYCDDAGNPTEAYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV KKGP PWLRMF  A EW S
Sbjct  1382  PWYPKQWDVEKKGPSPWLRMFQNAREWCS  1410



>ref|XP_007135941.1| hypothetical protein PHAVU_009G004700g [Phaseolus vulgaris]
 gb|ESW07935.1| hypothetical protein PHAVU_009G004700g [Phaseolus vulgaris]
Length=1409

 Score =   223 bits (568),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HN+S RFEC FTSV I+ SPAIMF GMEGS LG+WAA GEGRAYFPD S+ +
Sbjct  1261  DLSQPRFIHNKSGRFECRFTSVTIKPSPAIMFSGMEGSTLGIWAAHGEGRAYFPDESVFD  1320

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G PTEVYPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1321  RIVHSDLAPVRYSDDSGNPTEVYPFNANGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1380

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV K GP PWLRMF  A EW S
Sbjct  1381  PWYPKHWDVEKNGPSPWLRMFQNAREWCS  1409



>ref|XP_010668487.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Beta vulgaris subsp. vulgaris]
 ref|XP_010668494.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Beta vulgaris subsp. vulgaris]
Length=1412

 Score =   223 bits (568),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC FT V I++SPAIMFKGMEGS LGVWAA GEGRAYFPD  +LN
Sbjct  1264  DTAQPRFIHNESGRFECRFTGVTIEDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDTDVLN  1323

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP++   D GKPTE YPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1324  SVLGSDLAPLKYCDDNGKPTETYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQY  1383

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V KKGP PWLR+F  A EW S
Sbjct  1384  PWYPKNWGVDKKGPSPWLRLFQNAREWCS  1412



>ref|XP_004301174.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Fragaria vesca subsp. vesca]
Length=1412

 Score =   221 bits (564),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I +SP+IM  GMEGS LGVWAA GEGRAYFPD  + +
Sbjct  1260  DPSQPRFIHNESGRFECRFTSVKITDSPSIMLNGMEGSTLGVWAAHGEGRAYFPDDGVFD  1319

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G  TE+YPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1320  RVLHSKLAPVRYCDDDGIETELYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQY  1379

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXSXD  175
             PWYPK WDV KKGP PWLRMF  A EW S +
Sbjct  1380  PWYPKQWDVEKKGPSPWLRMFQNAREWCSKN  1410



>gb|KDP44919.1| hypothetical protein JCGZ_01419 [Jatropha curcas]
Length=1413

 Score =   221 bits (562),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I +SPAIMFKGMEGS LGVWAA GEGRAYFPD  + +
Sbjct  1265  DPSQPRFIHNESGRFECRFTSVRINDSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDGVFD  1324

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPV    D G PTEVYPFN NGSPLG  A+CS +GR    MP PERCFLM QF
Sbjct  1325  RMIHSNLAPVSYCDDDGNPTEVYPFNLNGSPLGVAAVCSADGRHLAMMPHPERCFLMWQF  1384

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W++ KKGP PWL+MF  A EW S
Sbjct  1385  PWYPKHWNLDKKGPSPWLKMFQNAREWCS  1413



>ref|NP_001130959.1| uncharacterized protein LOC100192064 [Zea mays]
 gb|ACF79363.1| unknown [Zea mays]
Length=254

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            D SQPR  HNES RFEC FTSV+I +SPAIMFKGMEGS LGVW+A GEGRA+FPD ++L 
Sbjct  106  DMSQPRFIHNESGRFECRFTSVSIGDSPAIMFKGMEGSTLGVWSAHGEGRAFFPDENVLA  165

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             V  S LAPVR   D    TE YPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  166  TVVKSNLAPVRYCDDSNNITETYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  225

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
            PWYPK W V K GP PWLRMF  A EW S
Sbjct  226  PWYPKEWQVEKSGPSPWLRMFQNAREWCS  254



>gb|KEH21294.1| phosphoribosylformylglycinamidine synthase [Medicago truncatula]
Length=1410

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FT+V I++SPA+MFKGM GS +G+W A GEGRAYFPD  +L 
Sbjct  1262  DLSQPRFIHNESGRFECRFTNVTIKDSPAMMFKGMAGSTMGIWTAHGEGRAYFPDEGVLE  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1322  RVVHSDLAPVRYCDDAGNPTETYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A +W S
Sbjct  1382  PWYPKLWNVDKKGPSPWLRMFQNARDWCS  1410



>gb|KEH24969.1| phosphoribosylformylglycinamidine synthase [Medicago truncatula]
Length=1410

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FT+V I++SPA+MFKGM GS +G+W A GEGRAYFPD  +L 
Sbjct  1262  DLSQPRFIHNESGRFECRFTNVTIKDSPAMMFKGMAGSTMGIWTAHGEGRAYFPDEGVLE  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1322  RVVHSDLAPVRYCDDAGNPTETYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A +W S
Sbjct  1382  PWYPKLWNVDKKGPSPWLRMFQNARDWCS  1410



>ref|XP_004503568.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like [Cicer arietinum]
Length=1407

 Score =   217 bits (553),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HN+S RFEC FT+V I++SPAIMFKGM GS +G+W A GEGRAYFPD  +L+
Sbjct  1259  DLSQPRFIHNKSGRFECRFTNVTIKDSPAIMFKGMAGSTMGIWTAHGEGRAYFPDEGVLD  1318

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1319  RVVHSDLAPVRYCDDTGNPTETYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1378

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWL+MF  A +W S
Sbjct  1379  PWYPKLWNVDKKGPSPWLKMFQNARDWCS  1407



>ref|XP_010543774.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Tarenaya hassleriana]
Length=1414

 Score =   217 bits (552),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SPAIM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1263  DTSQPRFIHNESGRFECRFTSVTIKDSPAIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1322

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G  TE YPFN NGSP+G  AICSP+GR    MP PERCFLM QF
Sbjct  1323  RMLHSDLAPLRYCDDDGHITEAYPFNLNGSPMGIAAICSPDGRHLAMMPHPERCFLMWQF  1382

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V K GP PWL+MF  A EW S
Sbjct  1383  PWYPKQWNVDKAGPSPWLKMFQNAREWCS  1411



>ref|XP_008788295.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Phoenix dactylifera]
 ref|XP_008788296.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Phoenix dactylifera]
Length=1417

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I +SPAIMFKGME + LGVWAA GEGRAYFPD  IL+
Sbjct  1269  DVSQPRFIHNESGRFECRFTSVKIGDSPAIMFKGMEDTTLGVWAAHGEGRAYFPDNGILD  1328

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAP+R   D G  TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M QF
Sbjct  1329  RVLKSNLAPLRYCNDSGSITEVYPFNPNGSPLGVAALCSPDGRHLAMMPHPERCFMMWQF  1388

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWL+MF  A EW S
Sbjct  1389  PWYPKEWEVDKKGPSPWLQMFQNAREWCS  1417



>ref|XP_010908309.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Elaeis guineensis]
Length=1420

 Score =   216 bits (550),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I +SPAIMFKGMEG+ LGVWAA GEGRAYFPD  +L 
Sbjct  1272  DVSQPRFIHNESGRFECRFTSVRIGDSPAIMFKGMEGTTLGVWAAHGEGRAYFPDNGVLE  1331

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D G  TEVYPFN NGSPLG  A+CSP+GR    MP PERCF++ QF
Sbjct  1332  CVLKSNLAPLRYCNDAGSITEVYPFNPNGSPLGVAALCSPDGRHLAMMPHPERCFMIWQF  1391

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V KKGP PWLRMF  A EW S
Sbjct  1392  PWYPKEWEVDKKGPSPWLRMFQNAREWCS  1420



>ref|XP_010428408.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Camelina sativa]
Length=1407

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1257  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1316

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1317  HMLHSDLAPLRYCDDDGNMTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQF  1376

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  WDV K GP PWL+MF  A +W S
Sbjct  1377  PWYPTSWDVEKAGPSPWLKMFQNARDWCS  1405



>ref|XP_010471513.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Camelina sativa]
Length=1407

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1257  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1316

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1317  HMLHSDLAPLRYCDDDGNMTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQF  1376

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  WDV K GP PWL+MF  A +W S
Sbjct  1377  PWYPTSWDVEKAGPSPWLKMFQNARDWCS  1405



>ref|XP_010416277.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Camelina sativa]
Length=1407

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1257  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1316

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1317  HMLHSDLAPLRYCDDDGNMTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQF  1376

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  WDV K GP PWL+MF  A +W S
Sbjct  1377  PWYPTSWDVEKAGPSPWLKMFQNARDWCS  1405



>ref|XP_006390444.1| hypothetical protein EUTSA_v10018011mg [Eutrema salsugineum]
 gb|ESQ27730.1| hypothetical protein EUTSA_v10018011mg [Eutrema salsugineum]
Length=1407

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1257  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1316

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1317  HMLHSDLAPLRYCDDDGSVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQF  1376

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  WDV K GP PWL+MF  A +W S
Sbjct  1377  PWYPTSWDVEKAGPSPWLKMFQNARDWCS  1405



>ref|XP_006300588.1| hypothetical protein CARUB_v10019663mg [Capsella rubella]
 gb|EOA33486.1| hypothetical protein CARUB_v10019663mg [Capsella rubella]
Length=1407

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1257  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1316

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1317  HMLHSDLAPLRYCDDDGNMTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQF  1376

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  WDV K GP PWL+MF  A +W S
Sbjct  1377  PWYPTSWDVEKAGPSPWLKMFQNARDWCS  1405



>ref|NP_177566.3| phosphoribosylformylglycinamidine synthase [Arabidopsis thaliana]
 sp|Q9M8D3.3|PUR4_ARATH RecName: Full=Probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial; Short=FGAM synthase; Short=FGAMS; 
AltName: Full=Formylglycinamide ribonucleotide amidotransferase; 
Short=FGAR amidotransferase; Short=FGAR-AT; AltName: 
Full=Formylglycinamide ribotide amidotransferase; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE35571.1| phosphoribosylformylglycinamidine synthase [Arabidopsis thaliana]
Length=1407

 Score =   215 bits (547),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1257  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1316

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1317  HMLHSDLAPLRYCDDDGNVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQF  1376

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP  WDV K GP PWL+MF  A +W
Sbjct  1377  PWYPTSWDVEKAGPSPWLKMFQNARDW  1403



>gb|ABW87767.1| phosphoribosylformylglycinamidine synthase [Arabidopsis thaliana]
Length=1387

 Score =   215 bits (547),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1237  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1296

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1297  HMLHSDLAPLRYCDDDGNVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQF  1356

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP  WDV K GP PWL+MF  A +W
Sbjct  1357  PWYPTSWDVEKAGPSPWLKMFQNARDW  1383



>gb|AAG52403.1|AC020579_5 putative phosphoribosylformylglycinamidine synthase; 25509-29950 
[Arabidopsis thaliana]
Length=1387

 Score =   214 bits (546),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1237  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1296

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1297  HMLHSDLAPLRYCDDDGNVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQF  1356

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP  WDV K GP PWL+MF  A +W
Sbjct  1357  PWYPTSWDVEKAGPSPWLKMFQNARDW  1383



>tpg|DAA35603.1| TPA: hypothetical protein ZEAMMB73_742845 [Zea mays]
Length=521

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            D +QPR  HNES RFEC FTSV+I  SPAIMFKGMEGS LGVW+A GEGRA+FPD ++L 
Sbjct  373  DITQPRFIHNESGRFECRFTSVSIGVSPAIMFKGMEGSTLGVWSAHGEGRAFFPDENVLA  432

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             V  S LAPVR   D    TE YPFN NGSPLG  A+CSP+GR    MP PERCF+M QF
Sbjct  433  TVVKSNLAPVRYCDDFNNITETYPFNPNGSPLGIGALCSPDGRHLAMMPHPERCFMMWQF  492

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
            PWYPK W V K GP PWLRMF  A EW S
Sbjct  493  PWYPKEWQVEKSGPSPWLRMFQNAREWCS  521



>ref|XP_008671054.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial, partial [Zea mays]
Length=534

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            D +QPR  HNES RFEC FTSV+I  SPAIMFKGMEGS LGVW+A GEGRA+FPD ++L 
Sbjct  386  DITQPRFIHNESGRFECRFTSVSIGVSPAIMFKGMEGSTLGVWSAHGEGRAFFPDENVLA  445

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             V  S LAPVR   D    TE YPFN NGSPLG  A+CSP+GR    MP PERCF+M QF
Sbjct  446  TVVKSNLAPVRYCDDFNNITETYPFNPNGSPLGIGALCSPDGRHLAMMPHPERCFMMWQF  505

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
            PWYPK W V K GP PWLRMF  A EW S
Sbjct  506  PWYPKEWQVEKSGPSPWLRMFQNAREWCS  534



>ref|XP_002888969.1| hypothetical protein ARALYDRAFT_476563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65228.1| hypothetical protein ARALYDRAFT_476563 [Arabidopsis lyrata subsp. 
lyrata]
Length=1410

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1260  DTSQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1319

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERC+LM QF
Sbjct  1320  HMLHSDLAPLRYCDDDGNVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCYLMWQF  1379

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP  WDV K GP PWL+MF  A +W
Sbjct  1380  PWYPTSWDVEKAGPSPWLKMFQNARDW  1406



>ref|XP_007163437.1| hypothetical protein PHAVU_001G234500g [Phaseolus vulgaris]
 gb|ESW35431.1| hypothetical protein PHAVU_001G234500g [Phaseolus vulgaris]
Length=1402

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HN S RFEC FTSV I  SPA+MF+GMEGS +G+WAA GEGRAYFPD  + +
Sbjct  1254  DLSQPRFIHNASGRFECRFTSVTILPSPAMMFRGMEGSTMGIWAAHGEGRAYFPDEGVFD  1313

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1314  RIVHSELAPVRYCDDAGNPTEAYPFNVNGSPLGAAAICSPDGRHLAMMPHPERCFLMWQF  1373

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1374  PWYPKHWHVEKNGPSPWLRMFQNAREWCS  1402



>emb|CDX68192.1| BnaA07g22320D [Brassica napus]
Length=1384

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1234  DTAQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1293

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1294  RMLHSDLAPLRYCDDDGSVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQY  1353

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V K GP PWL+MF  A +W S
Sbjct  1354  PWYPKSWEVEKAGPSPWLKMFQNARDWCS  1382



>emb|CDX85818.1| BnaC06g23160D [Brassica napus]
Length=1382

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1232  DTAQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1291

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1292  RMLHSDLAPLRYCDDDGSVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQY  1351

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V K GP PWL+MF  A +W S
Sbjct  1352  PWYPKSWEVEKAGPSPWLKMFQNARDWCS  1380



>gb|AAL55431.1| formylglycinamide ribonucleotide amidotransferase [Vigna unguiculata]
Length=1289

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HN S RFEC FTSV I  SPA+MFKGM GS +G+WAA GEG+AYFPD  + +
Sbjct  1141  DLSQPRFIHNASGRFECRFTSVTILPSPALMFKGMAGSTMGIWAAHGEGKAYFPDEGVFD  1200

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAPVR   D G PTE YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  1201  RIVHSELAPVRYCDDAGNPTESYPFNVNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  1260

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK WDV K GP PWLRMF  A EW S
Sbjct  1261  PWYPKHWDVEKNGPSPWLRMFQNAREWCS  1289



>gb|KFK41873.1| hypothetical protein AALP_AA2G182400 [Arabis alpina]
Length=1402

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FT V I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1252  DTSQPRFVHNESGRFECRFTGVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1311

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              +  S LAPVR   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCF+M Q+
Sbjct  1312  HMLHSDLAPVRYCDDDGSVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFMMWQY  1371

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYP  WDV K GP PWL+MF  A +W S
Sbjct  1372  PWYPTSWDVEKAGPSPWLKMFQNARDWCS  1400



>ref|XP_009104771.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphoribosylformylglycinamidine 
synthase, chloroplastic/mitochondrial [Brassica 
rapa]
Length=1404

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1254  DTAQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1313

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1314  RMLHSDLAPLRYCDDDGSVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQY  1373

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V K GP PWL+MF  A +W S
Sbjct  1374  PWYPKSWEVEKAGPSPWLKMFQNARDWCS  1402



>emb|CDX96528.1| BnaA07g31390D [Brassica napus]
Length=1379

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1229  DTAQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1288

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1289  RMLHSDLAPLRYCDDDGSVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQY  1348

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V K GP PWL+MF  A +W S
Sbjct  1349  PWYPKGWEVEKAGPSPWLKMFQNARDWCS  1377



>ref|XP_009106086.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Brassica rapa]
Length=1398

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC FTSV I++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1248  DTAQPRFVHNESGRFECRFTSVTIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLD  1307

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM Q+
Sbjct  1308  RMLHSDLAPLRYCDDDGSVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQY  1367

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W+V K GP PWL+MF  A +W S
Sbjct  1368  PWYPKGWEVEKAGPSPWLKMFQNARDWCS  1396



>ref|XP_010912732.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Elaeis guineensis]
Length=1413

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FT V I  SPAIMFKGMEGS LGVWAA GEGRAYFPD  + +
Sbjct  1265  DISQPRFIHNESGRFECRFTGVTIGNSPAIMFKGMEGSTLGVWAAHGEGRAYFPDDDVYD  1324

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAP+R   D G  TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M QF
Sbjct  1325  RVLKSNLAPLRYCDDAGMETEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQF  1384

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP  W++ KKGP PWL+MF  A EW
Sbjct  1385  PWYPMEWEIDKKGPSPWLKMFQNAREW  1411



>ref|XP_008675958.1| PREDICTED: uncharacterized protein LOC100192064 isoform X1 [Zea 
mays]
 tpg|DAA51023.1| TPA: hypothetical protein ZEAMMB73_043594 [Zea mays]
Length=1418

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV+I +SPAIMFKGMEGS LGVW+A GEGRA+FPD ++L 
Sbjct  1270  DMSQPRFIHNESGRFECRFTSVSIGDSPAIMFKGMEGSTLGVWSAHGEGRAFFPDENVLA  1329

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAPVR   D    TE YPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  1330  TVVKSNLAPVRYCDDSNNITETYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  1389

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1390  PWYPKEWQVEKSGPSPWLRMFQNAREWCS  1418



>ref|NP_001045039.1| Os01g0888500 [Oryza sativa Japonica Group]
 dbj|BAF06953.1| Os01g0888500, partial [Oryza sativa Japonica Group]
Length=793

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            D SQPR  HNES RFEC FTSV+I  SPAIMFKGMEGS LG+W+A GEGRA+FPD ++L 
Sbjct  645  DMSQPRFIHNESGRFECRFTSVSIGTSPAIMFKGMEGSTLGIWSAHGEGRAFFPDENVLA  704

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             V  S LAPVR   D    TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  705  SVVNSNLAPVRYCDDANNITEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  764

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
            PWYPK W + K GP PWLRMF  A EW
Sbjct  765  PWYPKEWQLEKCGPSPWLRMFQNAREW  791



>ref|XP_008781955.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Phoenix dactylifera]
Length=1413

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FT V I  SPAIMFKGMEGS LGVW A GEGRAYFPD  + +
Sbjct  1265  DISQPRFIHNESGRFECRFTGVTIGNSPAIMFKGMEGSTLGVWVAHGEGRAYFPDDDVYD  1324

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAP+R   D G  TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M QF
Sbjct  1325  RVLKSSLAPLRYCDDAGMETEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQF  1384

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP  W+V KKGP PWL+MF  A EW
Sbjct  1385  PWYPMEWEVDKKGPSPWLKMFQNAREW  1411



>gb|EMT12667.1| Putative phosphoribosylformylglycinamidine synthase, chloroplastic 
[Aegilops tauschii]
Length=1421

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC FTSVAI ESPAIMFKGMEGS LG+WAA GEGRA FPD ++L+
Sbjct  1273  DMAQPRFIHNESGRFECRFTSVAIGESPAIMFKGMEGSTLGIWAAHGEGRALFPDKNVLS  1332

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D    TEVYPFN NGSPLG  A+CSPNGR    MP PER F+M Q+
Sbjct  1333  GVVNSNLAPLRYCDDANTATEVYPFNPNGSPLGIAALCSPNGRHLAMMPHPERSFMMWQY  1392

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1393  PWYPKEWQVEKGGPSPWLRMFQNAREWCS  1421



>ref|XP_002463993.1| hypothetical protein SORBIDRAFT_01g010140 [Sorghum bicolor]
 gb|EER90991.1| hypothetical protein SORBIDRAFT_01g010140 [Sorghum bicolor]
Length=1310

 Score =   209 bits (531),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV+I +SPAIMFKGMEGS LGVW+A GEGRA+FPD ++L 
Sbjct  1162  DMSQPRFIHNESGRFECRFTSVSIGDSPAIMFKGMEGSTLGVWSAHGEGRAFFPDENVLA  1221

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S L PVR   D    TE YPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  1222  TVVKSNLVPVRYCDDSNNITETYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  1281

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1282  PWYPKEWQVEKSGPSPWLRMFQNAREWCS  1310



>gb|EMS66042.1| putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Triticum urartu]
Length=1354

 Score =   209 bits (531),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR THNES RFEC F SVAI +SP+IMFKGMEGS LG+W+A GEGRA+FPD ++L+
Sbjct  1206  DMSQPRFTHNESGRFECRFISVAIGDSPSIMFKGMEGSTLGIWSAHGEGRAFFPDENVLS  1265

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D    TEVYPFN NGSPLG  A+CSPNGR    MP PER F+M Q+
Sbjct  1266  DVVNSNLAPLRYCDDANNVTEVYPFNPNGSPLGIAALCSPNGRHLALMPHPERSFMMWQY  1325

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1326  PWYPKEWQVEKGGPSPWLRMFQNAREWCS  1354



>gb|EMT12449.1| Putative phosphoribosylformylglycinamidine synthase, chloroplastic 
[Aegilops tauschii]
Length=1661

 Score =   209 bits (531),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR THNES RFEC F SVAI +SP+IMFKGMEGS LG+W+A GEGRA+FPD ++L+
Sbjct  1513  DMSQPRFTHNESGRFECRFISVAIGDSPSIMFKGMEGSTLGIWSAHGEGRAFFPDENVLS  1572

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D    TEVYPFN NGSPLG  A+CSPNGR    MP PER F+M Q+
Sbjct  1573  DVVNSNLAPLRYCDDANNVTEVYPFNPNGSPLGIAALCSPNGRHLALMPHPERSFMMWQY  1632

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1633  PWYPKEWQVEKGGPSPWLRMFQNAREWCS  1661



>ref|XP_004981981.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like [Setaria italica]
Length=1418

 Score =   208 bits (530),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV+I  SPAIMFKGMEGS LGVW+A GEGRA+FPD ++L 
Sbjct  1270  DMSQPRFIHNESGRFECRFTSVSIGNSPAIMFKGMEGSTLGVWSAHGEGRAFFPDENVLA  1329

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAPVR   D    TE YPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  1330  TVVQSNLAPVRYCDDANNITETYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  1389

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V + GP PWLRMF  A EW S
Sbjct  1390  PWYPKEWQVEESGPSPWLRMFQNAREWCS  1418



>ref|XP_004982886.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like [Setaria italica]
Length=1418

 Score =   208 bits (530),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSVAI +SPAIMFKGMEGS LG+W+A GEGRA+FPD +IL+
Sbjct  1270  DISQPRFIHNESGRFECRFTSVAIGDSPAIMFKGMEGSTLGIWSAHGEGRAFFPDENILS  1329

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D    TEVYPFN NGSPLG  A+CSP+GR    MP PER F+M Q+
Sbjct  1330  GVVKSNLAPLRYCDDYNNVTEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERSFMMWQY  1389

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1390  PWYPKDWQVEKSGPSPWLRMFQNAREWCS  1418



>gb|EAY76767.1| hypothetical protein OsI_04723 [Oryza sativa Indica Group]
Length=1419

 Score =   208 bits (529),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV+I  SPAIMFKGMEGS LG+W+A GEGRA+FPD ++L 
Sbjct  1271  DMSQPRFIHNESGRFECRFTSVSIGTSPAIMFKGMEGSTLGIWSAHGEGRAFFPDENVLA  1330

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAPVR   D    TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  1331  SVVNSNLAPVRYCDDANNITEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  1390

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W + K GP PWLRMF  A EW S
Sbjct  1391  PWYPKEWQLEKCGPSPWLRMFQNAREWCS  1419



>gb|EMS48506.1| putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Triticum urartu]
Length=1442

 Score =   208 bits (529),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR THNES RFEC F SVAI  SP+IMFKGMEGS LG+W+A GEGRA+FPD ++L+
Sbjct  1294  DMSQPRFTHNESGRFECRFISVAIGVSPSIMFKGMEGSTLGIWSAHGEGRAFFPDENVLS  1353

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D    TEVYPFN NGSPLG  A+CSPNGR    MP PER F+M Q+
Sbjct  1354  DVVKSNLAPLRYCDDANNVTEVYPFNPNGSPLGIAALCSPNGRHLALMPHPERSFMMWQY  1413

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1414  PWYPKEWQVEKSGPSPWLRMFQNAREWCS  1442



>ref|XP_006645145.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial-like [Oryza brachyantha]
Length=1419

 Score =   208 bits (529),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV+I  SPAIMFKGMEGS LG+W+A GEGR +FPD ++L 
Sbjct  1271  DMSQPRFIHNESGRFECRFTSVSIGASPAIMFKGMEGSTLGIWSAHGEGRTFFPDENVLA  1330

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAPVR   D    TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  1331  SVVKSNLAPVRYCDDANNITEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  1390

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W + K GP PWLRMF  A EW S
Sbjct  1391  PWYPKEWQLEKSGPSPWLRMFQNAREWCS  1419



>gb|EMT04637.1| Putative phosphoribosylformylglycinamidine synthase, chloroplastic 
[Aegilops tauschii]
Length=1354

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR THNES RFEC F SVAI +SP+IMFKGMEGS LG+W+A GEGRA+FPD ++L+
Sbjct  1206  DMSQPRFTHNESGRFECRFISVAIGDSPSIMFKGMEGSTLGIWSAHGEGRAFFPDENVLS  1265

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V    LAP+R   D    TEVYPFN NGSPLG  A+CSPNGR    MP PER F+M Q+
Sbjct  1266  DVVKYNLAPLRYCDDANNVTEVYPFNPNGSPLGIAALCSPNGRHLALMPHPERSFMMWQY  1325

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1326  PWYPKEWQVEKSGPSPWLRMFQNAREWCS  1354



>dbj|BAD82369.1| putative formylglycineamide ribotide amidotransferase [Oryza 
sativa Japonica Group]
 dbj|BAD82143.1| putative formylglycineamide ribotide amidotransferase [Oryza 
sativa Japonica Group]
 gb|EAZ14425.1| hypothetical protein OsJ_04346 [Oryza sativa Japonica Group]
Length=1419

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV+I  SPAIMFKGMEGS LG+W+A GEGRA+FPD ++L 
Sbjct  1271  DMSQPRFIHNESGRFECRFTSVSIGTSPAIMFKGMEGSTLGIWSAHGEGRAFFPDENVLA  1330

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAPVR   D    TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  1331  SVVNSNLAPVRYCDDANNITEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  1390

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYPK W + K GP PWLRMF  A EW
Sbjct  1391  PWYPKEWQLEKCGPSPWLRMFQNAREW  1417



>gb|EMS53942.1| putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Triticum urartu]
Length=1510

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC FTSVAI ESPAIMF+GMEGS LG+W A GEGRA FPD ++L+
Sbjct  1362  DMAQPRFIHNESGRFECRFTSVAIGESPAIMFRGMEGSTLGIWTAHGEGRALFPDKNVLS  1421

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D    TEVYPFN NGSPLG  A+CSPNGR    MP PER F+M Q+
Sbjct  1422  GVVNSNLAPLRYCDDTNNATEVYPFNPNGSPLGIAALCSPNGRHLAMMPHPERSFMMWQY  1481

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V K GP PWLRMF  A EW S
Sbjct  1482  PWYPKEWQVEKGGPSPWLRMFQNAREWCS  1510



>gb|ADE77010.1| unknown [Picea sitchensis]
Length=410

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            D SQPR  HNES RFEC F+SV I ESP+IM +GMEG+ +G+W A GEGRA+FP   IL 
Sbjct  260  DNSQPRFIHNESGRFECRFSSVRIVESPSIMLRGMEGTTVGIWVAHGEGRAFFPRQEILQ  319

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             V  S LAP+R   D G  TE YPFN NGSPLG  AICSPNGR    MP PERCFLM QF
Sbjct  320  HVTESNLAPIRYCDDDGYVTEEYPFNPNGSPLGIAAICSPNGRHLALMPHPERCFLMWQF  379

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
            PWYP+ W++  KGP PWL+MF    EW
Sbjct  380  PWYPREWELDPKGPSPWLKMFQNVREW  406



>ref|XP_010240021.1| PREDICTED: probable phosphoribosylformylglycinamidine synthase, 
chloroplastic/mitochondrial [Brachypodium distachyon]
Length=1415

 Score =   206 bits (524),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSVAI +SP+IMF+GMEGS LG+WAA GEGRA FPD ++L+
Sbjct  1267  DISQPRFIHNESGRFECRFTSVAIGDSPSIMFRGMEGSTLGIWAAHGEGRALFPDENVLS  1326

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAP+R   D    TEVYPFN NGSPLG  A+CSPNGR    MP PER F+M Q+
Sbjct  1327  GVINSNLAPLRYCDDANNATEVYPFNPNGSPLGIAALCSPNGRHLAMMPHPERTFMMWQY  1386

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PWYPK W V + GP PWLRMF  A EW S
Sbjct  1387  PWYPKEWQVERGGPSPWLRMFQNAREWCS  1415



>gb|EEE62020.1| hypothetical protein OsJ_16802 [Oryza sativa Japonica Group]
Length=1415

 Score =   205 bits (522),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV+I  SPAIMFKGMEGS +G+W+A GEGRA+FPD ++L 
Sbjct  1267  DMSQPRFIHNESGRFECRFTSVSIGASPAIMFKGMEGSTMGIWSAHGEGRAFFPDENVLA  1326

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAPVR   D    TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  1327  SVVKSNLAPVRYCDDANNITEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  1386

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
             PW PK W + K GP PWLRMF  A EW S
Sbjct  1387  PWSPKDWQLEKSGPSPWLRMFQNAREWCS  1415



>ref|XP_006845743.1| hypothetical protein AMTR_s00019p00246290 [Amborella trichopoda]
 gb|ERN07418.1| hypothetical protein AMTR_s00019p00246290 [Amborella trichopoda]
Length=1412

 Score =   202 bits (515),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 106/147 (72%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D +QPR  HNES RFEC F SV I +SP++M +GM+GS LGVW+A GEGRA+FP   +L 
Sbjct  1262  DVTQPRFIHNESGRFECRFASVTIHDSPSVMLQGMQGSTLGVWSAHGEGRAFFPSDGVLE  1321

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D GK TEVYP N NGSPLG  A+CSP+GR    MP PERCFLM QF
Sbjct  1322  RVLGSGLAPVRYCDDDGKVTEVYPHNPNGSPLGIAALCSPDGRHLAMMPHPERCFLMWQF  1381

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYPK W   +KGP PWLRMF  A EW
Sbjct  1382  PWYPKDWGFDRKGPSPWLRMFQNAREW  1408



>ref|XP_002448676.1| hypothetical protein SORBIDRAFT_06g031310 [Sorghum bicolor]
 gb|EES13004.1| hypothetical protein SORBIDRAFT_06g031310 [Sorghum bicolor]
Length=1331

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = -1

Query  615   PRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPX  436
             P   HNES RFEC FTSV+I +SPAIMFKGMEGS LGVW+A GEGRA+FPD ++L+ V  
Sbjct  1187  PGFIHNESGRFECRFTSVSIGDSPAIMFKGMEGSTLGVWSAHGEGRAFFPDENVLSTVVK  1246

Query  435   SXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYP  256
             S LAPVR   D    TE YPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+PWYP
Sbjct  1247  SNLAPVRYCDDFNNITETYPFNPNGSPLGIGALCSPDGRHLAMMPHPERCFMMWQYPWYP  1306

Query  255   KXWDVXKKGPXPWLRMFXXAXEWXS  181
             K W V K GP PWLRMF  A EW S
Sbjct  1307  KEWQVEKSGPSPWLRMFQNAREWCS  1331



>gb|KHG14750.1| hypothetical protein F383_18060 [Gossypium arboreum]
Length=1108

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            DPSQPR  HNES RFEC FTSV I++SPA+MFKGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  779  DPSQPRFVHNESGRFECRFTSVTIKDSPAMMFKGMEGSTLGVWAAHGEGRAYFPDDGVLD  838

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
            +V    LAP+R   D G PT  YPFN NGSPLG  AICSP+GR    MP PERCFLM QF
Sbjct  839  RVLHLDLAPLRYCDDDGNPTVAYPFNLNGSPLGVAAICSPDGRHLAMMPHPERCFLMWQF  898

Query  267  PWYPKXWDVXKKGP  226
            PWYPK W V KKGP
Sbjct  899  PWYPKDWKVDKKGP  912



>gb|EAY96218.1| hypothetical protein OsI_18107 [Oryza sativa Indica Group]
Length=1842

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC FTSV+I  SPAIMFKGMEGS +G+W+A GEGRA+FPD ++L 
Sbjct  1218  DMSQPRFIHNESGRFECRFTSVSIGASPAIMFKGMEGSTMGIWSAHGEGRAFFPDENVLA  1277

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V  S LAPVR   D    TEVYPFN NGSPLG  A+CSP+GR    MP PERCF+M Q+
Sbjct  1278  SVVKSNLAPVRYCDDANNITEVYPFNPNGSPLGIAALCSPDGRHLAMMPHPERCFMMWQY  1337

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXE  190
             PW PK W + K GP PWLRMF  A E
Sbjct  1338  PWSPKDWQLEKSGPSPWLRMFQNARE  1363



>ref|XP_010099731.1| putative phosphoribosylformylglycinamidine synthase [Morus notabilis]
 gb|EXB80308.1| putative phosphoribosylformylglycinamidine synthase [Morus notabilis]
Length=1413

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 100/139 (72%), Gaps = 0/139 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DP+QPR  HNES RFEC FT V I++SPAIM KGMEGS LGVWAA GEGRAYFPD S+ +
Sbjct  1256  DPAQPRFIHNESGRFECRFTGVTIKDSPAIMLKGMEGSTLGVWAAHGEGRAYFPDHSVFD  1315

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAPVR   D G  TE YPFN NGSPLG  AICS +GR    MP PERCFLM QF
Sbjct  1316  RVLHSNLAPVRYCNDDGNETEQYPFNVNGSPLGVAAICSSDGRHLAMMPHPERCFLMWQF  1375

Query  267   PWYPKXWDVXKKGPXPWLR  211
             PWYPK W+  KKG     R
Sbjct  1376  PWYPKQWNEDKKGAEGLKR  1394



>ref|XP_002981506.1| hypothetical protein SELMODRAFT_114727 [Selaginella moellendorffii]
 gb|EFJ17321.1| hypothetical protein SELMODRAFT_114727 [Selaginella moellendorffii]
Length=1319

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC F SV I++SPAIM KGMEG+ +G+W A GEGRA+FP   IL 
Sbjct  1170  DKSQPRFVHNESGRFECRFASVTIEQSPAIMLKGMEGTTVGIWVANGEGRAFFPQPEILT  1229

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAP+R   D G+ TE YPFN NGSP G  A+CSP+GR    MP PERCF+M QF
Sbjct  1230  EVLDSNLAPLRYCDDAGEVTEQYPFNPNGSPRGVAALCSPDGRHLAMMPHPERCFMMWQF  1289

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP+ W +   GP PWL++F  A  W
Sbjct  1290  PWYPREWQIDPAGPSPWLKLFENARNW  1316



>gb|EPS62326.1| hypothetical protein M569_12463, partial [Genlisea aurea]
Length=1337

 Score =   192 bits (487),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 99/147 (67%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             + +QPR  HNES RFEC F SV I+ SPA+M  GMEGS LGVW A GEGRAYFPDG +  
Sbjct  1188  EKNQPRFVHNESGRFECRFASVRIERSPAVMLAGMEGSTLGVWVAHGEGRAYFPDGDVFA  1247

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
                 S L  V+   D G PTE YPFN NGSP G  A+CS +GR    MP PERCF+  Q+
Sbjct  1248  AAAESNLIAVKYCDDGGVPTEAYPFNPNGSPAGTAALCSADGRHLAMMPHPERCFMTWQY  1307

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP+ W+V K GP PWLRMF  A EW
Sbjct  1308  PWYPREWEVDKVGPSPWLRMFQNAAEW  1334



>ref|XP_002963575.1| hypothetical protein SELMODRAFT_165866 [Selaginella moellendorffii]
 gb|EFJ35446.1| hypothetical protein SELMODRAFT_165866 [Selaginella moellendorffii]
Length=1319

 Score =   191 bits (486),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQPR  HNES RFEC F SV I++SP+IM KGMEG+ +G+W A GEGRA+FP   IL 
Sbjct  1170  DKSQPRFVHNESGRFECRFASVTIEQSPSIMLKGMEGTTVGIWVANGEGRAFFPQPEILT  1229

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAP+R   D G+ TE YPFN NGSP G  A+CSP+GR    MP PERCF+M QF
Sbjct  1230  EVLDSNLAPLRYCDDAGEVTEQYPFNPNGSPRGVAALCSPDGRHLAMMPHPERCFMMWQF  1289

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYP+ W +   GP PWL++F  A  W
Sbjct  1290  PWYPREWQIDPAGPSPWLKLFENAHNW  1316



>ref|XP_003601752.1| Phosphoribosylformylglycinamidine synthase [Medicago truncatula]
Length=766

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 100/149 (67%), Gaps = 14/149 (9%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            D SQPR  HNES RFEC FT+V I++SPAIMFKGM GS +G+W A GEGRAYF D  +L 
Sbjct  454  DLSQPRFIHNESGRFECRFTNVTIKDSPAIMFKGMTGSTMGIWTAHGEGRAYFQDEDVLQ  513

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
            +V  S LAP+R   D G PTE YPFN NGSPLG  AICSP+GR                F
Sbjct  514  RVVHSELAPIRYCDDAGNPTETYPFNVNGSPLGIAAICSPDGRHL--------------F  559

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
            PW+PK W++ KKGP PWLRMF  A +W S
Sbjct  560  PWHPKSWNIDKKGPSPWLRMFQNARDWSS  588



>gb|AES72003.2| CobB/CobQ-like glutamine amidotransferase domain protein [Medicago 
truncatula]
Length=775

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 100/149 (67%), Gaps = 14/149 (9%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            D SQPR  HNES RFEC FT+V I++SPAIMFKGM GS +G+W A GEGRAYF D  +L 
Sbjct  463  DLSQPRFIHNESGRFECRFTNVTIKDSPAIMFKGMTGSTMGIWTAHGEGRAYFQDEDVLQ  522

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
            +V  S LAP+R   D G PTE YPFN NGSPLG  AICSP+GR                F
Sbjct  523  RVVHSELAPIRYCDDAGNPTETYPFNVNGSPLGIAAICSPDGRHL--------------F  568

Query  267  PWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
            PW+PK W++ KKGP PWLRMF  A +W S
Sbjct  569  PWHPKSWNIDKKGPSPWLRMFQNARDWSS  597



>ref|XP_001784004.1| predicted protein [Physcomitrella patens]
 gb|EDQ51172.1| predicted protein [Physcomitrella patens]
Length=1450

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DP+QPR  HN+S RFEC F+SV I ESPAIM +GM G+ +G+W + GEG+A FP+  IL 
Sbjct  1298  DPAQPRFVHNDSGRFECRFSSVKIGESPAIMLEGMAGTTVGIWISHGEGKALFPNSPILE  1357

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S L P+    D G+ TE YPFN NGSP G  A+CSP+GR    MP PERCF M QF
Sbjct  1358  KVKKSNLVPLTYCDDAGESTEAYPFNPNGSPEGIAALCSPDGRHLAMMPHPERCFQMWQF  1417

Query  267   PWYPKXW-DVXKKGPXPWLRMFXXAXEWXS  181
             PWYP+ W  +   GP PWLR+F  A EW S
Sbjct  1418  PWYPQEWTHIDAAGPSPWLRLFQNAREWCS  1447



>gb|KDD75098.1| CobB/CobQ-like glutamine amidotransferase domain-containing protein, 
partial [Helicosporidium sp. ATCC 50920]
Length=316

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 95/148 (64%), Gaps = 1/148 (1%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQ-ESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
            D SQPR  HN S RFEC + +V ++ +SPA++ +GM G+ LGVW A GEGRA FPD  + 
Sbjct  164  DASQPRFVHNASGRFECRWATVGVEPDSPAVLLRGMGGARLGVWVAHGEGRAVFPDEDVE  223

Query  450  NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
              +    LAP+R     G PTE YP N NGSP G  A+CSPNGR    MP PERC+LM Q
Sbjct  224  RAILDRGLAPMRYVDASGSPTEAYPANPNGSPHGVAALCSPNGRHLAMMPHPERCYLMWQ  283

Query  270  FPWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PW+P    + K+ P PWL++F  A EW
Sbjct  284  NPWWPADVGLSKRDPGPWLKLFQNAREW  311



>ref|XP_005648260.1| AIR synthase-related protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23716.1| AIR synthase-related protein [Coccomyxa subellipsoidea C-169]
Length=1348

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 93/147 (63%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D  QPR  HN S RFEC + +V I+ SP+I+ KGMEGS +G+W A GEG+A FPD ++  
Sbjct  1196  DTRQPRFVHNASGRFECRWATVRIEPSPSILLKGMEGSVVGIWCAHGEGQAKFPDDAVRA  1255

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V    LAP+R     G  TE YPFN NGSP G  A+ SP+GR    MP PERCFL  Q 
Sbjct  1256  SVLQQGLAPIRYCDASGATTEAYPFNPNGSPDGIAALTSPDGRHLALMPHPERCFLTWQN  1315

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PWYPK   +   GP PWL++F  A EW
Sbjct  1316  PWYPKDVGLQPDGPSPWLKLFQNAREW  1342



>ref|XP_005844442.1| hypothetical protein CHLNCDRAFT_139160 [Chlorella variabilis]
 gb|EFN52340.1| hypothetical protein CHLNCDRAFT_139160 [Chlorella variabilis]
Length=1095

 Score =   159 bits (401),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 95/149 (64%), Gaps = 2/149 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQE-SPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
             D  QPR  HN S RFE  +  V ++E SPA+M +GM G+ LGVW A GEGRA+FPD ++ 
Sbjct  942   DARQPRFVHNASGRFESRWAMVRVEEGSPAVMLRGMAGAQLGVWCAHGEGRAHFPDAAVR  1001

Query  450   NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
              +V    LAP+R     G PTE YPFN NGSP G  A+CSP+GR    MP PERCFL  Q
Sbjct  1002  ARVEAEALAPIRYCDAKGAPTEQYPFNPNGSPAGIAALCSPDGRHLAMMPHPERCFLAWQ  1061

Query  270   FPWYPKXWD-VXKKGPXPWLRMFXXAXEW  187
              PWYP+  + +    P PWL++F  A EW
Sbjct  1062  LPWYPRGMEGLEAACPGPWLKLFQNAREW  1090



>ref|XP_002948800.1| hypothetical protein VOLCADRAFT_58690 [Volvox carteri f. nagariensis]
 gb|EFJ50180.1| hypothetical protein VOLCADRAFT_58690 [Volvox carteri f. nagariensis]
Length=1325

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 92/147 (63%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D  QPR  HN S RFE  +  V I+ESP+++ KGMEGS +GVW A GEG+  FPD  +  
Sbjct  1171  DVRQPRFVHNSSGRFESRWVQVRIRESPSVLLKGMEGSVVGVWCAHGEGKCLFPDDQVKQ  1230

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V    LAP++      +PTEVYP N NGSPLG   +CS +GR    MP PERCFL  Q 
Sbjct  1231  EVLSKGLAPIQYVDADAQPTEVYPANPNGSPLGIAGLCSEDGRHLAMMPHPERCFLTWQL  1290

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             P+ P+   +  KGP PW+++F  A EW
Sbjct  1291  PYVPQSLGLDPKGPAPWIQLFQNAREW  1317



>ref|XP_001696039.1| AIR synthase-related protein [Chlamydomonas reinhardtii]
 gb|EDP00988.1| AIR synthase-related protein [Chlamydomonas reinhardtii]
Length=1403

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 90/147 (61%), Gaps = 0/147 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D  QPR  HN S RFE  +  V I++SPA++ KGMEG   GVWAA GEG+A FPD +I  
Sbjct  1251  DVKQPRFVHNASGRFESRWVQVRIEKSPAVLLKGMEGMVAGVWAAHGEGQALFPDDAIKA  1310

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V    L PV+       PTEVYP N NGSP+G   +CS NGR    MP PERCFL  Q 
Sbjct  1311  EVLAKNLIPVKYVDADASPTEVYPANPNGSPMGIAGMCSENGRHLAMMPHPERCFLTWQL  1370

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             P+ PK   +  KG  PWL++F  A EW
Sbjct  1371  PYVPKELGLEPKGAGPWLKLFQNAREW  1397



>ref|WP_038065041.1| phosphoribosylformylglycinamidine synthase [Thermodesulfovibrio 
thiophilus]
Length=1278

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 91/147 (62%), Gaps = 2/147 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             +  QPR   N S RFE  ++SV I  SP+IM K ME S LG+W A GEGRAYFPD  IL 
Sbjct  1129  ETRQPRFIRNNSGRFESRWSSVKILPSPSIMLKNMENSQLGIWIAHGEGRAYFPDQEILK  1188

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V    LAP+R   D GK TE YPFN NGSP G  A+C+ +GR    MP PER FL+ Q+
Sbjct  1189  TVLEKNLAPIRYIDDDGKITESYPFNPNGSPSGITALCTEDGRHLAMMPHPERSFLLWQW  1248

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PW P+ W   K    PWL++F  A +W
Sbjct  1249  PWLPESWKKLK--ASPWLKLFQNARKW  1273



>ref|XP_002177389.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51852.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=1313

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 90/144 (63%), Gaps = 2/144 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             + +QPR  HN+S +FE  F+SV IQ SPA+MFKGMEGS LGVW A GEGR +FPD S+  
Sbjct  1165  EENQPRLLHNDSGKFESRFSSVKIQSSPAVMFKGMEGSSLGVWVAHGEGRFHFPDPSVQE  1224

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V    LAP+R   D    T+ YPFN NGSP G  A+CS +GR    MP PER F   Q+
Sbjct  1225  MVKEKDLAPLRYVNDTNDVTQEYPFNPNGSPDGIAALCSEDGRHLALMPHPERVFTTWQW  1284

Query  267   PWYPKXWDVXKKGPXPWLRMFXXA  196
             PW P  W   K G  PWL MF  A
Sbjct  1285  PWTPAEWKDFKVG--PWLHMFQNA  1306



>gb|EWM30331.1| phosphoribosylformylglycinamidine synthase [Nannochloropsis gaditana]
Length=1338

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 91/149 (61%), Gaps = 2/149 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             + +QPR   N S RFE  F+SV IQ S AIMF GM GS LGVW A GEGR +F      +
Sbjct  1182  EAAQPRFIENNSARFESRFSSVQIQPSAAIMFAGMAGSSLGVWVAHGEGRVHFSTHETQD  1241

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
              V    LAP++   D   PTEVYPFN NGSPLG  A+CS +GR    MP PERC+L  Q+
Sbjct  1242  FVVAKQLAPMKYVDDDNNPTEVYPFNPNGSPLGIAALCSEDGRHLAMMPHPERCYLGWQW  1301

Query  267   PWYPKXWDVX--KKGPXPWLRMFXXAXEW  187
             P+ P+ W+    + G  PWLRMF  A  W
Sbjct  1302  PYLPREWEEKGMRSGVGPWLRMFQNARTW  1330



>ref|XP_002294498.1| phosphoribosylformylglycinamidine synthase [Thalassiosira pseudonana 
CCMP1335]
 gb|EED88332.1| phosphoribosylformylglycinamidine synthase [Thalassiosira pseudonana 
CCMP1335]
Length=1321

 Score =   151 bits (381),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 90/144 (63%), Gaps = 2/144 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             + SQPR   N+S RFE  F+SV I ESPAIMFKGMEGS LGVW A GEGR +FPD  I  
Sbjct  1173  EESQPRLLENDSGRFESRFSSVKIVESPAIMFKGMEGSSLGVWVAHGEGRFHFPDSKIHE  1232

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
                 S L+P+R   D  + T+ YPFN NGSP G  A+CS +GR    MP PER F   Q+
Sbjct  1233  HALASNLSPLRYVNDSNEVTQEYPFNPNGSPDGMAALCSEDGRHLAMMPHPERVFTTWQW  1292

Query  267   PWYPKXWDVXKKGPXPWLRMFXXA  196
             PW P+ W     G  PWL+MF  A
Sbjct  1293  PWMPEEWKDYTVG--PWLQMFQNA  1314



>ref|WP_012544968.1| phosphoribosylformylglycinamidine synthase [Thermodesulfovibrio 
yellowstonii]
 ref|YP_002248472.1| phosphoribosylformylglycinamidine synthase [Thermodesulfovibrio 
yellowstonii DSM 11347]
 gb|ACI20230.1| phosphoribosylformylglycinamidine synthase [Thermodesulfovibrio 
yellowstonii DSM 11347]
Length=1303

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 89/144 (62%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR   N+S RFE  + +V I  SP+IM K ME S +GVW A GEGRAYFPD +IL++V 
Sbjct  1157  QPRFIWNKSGRFESRWVTVKILPSPSIMLKEMEDSQIGVWIAHGEGRAYFPDKNILSKVL  1216

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                LAPVR   D G  TE YPFN N SP G  A+CS +GR    MP PER FL+ Q PW 
Sbjct  1217  EKNLAPVRYVDDSGNITETYPFNPNNSPYGITALCSEDGRHLAMMPHPERTFLLWQLPWL  1276

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+ W   K    PWL++F  A  W
Sbjct  1277  PQDWKKLK--ASPWLKLFQNARLW  1298



>gb|EJK51092.1| hypothetical protein THAOC_29768 [Thalassiosira oceanica]
Length=1329

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 92/144 (64%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR   NES +FE  F+SV + + P+++ KGM GS LGVW A GEGR +FPD ++L+   
Sbjct  1182  QPRLLENESGKFESRFSSVKVVDGPSVLLKGMAGSSLGVWVAHGEGRFHFPDSTVLDSSL  1241

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
              S LAP+R   D  + T+ YPFN NGSP G  A+CS +GR    MP PERCF   Q+PW 
Sbjct  1242  SSNLAPLRYVNDSNEVTQEYPFNPNGSPEGIAALCSDDGRHLAMMPHPERCFATWQWPWM  1301

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+ W   + G  PWLRMF  A E+
Sbjct  1302  PEDWAGYEAG--PWLRMFQNAREF  1323



>ref|WP_038059314.1| phosphoribosylformylglycinamidine synthase [Thermodesulfovibrio 
islandicus]
Length=1281

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 89/144 (62%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR   N+S RFE  + +V I  SP+IM K ME S +GVW A GEGRAYFPD +IL++V 
Sbjct  1135  QPRFIWNKSGRFESRWVTVKILPSPSIMLKEMEDSQIGVWIAHGEGRAYFPDKNILSKVL  1194

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                LAPVR   D G  TE YPFN N SP G  A+CS +GR    MP PER FL+ Q PW 
Sbjct  1195  EKNLAPVRYVDDSGNITETYPFNPNNSPYGITALCSEDGRHLAMMPHPERTFLLWQLPWL  1254

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+ W   K    PWL++F  A  W
Sbjct  1255  PQDWKKLK--ASPWLKLFQNARLW  1276



>ref|XP_002611349.1| hypothetical protein BRAFLDRAFT_278091 [Branchiostoma floridae]
 gb|EEN67359.1| hypothetical protein BRAFLDRAFT_278091 [Branchiostoma floridae]
Length=1337

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 88/140 (63%), Gaps = 2/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSI-LNQVPXSXL  427
             +N S RFE  F +VAI+ESPA+M KGMEGS LG+W A GEGR  F    I L++V  + L
Sbjct  1194  YNVSERFESRFVTVAIEESPALMLKGMEGSTLGIWVAHGEGRTEFVSLKIQLSEVEQNHL  1253

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
              P+R   D GKPT  YP N NGSP G  A+CSP+GR    MP PERC L  Q+PW P+ W
Sbjct  1254  TPLRYVDDDGKPTTAYPLNPNGSPNGLAALCSPDGRHLAMMPHPERCTLTWQWPWMPQDW  1313

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                 K   PWLRMF  A  W
Sbjct  1314  HQSMK-TSPWLRMFQNAYVW  1332



>ref|XP_004341600.1| phosphoribosylformylglycinamidine synthase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19514.1| phosphoribosylformylglycinamidine synthase [Acanthamoeba castellanii 
str. Neff]
Length=1314

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 1/146 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQE-SPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQ  445
             SQPR  HNES RFE  F ++ I E +P+I  KGMEGS LG W++ GEG+ +FP  +I  Q
Sbjct  1160  SQPRFIHNESERFESRFVTLKIMEDNPSIFLKGMEGSSLGCWSSHGEGKVHFPSKAIEEQ  1219

Query  444   VPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFP  265
             V    LAP+R   D  +PTE YPFN NGS  G  A+CSP+GR    MP PER FL  Q+ 
Sbjct  1220  VLQQHLAPIRYVDDHNRPTETYPFNPNGSMQGIAALCSPDGRHMAIMPHPERTFLRWQWA  1279

Query  264   WYPKXWDVXKKGPXPWLRMFXXAXEW  187
             W P  W        PWL +F  A  W
Sbjct  1280  WMPHEWKEETVPVSPWLHLFQNARRW  1305



>ref|XP_002741156.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Saccoglossus 
kowalevskii]
Length=511

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 82/140 (59%), Gaps = 1/140 (1%)
 Frame = -1

Query  606  THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
            THN S RFE  F SV IQ SPAIM KGM+ S LGVW A GEG   F +  IL  V  + L
Sbjct  367  THNNSERFESRFVSVQIQSSPAIMLKGMDCSTLGVWVAHGEGNMKFLNDEILQNVLKNNL  426

Query  426  APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
            AP+R   D G  T  YP N NGSP G  A+CS +GR    MP PERC L+ Q+PW P  W
Sbjct  427  APIRYVDDIGDVTTQYPLNPNGSPNGIAALCSRDGRHLAMMPHPERCTLVWQWPWMPNEW  486

Query  246  DVXKKGPXPWLRMFXXAXEW  187
                K   PWLRMF  A  W
Sbjct  487  RKTLK-VSPWLRMFQNACVW  505



>ref|XP_007513321.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16879.1| predicted protein [Bathycoccus prasinos]
Length=1391

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 89/148 (60%), Gaps = 3/148 (2%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQ-ESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
             D  QPR  HN+S RFE  F +V I   +P+IM K M GS +GVW A GEG+A+FPD S++
Sbjct  1242  DAKQPRFIHNDSGRFESRFVTVGIDSNTPSIMLKDMGGSRMGVWCAHGEGKAHFPDSSVI  1301

Query  450   NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
             +++  S    VR     GKPT  YP N NGSP G   +CS +GR    MP PER FL  Q
Sbjct  1302  SELSKSGQCAVRYVDSAGKPTTEYPLNPNGSPEGIAGLCSKDGRHLAMMPHPERAFLGWQ  1361

Query  270   FPWYPKXWDVXKKGPXPWLRMFXXAXEW  187
              PW PK  +V   G  PWL+MF  A +W
Sbjct  1362  LPWSPKDANVQDVG--PWLKMFQNAADW  1387



>ref|XP_781955.3| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Strongylocentrotus 
purpuratus]
Length=1376

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 86/139 (62%), Gaps = 1/139 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S R+E  F +V IQESPAIM +GM+ S LG+W A GEG+  F   SI + V  + LA
Sbjct  1233  HNDSERYESRFVTVKIQESPAIMLQGMQDSTLGIWVAHGEGKMKFAKESIHSSVLSNDLA  1292

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             PVR   D G PT  YP N NGSP G  A+CSP+GR    MP PERC L  Q+PW P  W 
Sbjct  1293  PVRYVDDEGAPTTQYPLNPNGSPDGIAALCSPDGRHLAIMPHPERCTLTWQWPWMPAEWR  1352

Query  243   VXKKGPXPWLRMFXXAXEW  187
                K   PWLR+F  A +W
Sbjct  1353  RDLKAS-PWLRIFQNAYKW  1370



>ref|XP_001641660.1| predicted protein [Nematostella vectensis]
 gb|EDO49597.1| predicted protein [Nematostella vectensis]
Length=1358

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             THN S RFE  F +V I+ SPA+M +G+EGS LGVW A GEGRA F    +L+ V    L
Sbjct  1215  THNISERFESRFVTVTIESSPALMLQGLEGSSLGVWVAHGEGRAQFVRPEVLDNVVSKNL  1274

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             APVR   D G  T  YP N NGSPLG   +CSP+GR    MP PERC L  Q+ W P+ W
Sbjct  1275  APVRYVDDDGNITTQYPLNPNGSPLGIAGLCSPDGRHLAMMPHPERCTLPWQWAWMPEEW  1334

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                     PWLRMF  A EW
Sbjct  1335  R-GSMSTSPWLRMFQNAYEW  1353



>ref|XP_008118599.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Anolis 
carolinensis]
Length=1337

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 84/138 (61%), Gaps = 1/138 (1%)
 Frame = -1

Query  600   NESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAP  421
             N S RFE  F S+ I+ESP++M +GM GS LG+W A GEGR  F    +L +V  + L P
Sbjct  1192  NNSGRFESRFVSLGIEESPSVMLRGMAGSVLGIWVAHGEGRMRFRSPEVLTKVRSARLIP  1251

Query  420   VRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWDV  241
             +R   D G PTE YP N NGSP+G   ICSP+GR    MP PERC L  Q+PW P  W  
Sbjct  1252  LRYVDDQGLPTEEYPLNPNGSPMGIAGICSPDGRHLAMMPHPERCVLPWQWPWMPSSWRQ  1311

Query  240   XKKGPXPWLRMFXXAXEW  187
               K   PWLRMF  A EW
Sbjct  1312  SMK-VSPWLRMFQNACEW  1328



>ref|WP_020256263.1| hypothetical protein [Candidatus Paceibacter normanii]
Length=1265

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             +  QPR   N S RFE  + +V I ESP+IM KGMEGS LG+W+A G GR Y P+  IL+
Sbjct  1113  EKEQPRFIANPSERFESHWGAVKILESPSIMLKGMEGSILGIWSAHGGGRLYCPNPKILS  1172

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +     L PV    D G+PTE Y  N NGSP G  A CSP+GR    MP PER FL+ Q+
Sbjct  1173  KAVQEWLTPVVYVDDQGRPTEEYRLNPNGSPFGITAFCSPDGRHLAMMPHPERSFLLWQW  1232

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PW P+ W   K    PWLRMF  A EW
Sbjct  1233  PWVPQEWKF-KDWISPWLRMFQNAREW  1258



>ref|XP_001418300.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96593.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1348

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 90/152 (59%), Gaps = 1/152 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQE-SPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
             D  QPR  HN+S RFE  +T+V I E +PA+M KGM GS +GVW A GEG+  FPD S+L
Sbjct  1195  DSRQPRFIHNDSGRFESRWTTVGIDENTPAMMLKGMGGSRMGVWCAHGEGKVKFPDESML  1254

Query  450   NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
               V  +  A VR     G PTE YP N NGSP G   +CS +GR    MP PER F+  Q
Sbjct  1255  PDVLKNGQAAVRYVDADGSPTEQYPLNPNGSPHGIAGLCSKDGRHLAMMPHPERAFIGWQ  1314

Query  270   FPWYPKXWDVXKKGPXPWLRMFXXAXEWXSXD  175
              PW P    V   GP PWL+MF  A +W + +
Sbjct  1315  VPWAPADAGVDPYGPGPWLQMFQNAQKWAAEN  1346



>ref|XP_004351784.1| phosphoribosylformylglycinamide synthase [Dictyostelium fasciculatum]
 gb|EGG15064.1| phosphoribosylformylglycinamide synthase [Dictyostelium fasciculatum]
Length=1339

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 89/150 (59%), Gaps = 3/150 (2%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D  QPR  HN S RFE  + +V+I ES A++ KGMEGS LG WA  GEGRAYFPD   L 
Sbjct  1182  DQLQPRFIHNASGRFESRWITVSIAESKAVLLKGMEGSVLGCWAQHGEGRAYFPDPDTLK  1241

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             Q+    LAPVR   D  +PTE YP N +G+P G   +CS +GR    MP PER F+  Q+
Sbjct  1242  QIKQLGLAPVRYVDDSCQPTETYPHNPSGTPEGIAGLCSKDGRHLALMPHPERSFMSWQW  1301

Query  267   PWYPKXWDVXKKG---PXPWLRMFXXAXEW  187
             PW P+       G   P PWL++F  A  +
Sbjct  1302  PWMPEHIQTQVGGLNQPSPWLKIFQNAKSF  1331



>ref|XP_008174296.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Chrysemys 
picta bellii]
Length=466

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 85/140 (61%), Gaps = 1/140 (1%)
 Frame = -1

Query  606  THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
            T N+S RFE  F ++ I+ESPA+M +GM GS LG+W A GEGR  F    +L  V    L
Sbjct  319  TPNDSGRFESRFVALTIEESPAVMLRGMAGSTLGIWVAHGEGRMRFRSPEVLAAVTSGGL  378

Query  426  APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
            AP+R   D G+PT+ YP N NGSPLG   +CSP+GR    MP PERC L  Q+ W P  W
Sbjct  379  APLRYVDDQGQPTQEYPLNPNGSPLGIAGLCSPDGRHLAMMPHPERCVLPWQWAWMPPAW  438

Query  246  DVXKKGPXPWLRMFXXAXEW  187
                +   PWLRMF  A EW
Sbjct  439  RHTME-VSPWLRMFQNACEW  457



>ref|XP_010785341.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Notothenia 
coriiceps]
Length=1319

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S+   THN+S RFE  F SV IQESP+I  +GMEGS LGVW A GEG   F       Q+
Sbjct  1171  SEVALTHNKSGRFESRFVSVGIQESPSIWLRGMEGSALGVWVAHGEGLMQFRSSLAEEQI  1230

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S LAPVR   D G+PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW
Sbjct  1231  ISSGLAPVRYLDDLGQPTEEYPLNPNGSPRGVAGLCSRDGRHLAMMPHPERCTLGWQWPW  1290

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              P+ +      P PWLRMF  A  W S
Sbjct  1291  APRDFR-PSLTPSPWLRMFKNAAAWCS  1316



>ref|XP_006007111.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Latimeria 
chalumnae]
Length=992

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = -1

Query  606  THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             HN+S RFE  F +V+I ESPAIM +GMEGS LG+W A GEG   F     L+ V  + L
Sbjct  849  NHNQSRRFESRFVTVSILESPAIMLRGMEGSSLGIWVAHGEGYMQFKSEDTLDFVTSNCL  908

Query  426  APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
            APVR   D G PT+ YP N NGSP G   +CS +GR    MP PERC L  Q+PW P+ W
Sbjct  909  APVRYVDDLGLPTQQYPLNPNGSPSGIAGLCSADGRHLAMMPHPERCTLTWQWPWMPQEW  968

Query  246  DVXKKGPXPWLRMFXXAXEW  187
                    PWLR+F  A EW
Sbjct  969  R-RTLAVSPWLRVFQNAAEW  987



>emb|CEF98481.1| Glutamine amidotransferase [Ostreococcus tauri]
Length=1373

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 88/150 (59%), Gaps = 1/150 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQE-SPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
             D  QPR  HN+S RFE  +T+V I E +PA+M KGM GS +GVW A GEG+  FPD S+L
Sbjct  1221  DSKQPRFIHNDSGRFESRWTTVGIDENTPAMMLKGMGGSRMGVWCAHGEGKVKFPDESML  1280

Query  450   NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
               V  +  A VR     G PT+ YP N NGSP G   +CS +GR    MP PER F+  Q
Sbjct  1281  PDVLKNGQAAVRYVDADGAPTQQYPLNPNGSPHGIAGLCSKDGRHLAMMPHPERAFIGWQ  1340

Query  270   FPWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              PW P    +   GP PWL+MF  A  W S
Sbjct  1341  VPWAPSDAGIDPYGPGPWLQMFQNAQRWAS  1370



>ref|XP_005784999.1| hypothetical protein EMIHUDRAFT_456050 [Emiliania huxleyi CCMP1516]
 gb|EOD32570.1| hypothetical protein EMIHUDRAFT_456050 [Emiliania huxleyi CCMP1516]
Length=402

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = -1

Query  627  DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
            +  QPR  HN S RFE  +++V +  SPA++ +GMEGS LGVW A GEGRA+FP    L 
Sbjct  253  EAEQPRFVHNSSGRFESRWSAVKVAPSPAVLLQGMEGSSLGVWVAHGEGRAHFPREDSLQ  312

Query  447  QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             V     AP+R   D  + T+ YP N NGSP G  A+CSP+GR    MP PERCF+  Q 
Sbjct  313  AVLKGSQAPLRYINDACEVTQEYPHNPNGSPEGIAALCSPDGRHLAMMPHPERCFVKWQC  372

Query  267  PWYPKXWDVXKKGPXPWLRMFXXA  196
            PW P  W+       PWLR+F  A
Sbjct  373  PWAPPEWEANASA--PWLRLFQNA  394



>ref|XP_002112809.1| hypothetical protein TRIADDRAFT_56338 [Trichoplax adhaerens]
 gb|EDV24919.1| hypothetical protein TRIADDRAFT_56338 [Trichoplax adhaerens]
Length=817

 Score =   141 bits (355),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 67/140 (48%), Positives = 79/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  606  THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
            T N S RFE  F +V I +SPAIM +GM  S LG+W A  EG A F    IL  +    L
Sbjct  672  TENISNRFESRFPTVKILDSPAIMLQGMANSQLGIWVAHAEGYAKFSSDQILKNMLELNL  731

Query  426  APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
            AP+R     G+PTE YPFN NGSP G   +CS +GR    MP PERC  + Q+PW P  W
Sbjct  732  APIRYVDSTGRPTEEYPFNPNGSPCGIAGLCSRDGRHLAMMPHPERCIHLWQWPWVPHDW  791

Query  246  DVXKKGPXPWLRMFXXAXEW  187
                    PWL+MF  A EW
Sbjct  792  K-QSIDVSPWLKMFRNAYEW  810



>emb|CAG01685.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=1336

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             THN+S RFE  F SV IQESP+I  +GMEGS LGVW A GEG   F      +Q+    L
Sbjct  1197  THNKSGRFESRFVSVGIQESPSIWLQGMEGSALGVWVAHGEGLVKFRSAQAEDQIISCRL  1256

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G+PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW P+ +
Sbjct  1257  APLRYLDDQGQPTEEYPLNPNGSPWGVAGLCSRDGRHLAMMPHPERCTLGWQWPWAPRDF  1316

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                   P PWLRMF  A  W
Sbjct  1317  RASLT-PSPWLRMFKNAAAW  1335



>ref|XP_001745292.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89870.1| predicted protein [Monosiga brevicollis MX1]
Length=1324

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 82/140 (59%), Gaps = 2/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             THN S R+E  F +V I ESPA+M +GM GS LGVW A GEGR  F D      V    L
Sbjct  1182  THNTSGRYESRFVTVRIDESPAMMLQGMAGSTLGVWVAHGEGRVEFLDADAKKAVETENL  1241

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D  + TEVYP N NGSP G   +CS +GR    MP PERC ++ Q+P+ P+ W
Sbjct  1242  APIRYVDDANEATEVYPLNPNGSPDGIAGLCSADGRHLALMPHPERCSILWQWPYLPEDW  1301

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                +    PWLRMF  A  W
Sbjct  1302  RALE--ASPWLRMFENAAAW  1319



>ref|XP_002533184.1| Phosphoribosylformylglycinamidine synthase, putative [Ricinus 
communis]
 gb|EEF29198.1| Phosphoribosylformylglycinamidine synthase, putative [Ricinus 
communis]
Length=1355

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSVAI++SP+IM KGMEGS LGVWAA GEGRAYFPD  +L+
Sbjct  1265  DPSQPRFVHNESGRFECRFTSVAIKDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDDGVLD  1324

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSP  355
             +V  S LAPVR   D G PTE YPFN NGSP
Sbjct  1325  RVVHSDLAPVRYCDDDGNPTETYPFNVNGSP  1355



>ref|XP_010738061.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Larimichthys 
crocea]
Length=1318

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 84/142 (59%), Gaps = 1/142 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             THN+S RFE  F SV IQESP++  +GMEGS LGVW A GEG   F +    +Q+     
Sbjct  1175  THNKSGRFESRFISVGIQESPSVWLRGMEGSALGVWVAHGEGLMQFRNSQAQDQIISGGF  1234

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW P+ +
Sbjct  1235  APLRYLDDQGHPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLGWQWPWAPRDF  1294

Query  246   DVXKKGPXPWLRMFXXAXEWXS  181
                   P PWLRMF  A  W S
Sbjct  1295  RASLT-PSPWLRMFKNAAAWCS  1315



>ref|XP_008175180.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Chrysemys 
picta bellii]
Length=1456

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 85/140 (61%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             T N+S RFE  F ++ I+ESPA+M +GM GS LG+W A GEGR  F    +L  V    L
Sbjct  1309  TPNDSGRFESRFVALTIEESPAVMLRGMAGSTLGIWVAHGEGRMRFRSPEVLAAVTSGGL  1368

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G+PT+ YP N NGSPLG   +CSP+GR    MP PERC L  Q+ W P  W
Sbjct  1369  APLRYVDDQGQPTQEYPLNPNGSPLGIAGLCSPDGRHLAMMPHPERCVLPWQWAWMPPAW  1428

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                 +   PWLRMF  A EW
Sbjct  1429  RHTME-VSPWLRMFQNACEW  1447



>ref|XP_011453116.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like isoform 
X1 [Crassostrea gigas]
 ref|XP_011453117.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like isoform 
X1 [Crassostrea gigas]
 ref|XP_011453119.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like isoform 
X1 [Crassostrea gigas]
Length=1359

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 83/143 (58%), Gaps = 9/143 (6%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC FT+V I +SPAIMFKGME +  G+W+A GEGR  F    I   V    L 
Sbjct  1217  HNLSERFECRFTTVKILDSPAIMFKGMEDTVFGMWSAHGEGRMVFCSEEIYQDVCRDKLV  1276

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYP----  256
              V+   D GKPTE YPFN NGS  G  A+CS +GR    MP PERCFL  Q  W P    
Sbjct  1277  AVKYVDDQGKPTETYPFNPNGSRDGIAALCSDDGRHLAIMPHPERCFLPWQCAWMPQEMR  1336

Query  255   KXWDVXKKGPXPWLRMFXXAXEW  187
             K +DV      PW +MF  A +W
Sbjct  1337  KNYDV-----SPWYKMFQNAFDW  1354



>ref|XP_005923257.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Haplochromis 
burtoni]
Length=1313

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 84/142 (59%), Gaps = 1/142 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             +HN+S RFE  F SV IQ+SP+I  +GMEGS LGVW A GEG   F     L+ +    L
Sbjct  1170  SHNKSGRFESRFVSVGIQDSPSIWLRGMEGSALGVWVAHGEGLVQFRSSRALDLIISGGL  1229

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW P+ +
Sbjct  1230  APLRYLDDQGHPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLSWQWPWAPRDF  1289

Query  246   DVXKKGPXPWLRMFXXAXEWXS  181
                   P PWLRMF  A  W S
Sbjct  1290  R-PSLTPSPWLRMFKNAASWCS  1310



>ref|XP_011453120.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like isoform 
X2 [Crassostrea gigas]
Length=1358

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 83/143 (58%), Gaps = 9/143 (6%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC FT+V I +SPAIMFKGME +  G+W+A GEGR  F    I   V    L 
Sbjct  1216  HNLSERFECRFTTVKILDSPAIMFKGMEDTVFGMWSAHGEGRMVFCSEEIYQDVCRDKLV  1275

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYP----  256
              V+   D GKPTE YPFN NGS  G  A+CS +GR    MP PERCFL  Q  W P    
Sbjct  1276  AVKYVDDQGKPTETYPFNPNGSRDGIAALCSDDGRHLAIMPHPERCFLPWQCAWMPQEMR  1335

Query  255   KXWDVXKKGPXPWLRMFXXAXEW  187
             K +DV      PW +MF  A +W
Sbjct  1336  KNYDV-----SPWYKMFQNAFDW  1353



>ref|XP_003062214.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53926.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1384

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 85/148 (57%), Gaps = 1/148 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQ-ESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
             D  QPR  HN+S RFE  + +V +  ++PA+M  GM+GS +G+W A GEG+  FPD S +
Sbjct  1230  DEKQPRFIHNDSGRFESRWVTVGVDADTPAVMLDGMQGSKIGIWIAHGEGKVKFPDASRV  1289

Query  450   NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
             + +     AP+R     G+ T  YP N NGS  G   +CS +GR    MP PER FL  Q
Sbjct  1290  DDIVAGGQAPIRYVDADGEATTRYPLNPNGSERGIAGLCSKDGRHLAMMPHPERAFLGWQ  1349

Query  270   FPWYPKXWDVXKKGPXPWLRMFXXAXEW  187
              PW P+   +   GP PWLRMF  A  W
Sbjct  1350  MPWAPEDAGIDANGPGPWLRMFQNARTW  1377



>ref|XP_011453121.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like isoform 
X3 [Crassostrea gigas]
Length=1355

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 83/143 (58%), Gaps = 9/143 (6%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC FT+V I +SPAIMFKGME +  G+W+A GEGR  F    I   V    L 
Sbjct  1213  HNLSERFECRFTTVKILDSPAIMFKGMEDTVFGMWSAHGEGRMVFCSEEIYQDVCRDKLV  1272

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYP----  256
              V+   D GKPTE YPFN NGS  G  A+CS +GR    MP PERCFL  Q  W P    
Sbjct  1273  AVKYVDDQGKPTETYPFNPNGSRDGIAALCSDDGRHLAIMPHPERCFLPWQCAWMPQEMR  1332

Query  255   KXWDVXKKGPXPWLRMFXXAXEW  187
             K +DV      PW +MF  A +W
Sbjct  1333  KNYDV-----SPWYKMFQNAFDW  1350



>gb|EKC33036.1| Phosphoribosylformylglycinamidine synthase, partial [Crassostrea 
gigas]
Length=1292

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 83/143 (58%), Gaps = 9/143 (6%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC FT+V I +SPAIMFKGME +  G+W+A GEGR  F    I   V    L 
Sbjct  1150  HNLSERFECRFTTVKILDSPAIMFKGMEDTVFGMWSAHGEGRMVFCSEEIYQDVCRDKLV  1209

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYP----  256
              V+   D GKPTE YPFN NGS  G  A+CS +GR    MP PERCFL  Q  W P    
Sbjct  1210  AVKYVDDQGKPTETYPFNPNGSRDGIAALCSDDGRHLAIMPHPERCFLPWQCAWMPQEMR  1269

Query  255   KXWDVXKKGPXPWLRMFXXAXEW  187
             K +DV      PW +MF  A +W
Sbjct  1270  KNYDV-----SPWYKMFQNAFDW  1287



>ref|XP_008175179.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Chrysemys 
picta bellii]
Length=1282

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             T N+S RFE  F ++AI+ES A+M +GM GS LG+W A GEGR  F    +L  V    L
Sbjct  1135  TPNDSGRFESRFVALAIEESLAVMLQGMAGSTLGIWVAHGEGRMRFRSPEVLAAVTSGGL  1194

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G+PT+ YP N NGSPLG   +CSP+GR    MP PERC L  Q+ W P  W
Sbjct  1195  APLRYVDDQGQPTQEYPLNPNGSPLGIAGLCSPDGRHLAMMPHPERCVLPWQWAWMPPAW  1254

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                     PWLRMF  A EW
Sbjct  1255  -CRTMEVSPWLRMFQNACEW  1273



>ref|XP_005710774.1| phosphoribosylformylglycinamidine synthase [Chondrus crispus]
 emb|CDF40480.1| phosphoribosylformylglycinamidine synthase [Chondrus crispus]
Length=1414

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAI-QESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQ  445
             SQPR  HN+S R+E  F++V I  +SPAIMFK M G+ LGVW A GEG+A+FPD  +L +
Sbjct  1254  SQPRFIHNDSGRYESRFSTVKIADDSPAIMFKDMAGAQLGVWVAHGEGKAFFPDTEVLER  1313

Query  444   VPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFP  265
             V    LAP+R   D G  T+ YP N NGS  G   +CS NGR    MP PER  L  Q+ 
Sbjct  1314  VKQQNLAPLRYVDDQGGITQAYPDNPNGSEQGIAGLCSQNGRHLALMPHPERTVLKWQWG  1373

Query  264   WYPKXWDVXKKGPXPWLRMFXXAXEW  187
             + PK  D  +    PWL+MF  A EW
Sbjct  1374  FLPKEND-DEWEASPWLKMFQNAYEW  1398



>gb|KDR16414.1| Phosphoribosylformylglycinamidine synthase [Zootermopsis nevadensis]
Length=1338

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 83/139 (60%), Gaps = 1/139 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC F++V I+ SP+IM +GMEG  LG+W A GEGR  F + ++L+ +      
Sbjct  1195  HNLSERFECRFSTVRIERSPSIMLQGMEGCILGIWIAHGEGRFTFRNENVLSSLEQRCCL  1254

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D GKPT+ YP N NGSP G   ICS +GR    MP PERC  + Q+PW P  W 
Sbjct  1255  AMKYVDDDGKPTQTYPLNPNGSPCGIAGICSEDGRHLAMMPHPERCTQLWQWPWMPADWH  1314

Query  243   VXKKGPXPWLRMFXXAXEW  187
               K    PWLRMF  A  W
Sbjct  1315  -DKYTVSPWLRMFENAFSW  1332



>ref|XP_003974141.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Takifugu 
rubripes]
Length=1319

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 83/140 (59%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             THN+S RFE  F SV IQESP++  KGMEGS LGVW A GEG   F +     ++    L
Sbjct  1176  THNKSGRFESRFVSVGIQESPSVWLKGMEGSALGVWVAHGEGLVQFRNSRAEERIISRHL  1235

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G+PTE YP N NGSP G   +CS +GR    MP PERC L  Q+ W P+ +
Sbjct  1236  APLRYLDDQGRPTEEYPLNPNGSPRGIAGLCSGDGRHLAMMPHPERCTLGWQWAWAPRDF  1295

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                   P PWLRMF  A  W
Sbjct  1296  R-SSLTPSPWLRMFKNAAAW  1314



>gb|EFA75406.1| phosphoribosylformylglycinamide synthase [Polysphondylium pallidum 
PN500]
Length=1347

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 87/144 (60%), Gaps = 3/144 (2%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN S RFE  + +VAI++S AIM  GMEGS LG W+  GEG AYFPD SIL  V 
Sbjct  1195  QPRFIHNASGRFESRWVTVAIEKSNAIMLAGMEGSILGCWSQHGEGLAYFPDESILADVQ  1254

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
              + LAPVR   D G+ T VYP+N NGS  G  ++ S +GR    MP PER FL  Q+P  
Sbjct  1255  ANNLAPVRYVDDNGQKTNVYPYNPNGSTDGIASLISRDGRHLAMMPHPERSFLSWQWPHM  1314

Query  258   PKXWDVXKKG---PXPWLRMFXXA  196
             P+       G   P PWL+MF  A
Sbjct  1315  PQNIQQAVGGLSQPSPWLKMFQNA  1338



>ref|XP_008405530.1| PREDICTED: phosphoribosylformylglycinamidine synthase isoform 
X2 [Poecilia reticulata]
Length=1119

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 83/147 (56%), Gaps = 1/147 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S+   THN S RFE  F SV IQ SP+I  +GMEGS LGVW A GEG   F      + +
Sbjct  971   SEVVLTHNRSGRFESRFVSVGIQRSPSIWLRGMEGSALGVWVAHGEGLMRFRSPRAQDLI  1030

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S LAPVR   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW
Sbjct  1031  TSSGLAPVRYLDDQGSPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLGWQWPW  1090

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              P+        P PWLRMF  A  W S
Sbjct  1091  APRDLR-PALSPSPWLRMFRNAAAWCS  1116



>ref|XP_008405528.1| PREDICTED: phosphoribosylformylglycinamidine synthase isoform 
X1 [Poecilia reticulata]
 ref|XP_008405529.1| PREDICTED: phosphoribosylformylglycinamidine synthase isoform 
X1 [Poecilia reticulata]
Length=1320

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 83/147 (56%), Gaps = 1/147 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S+   THN S RFE  F SV IQ SP+I  +GMEGS LGVW A GEG   F      + +
Sbjct  1172  SEVVLTHNRSGRFESRFVSVGIQRSPSIWLRGMEGSALGVWVAHGEGLMRFRSPRAQDLI  1231

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S LAPVR   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW
Sbjct  1232  TSSGLAPVRYLDDQGSPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLGWQWPW  1291

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              P+        P PWLRMF  A  W S
Sbjct  1292  APRDLR-PALSPSPWLRMFRNAAAWCS  1317



>ref|XP_007259559.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Astyanax 
mexicanus]
Length=1315

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 82/140 (59%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             THN+S RFE  F SV I  SPA+M KGMEGS LGVW A GEG   F      +++  + L
Sbjct  1171  THNKSGRFESRFVSVGILPSPAVMLKGMEGSALGVWVAHGEGLMQFRCPEAQDRLISASL  1230

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             APVR   D G PTE YP N NGS  G   ICSP+GR    MP PER  L  Q+PW P+  
Sbjct  1231  APVRYIDDSGVPTETYPMNPNGSAQGIAGICSPDGRHLAMMPHPERAVLGWQWPWVPQPL  1290

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                 K P PWLRMF  A  W
Sbjct  1291  RASLK-PSPWLRMFQNAAAW  1309



>ref|XP_005795740.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Xiphophorus 
maculatus]
Length=1318

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 84/147 (57%), Gaps = 1/147 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S+   THN S RFE  F SV IQ+SP+I  +GMEGS LGVW A GEG   F      + +
Sbjct  1170  SEVVLTHNRSGRFESRFVSVGIQKSPSIWLRGMEGSALGVWVAHGEGLMRFCSPRAQDLI  1229

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S LAPVR   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW
Sbjct  1230  TSSGLAPVRYLDDQGSPTEEYPLNPNGSPQGIAGLCSKDGRHLAMMPHPERCTLGWQWPW  1289

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              P+        P PW+RMF  A  W S
Sbjct  1290  APRDLR-PALSPSPWMRMFRNAAAWCS  1315



>ref|XP_004557308.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Maylandia 
zebra]
Length=1313

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             +HN+S RFE  F SV IQ+SP+I  +GMEGS LGVW A GEG   F      + +    L
Sbjct  1170  SHNKSGRFESRFVSVGIQDSPSIWLRGMEGSALGVWVAHGEGLVQFRSSRAQDLIISGGL  1229

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW P+ +
Sbjct  1230  APLRYLDDQGHPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLSWQWPWAPRDF  1289

Query  246   DVXKKGPXPWLRMFXXAXEWXS  181
                   P PWLRMF  A  W S
Sbjct  1290  R-PSLTPSPWLRMFKNAASWCS  1310



>ref|XP_008305437.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Cynoglossus 
semilaevis]
Length=1321

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 81/145 (56%), Gaps = 1/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S+   THN+S RFE  F SV IQ SP++  KGMEGS LGVW A GEG   F       Q+
Sbjct  1173  SEVVLTHNKSGRFESRFVSVGIQASPSVWLKGMEGSALGVWVAHGEGLMQFRSSEAQEQI  1232

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
                 LAP+R   D G PTE YP N NGSPLG   +CS +GR    MP PERC    Q+ W
Sbjct  1233  ISGGLAPLRYLDDQGGPTEEYPLNPNGSPLGTAGLCSRDGRHLAMMPHPERCTRAWQWAW  1292

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P+        P PWLRMF  A  W
Sbjct  1293  APRDLRASLT-PSPWLRMFRNAAAW  1316



>ref|XP_005479005.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Oreochromis 
niloticus]
Length=1321

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             +HN+S RFE  F SV IQ+SP+I  +GMEGS LGVW A GEG   F      + +    L
Sbjct  1178  SHNKSGRFESRFVSVGIQDSPSIWLRGMEGSALGVWVAHGEGLVQFRSSRAQDLIISGGL  1237

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW P+ +
Sbjct  1238  APLRYLDDQGHPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLSWQWPWAPRDF  1297

Query  246   DVXKKGPXPWLRMFXXAXEWXS  181
                   P PWLRMF  A  W S
Sbjct  1298  R-PSLTPSPWLRMFKNAASWCS  1318



>ref|XP_002507834.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69092.1| predicted protein [Micromonas sp. RCC299]
Length=1272

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 86/148 (58%), Gaps = 1/148 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQE-SPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
             D  QPR  HN+S RFE  +T+V I+E +PA+M +GM+GS +G+W A GEG+  FP+ S +
Sbjct  1114  DVEQPRFIHNDSGRFESRWTTVGIEENTPAVMLQGMQGSRIGIWVAHGEGKVKFPNESRV  1173

Query  450   NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
               +  S  A VR     G+PT  YP N NGSP G   +C   GR    MP PER +L  Q
Sbjct  1174  PDILKSGQACVRYVDHAGEPTTQYPLNPNGSPHGIAGLCDATGRHLAMMPHPERAYLGWQ  1233

Query  270   FPWYPKXWDVXKKGPXPWLRMFXXAXEW  187
              PW P    +   GP PW+RMF  A  W
Sbjct  1234  MPWAPAEAGIAPDGPGPWMRMFQNARIW  1261



>ref|XP_011332505.1| PREDICTED: phosphoribosylformylglycinamidine synthase isoform 
X1 [Cerapachys biroi]
 gb|EZA58391.1| Phosphoribosylformylglycinamidine synthase [Cerapachys biroi]
Length=1329

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 83/139 (60%), Gaps = 4/139 (3%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +++V I++SP+IM +GMEGS LGVW A GEGR  F D  +L  +  +   
Sbjct  1188  HNISERFECRWSTVKIEKSPSIMLRGMEGSVLGVWVAHGEGRFTFHD-EVLETLRRNNCL  1246

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             P+R   D G PTE YP N NGS  G   +CS NGR    MP PERC  M Q+PW P  W+
Sbjct  1247  PIRFTDDYGNPTEQYPMNPNGSVSGIAGVCSKNGRHLAMMPHPERCTQMWQWPWTPAQWN  1306

Query  243   VXKKGPXPWLRMFXXAXEW  187
             +      PW R+F  A  W
Sbjct  1307  IQ---TSPWQRLFDNAYTW  1322



>ref|XP_625036.3| PREDICTED: phosphoribosylformylglycinamidine synthase [Apis mellifera]
Length=1325

 Score =   136 bits (342),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC ++++ I +SP+IM  GME S LG+W A GEGR  F +  IL ++  +   
Sbjct  1185  HNISERFECRWSTIKIDKSPSIMLSGMENSILGIWVAHGEGRFTFRNDEILQKLKKNHCL  1244

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G PTE YPFN NGS  G   ICS +GR    MP PERC  M Q+PW P  W 
Sbjct  1245  AIKYTDDFGNPTEKYPFNPNGSIEGIAGICSMDGRHLALMPHPERCSQMWQWPWKPYDW-  1303

Query  243   VXKKGPXPWLRMFXXAXEW  187
               K    PW R+F  A  W
Sbjct  1304  --KYSISPWQRIFDNAYAW  1320



>ref|XP_011332506.1| PREDICTED: phosphoribosylformylglycinamidine synthase isoform 
X2 [Cerapachys biroi]
Length=1150

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 83/139 (60%), Gaps = 4/139 (3%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +++V I++SP+IM +GMEGS LGVW A GEGR  F D  +L  +  +   
Sbjct  1009  HNISERFECRWSTVKIEKSPSIMLRGMEGSVLGVWVAHGEGRFTFHD-EVLETLRRNNCL  1067

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             P+R   D G PTE YP N NGS  G   +CS NGR    MP PERC  M Q+PW P  W+
Sbjct  1068  PIRFTDDYGNPTEQYPMNPNGSVSGIAGVCSKNGRHLAMMPHPERCTQMWQWPWTPAQWN  1127

Query  243   VXKKGPXPWLRMFXXAXEW  187
             +      PW R+F  A  W
Sbjct  1128  IQTS---PWQRLFDNAYTW  1143



>ref|XP_005732481.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Pundamilia 
nyererei]
Length=1061

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             +HN+S RFE  F SV IQ SP+I  +GMEGS LGVW A GEG   F      + +    L
Sbjct  918   SHNKSGRFESRFVSVGIQNSPSIWLRGMEGSALGVWVAHGEGLVQFRSSRAQDLIISGGL  977

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW P+ +
Sbjct  978   APLRYLDDQGHPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLSWQWPWAPRDF  1037

Query  246   DVXKKGPXPWLRMFXXAXEWXS  181
                   P PWLRMF  A  W S
Sbjct  1038  R-PSLTPSPWLRMFKNAASWCS  1058



>ref|XP_006132850.1| PREDICTED: LOW QUALITY PROTEIN: phosphoribosylformylglycinamidine 
synthase-like [Pelodiscus sinensis]
Length=1315

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 82/138 (59%), Gaps = 1/138 (1%)
 Frame = -1

Query  600   NESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAP  421
             N+S RFE  F ++ I+ESPA+M +GM GS LG+W A GEGR  F    +L  V    LAP
Sbjct  1170  NDSGRFESRFVALGIEESPAMMLRGMAGSTLGIWVAHGEGRMRFRSPEVLAAVTSGHLAP  1229

Query  420   VRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWDV  241
             +R   D G+PT  YP N NGSP G   +CSP+GR    MP PERC L  Q+ W P  W  
Sbjct  1230  LRYVDDQGQPTLEYPLNPNGSPQGIAGLCSPDGRHLAMMPHPERCVLPWQWAWMPSGWRR  1289

Query  240   XKKGPXPWLRMFXXAXEW  187
               +   PWLRMF  A EW
Sbjct  1290  TME-VSPWLRMFQNACEW  1306



>gb|EFN81618.1| Phosphoribosylformylglycinamidine synthase [Harpegnathos saltator]
Length=587

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = -1

Query  603  HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
            HN S RFEC +++V I+ SPAIM K MEGS LG+W A GEGR  F +  IL  +  +   
Sbjct  447  HNLSERFECRWSTVKIESSPAIMLKAMEGSVLGIWIAHGEGRFTFRNKKILKSLERNNCL  506

Query  423  PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
            P+R   D G PT  YP N NGS  G  A+CS +GR    MP PERC  M Q+PW P  W+
Sbjct  507  PLRYTDDCGHPTTCYPMNPNGSINGIAAVCSKDGRHLAMMPHPERCTRMWQWPWKPSEWN  566

Query  243  VXKKGPXPWLRMFXXAXEW  187
                   PW R+F  A  W
Sbjct  567  FE---VSPWQRLFDNAFTW  582



>ref|WP_035228399.1| phosphoribosylformylglycinamidine synthase [Desulfobulbus sp. 
Tol-SR]
 gb|KGO34863.1| phosphoribosylformylglycinamidine synthase [Desulfobulbus sp. 
Tol-SR]
Length=1268

 Score =   135 bits (341),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 64/147 (44%), Positives = 86/147 (59%), Gaps = 2/147 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D  QPR  HN S RFE  +++V + +SPA+M KGM+G   G+    GEGR  FPD ++  
Sbjct  1119  DERQPRFVHNRSGRFESRWSTVRVAKSPAMMLKGMDGLIFGIHVDHGEGRLLFPDDTVRQ  1178

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             Q+    LAP+    D G+PTE YPFN NGSP G   +CS +GR    MP PER FL  Q 
Sbjct  1179  QILAQGLAPLYYVDDTGRPTETYPFNPNGSPDGIAGLCSADGRHLALMPHPERVFLPWQA  1238

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
              W P+  ++      PW+++F  A +W
Sbjct  1239  HWLPE--ELRHLQVTPWMQLFRNAYDW  1263



>ref|WP_028579477.1| phosphoribosylformylglycinamidine synthase [Desulfobulbus japonicus]
Length=1267

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 83/144 (58%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN S RFE  +T+V IQ+SP++M +GME    G+    GEG+ +FPD SI  QV 
Sbjct  1122  QPRFIHNRSGRFESRWTTVKIQQSPSVMLRGMEDLVFGIHVDHGEGKLHFPDNSIFEQVQ  1181

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                L P+    D G+ TE YPFN NGSP G   +CSP+GR    MP PER FL  Q  W 
Sbjct  1182  QQNLTPMFYVNDQGQATEQYPFNPNGSPKGIAGLCSPDGRHLAIMPHPERVFLAWQAHWL  1241

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+     +    PWL+MF  A  W
Sbjct  1242  PEAMKGLE--VSPWLKMFQNAYAW  1263



>ref|XP_007550599.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Poecilia 
formosa]
Length=1318

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 83/147 (56%), Gaps = 1/147 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S+   THN S RFE  F SV IQ SP+I  +GMEGS LGVW A GEG   F      + +
Sbjct  1170  SEVVLTHNRSGRFESRFVSVGIQSSPSIWLRGMEGSALGVWVAHGEGLMRFRSPWAQDLI  1229

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S LAPVR   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW
Sbjct  1230  TSSGLAPVRYLDDQGSPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLGWQWPW  1289

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              P+        P PWLRMF  A  W S
Sbjct  1290  APRDLR-PALSPSPWLRMFRNAAAWCS  1315



>ref|XP_006790584.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Neolamprologus 
brichardi]
Length=963

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = -1

Query  606  THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
            +HN+S RFE  F SV IQ+SP+I  +GMEGS LGVW A GEG   F      + +    L
Sbjct  820  SHNKSGRFESRFVSVGIQDSPSIWLRGMEGSALGVWVAHGEGLVQFCSSRAQDLIISGGL  879

Query  426  APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
            AP+R   D G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW P+ +
Sbjct  880  APLRYLDDQGHPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLTWQWPWAPRDF  939

Query  246  DVXKKGPXPWLRMFXXAXEWXS  181
                  P PWL MF  A  W S
Sbjct  940  R-PSLTPSPWLHMFKNAASWCS  960



>gb|ENN76633.1| hypothetical protein YQE_06853, partial [Dendroctonus ponderosae]
Length=1343

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 85/143 (59%), Gaps = 2/143 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC +++V I++S AIM K ME S LGVW A GEGR  F D +I N++    L 
Sbjct  1196  HNKSERFECRWSTVRIEKSQAIMLKDMEKSVLGVWVAHGEGRFAFKDNTIYNKLVKDGLV  1255

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D   PTEVYP N NGS  G   +CSPNGR    MP PERC    Q P+ P+ W 
Sbjct  1256  ALRYVDDNSLPTEVYPMNPNGSLEGLAGVCSPNGRHLAIMPHPERCVQPFQCPYMPREWI  1315

Query  243   VXKKGPXPWLRMFXXAXEWXSXD  175
               +K   PW +MF  A +W + +
Sbjct  1316  HYQKS--PWEKMFKNAFDWCTNN  1336



>ref|XP_003696360.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Apis 
florea]
Length=1326

 Score =   135 bits (340),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC ++++ I +SP+IM  GME S LGVW A GEGR  F +  +L ++  +   
Sbjct  1186  HNISERFECRWSTIKIDKSPSIMLNGMENSILGVWVAHGEGRFTFRNDEVLQKLKKNHCL  1245

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D G PTE YPFN NGS  G   ICS +GR    MP PERC  + Q+PW P  W 
Sbjct  1246  AIRYTDDFGNPTEKYPFNPNGSIEGIAGICSMDGRHLALMPHPERCSQIWQWPWKPYNW-  1304

Query  243   VXKKGPXPWLRMFXXAXEW  187
               K    PW R+F  A  W
Sbjct  1305  --KYTISPWQRIFDNAYAW  1321



>ref|WP_023408324.1| hypothetical protein [uncultured Desulfofustis sp. PB-SRB1]
 gb|ESQ09368.1| hypothetical protein N839_00915 [uncultured Desulfofustis sp. 
PB-SRB1]
Length=1266

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 80/144 (56%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR   N S RFE  + SV + ESPAIM  GME +  G+    GEGR + PD  +LN V 
Sbjct  1122  QPRFVRNRSQRFESRWVSVTVTESPAIMLAGMENTTFGIHVDHGEGRFHAPDAGVLNAVK  1181

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                L P+    D G PTE YPFN NGSP G   +CSP+GR    MP PERCFL  Q  W 
Sbjct  1182  EQNLIPLAYVDDDGAPTERYPFNPNGSPGGVAGLCSPDGRHLALMPHPERCFLPWQAHWL  1241

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+  D+      PW R+F  A  W
Sbjct  1242  PE--DMKTIETSPWFRLFTNAYRW  1263



>emb|CDQ90799.1| unnamed protein product [Oncorhynchus mykiss]
Length=1154

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 81/142 (57%), Gaps = 0/142 (0%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             THN+S RFE  F SV I+ SP++  +GMEGS LGVW A GEG   F    +  ++  S L
Sbjct  1010  THNQSGRFESRFVSVGIKASPSVWLRGMEGSALGVWVAHGEGLVQFRSPQVQQRIISSGL  1069

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G PTEVYP N NGSP G   + S +GR    MP PERC    Q+PW P+  
Sbjct  1070  APLRYLDDTGAPTEVYPQNPNGSPQGLAGLTSRDGRHLAMMPHPERCTFGWQWPWAPREL  1129

Query  246   DVXKKGPXPWLRMFXXAXEWXS  181
                     PWLRMF  A  W S
Sbjct  1130  QSSLSTTSPWLRMFTNAAAWCS  1151



>ref|XP_009034351.1| hypothetical protein AURANDRAFT_22512 [Aureococcus anophagefferens]
 gb|EGB10763.1| hypothetical protein AURANDRAFT_22512 [Aureococcus anophagefferens]
Length=1294

 Score =   135 bits (339),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 66/142 (46%), Positives = 85/142 (60%), Gaps = 1/142 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             +QPR  HN S +FE  + SVA+ ESPA +  GM G+ LGVW A GEGRA+FPD  +   V
Sbjct  1131  TQPRFVHNASRKFESRWLSVAVLESPAKLLAGMAGATLGVWVAHGEGRAHFPDADVERAV  1190

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
                 LAPVR   D G+PT+ YPF  NG+  G  A+CSP G+    MP PERC L  Q+P+
Sbjct  1191  FDGGLAPVRYADDAGEPTDAYPFCPNGAARGAAALCSPCGKHLAMMPHPERCVLPWQWPY  1250

Query  261   YPKXWDVXKKGPXPWLRMFXXA  196
              P       +   PW+++F  A
Sbjct  1251  KPPGLP-GLEAASPWMKLFQNA  1271



>ref|XP_636865.1| phosphoribosylformylglycinamide synthase [Dictyostelium discoideum 
AX4]
 sp|Q54JC8.1|PUR4_DICDI RecName: Full=Phosphoribosylformylglycinamidine synthase; Short=FGAM 
synthase; Short=FGAMS; AltName: Full=Formylglycinamide 
ribonucleotide amidotransferase; Short=FGAR amidotransferase; 
Short=FGAR-AT; AltName: Full=Formylglycinamide ribotide 
amidotransferase [Dictyostelium discoideum]
 gb|EAL63360.1| phosphoribosylformylglycinamide synthase [Dictyostelium discoideum 
AX4]
Length=1355

 Score =   134 bits (338),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 65/144 (45%), Positives = 88/144 (61%), Gaps = 3/144 (2%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN S RFE  + +V I  SPA++ KGMEGS LGVW+  GEGR +  D SI+N + 
Sbjct  1204  QPRFIHNASGRFESRWVNVKIMPSPALLLKGMEGSVLGVWSQHGEGRFWSEDQSIVNDIK  1263

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
              + L+P+R   D G+ TE YPFN +G+  G  ++CS +GR    MP PER FL  Q+P+ 
Sbjct  1264  ANNLSPIRYVDDDGEITESYPFNPSGTQEGFASLCSKDGRHLAIMPHPERSFLSWQWPFM  1323

Query  258   PKXWDVXKKG---PXPWLRMFXXA  196
             P+       G   P PW+++F  A
Sbjct  1324  PENIKQNVGGLDQPSPWIKIFQNA  1347



>ref|XP_004068232.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Oryzias 
latipes]
Length=1319

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 83/147 (56%), Gaps = 1/147 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S+   THN S RFE  F SV IQESP+I  +GMEGS LGVW A GEG   F      + +
Sbjct  1170  SEVVLTHNRSGRFESRFVSVGIQESPSIWLRGMEGSALGVWVAHGEGLMQFRSSMAQDLI  1229

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
                 LAP+R   + G PTE YP N NGSP G   +CS +GR    MP PERC L  Q+PW
Sbjct  1230  ISGGLAPLRYLDEQGFPTEEYPLNPNGSPQGVAGLCSRDGRHLAMMPHPERCTLSWQWPW  1289

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              P+        P PWLRMF  A  W S
Sbjct  1290  APRELR-PSLVPSPWLRMFKNAAAWCS  1315



>ref|XP_006635368.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Lepisosteus 
oculatus]
Length=1290

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 81/147 (55%), Gaps = 1/147 (1%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DP     THN S RFE  F S+ I  SPAIM KGMEGS LGVW A GEG   F   + L 
Sbjct  1140  DPHSVVLTHNTSGRFESRFVSLGILPSPAIMLKGMEGSTLGVWVAHGEGLMQFRSQAALE  1199

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             ++  + LAP+R   D G PTE YP N NGS  G   +CS +GR    MP PER  L  Q+
Sbjct  1200  RLLSASLAPLRYVDDAGAPTEEYPMNPNGSCQGLAGLCSEDGRHLAMMPHPERAVLSWQW  1259

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PW P  +      P PWL MF  A  W
Sbjct  1260  PWAPTSFRTSLS-PSPWLTMFRNAAAW  1285



>ref|XP_003080020.1| putative formylglycineamide ribotide am (ISS), partial [Ostreococcus 
tauri]
Length=1078

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 85/150 (57%), Gaps = 11/150 (7%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQE-SPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
             D  QPR  HN+S RFE  +T+V I E +PA+M KGM GS +GVW A GEG+  FPD S+L
Sbjct  936   DSKQPRFIHNDSGRFESRWTTVGIDENTPAMMLKGMGGSRMGVWCAHGEGKVKFPDESML  995

Query  450   NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
               V  +           G PT+ YP N NGSP G   +CS +GR    MP PER F+  Q
Sbjct  996   PDVVDAD----------GAPTQQYPLNPNGSPHGIAGLCSKDGRHLAMMPHPERAFIGWQ  1045

Query  270   FPWYPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              PW P    +   GP PWL+MF  A  W S
Sbjct  1046  VPWAPSDAGIDPYGPGPWLQMFQNAQRWAS  1075



>ref|XP_007893212.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Callorhinchus 
milii]
Length=1402

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 81/140 (58%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             T N S RFE  F SV++  SP++M +GMEGS LGVW A GEGR  F     L++V    L
Sbjct  1257  TPNRSGRFESRFVSVSVLPSPSLMLRGMEGSTLGVWVAHGEGRMSFRSPDTLSRVLAGSL  1316

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G PTE YP N NGS LG   +CS +GR    MP PERC  + Q+ W P  W
Sbjct  1317  APLRYADDKGSPTETYPLNPNGSELGIAGLCSADGRHLALMPHPERCVRLWQWAWVPPGW  1376

Query  246   DVXKKGPXPWLRMFXXAXEW  187
             +       PWLR+F  A  W
Sbjct  1377  N-RSHSVSPWLRVFLNASAW  1395



>emb|CBN75952.1| conserved unknown protein [Ectocarpus siliculosus]
Length=130

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = -1

Query  552  ESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAPVRXXXDXGKPTEVYPF  373
            ESP+++  GMEGS LGVW A GEGRA+FPD +         LAPVR   D   PTE YPF
Sbjct  2    ESPSVLLAGMEGSSLGVWVAHGEGRAHFPDPASRKSAVDGGLAPVRFVDDSNSPTEAYPF  61

Query  372  NXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWDVXKKGPXPWLRMFXXAX  193
            N NGSP G   +CS +GR    MP PERCFL  Q+P+ P  W        PWL+MF  A 
Sbjct  62   NPNGSPDGIAGLCSEDGRHLAVMPHPERCFLKWQWPYMPIEWRDTLTA-SPWLKMFQNAR  120

Query  192  EW  187
            +W
Sbjct  121  QW  122



>ref|XP_002422737.1| Phosphoribosylformylglycinamidine synthase, putative [Pediculus 
humanus corporis]
 gb|EEB09999.1| Phosphoribosylformylglycinamidine synthase, putative [Pediculus 
humanus corporis]
Length=1316

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC FTSV   ESPAIM KGM GS  GVW A GEGR    +  + N++      
Sbjct  1174  HNLSERFECRFTSVKFMESPAIMLKGMAGSVFGVWVAHGEGRFTMKNEKVFNELLRKNAL  1233

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D G+PTEVYP N NGS LG   ICS +GR    MP PERC  + Q+P  P  + 
Sbjct  1234  AIRYVDDNGEPTEVYPMNPNGSKLGVAGICSLDGRHLAMMPHPERCTQLWQWPVLPNEF-  1292

Query  243   VXKKGPXPWLRMFXXAXEW  187
                    PWLR+F  A  W
Sbjct  1293  -KNLTASPWLRIFQNAFAW  1310



>ref|XP_011144014.1| PREDICTED: phosphoribosylformylglycinamidine synthase, partial 
[Harpegnathos saltator]
Length=1139

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +++V I+ SPAIM K MEGS LG+W A GEGR  F +  IL  +  +   
Sbjct  999   HNLSERFECRWSTVKIESSPAIMLKAMEGSVLGIWIAHGEGRFTFRNKKILKSLERNNCL  1058

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             P+R   D G PT  YP N NGS  G  A+CS +GR    MP PERC  M Q+PW P  W+
Sbjct  1059  PLRYTDDCGHPTTCYPMNPNGSINGIAAVCSKDGRHLAMMPHPERCTRMWQWPWKPSEWN  1118

Query  243   VXKKGPXPWLRMFXXAXEW  187
                    PW R+F  A  W
Sbjct  1119  FE---VSPWQRLFDNAFTW  1134



>ref|XP_002901032.1| phosphoribosylformylglycinamidine synthase [Phytophthora infestans 
T30-4]
 gb|EEY59422.1| phosphoribosylformylglycinamidine synthase [Phytophthora infestans 
T30-4]
Length=1332

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 84/146 (58%), Gaps = 4/146 (3%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             SQPR  HNES R E  F SV IQES A+M +GM GS LGVW + GEGRA+F    I    
Sbjct  1186  SQPRFVHNESGRHESRFVSVQIQESNAVMLRGMAGSSLGVWVSHGEGRAHFTHPKIQKTY  1245

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S  A +R   D   PTE YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  1246  VASGAAAIRYVDDSNVPTEEYPFNPNGSPQGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  1305

Query  261   YPKXWDVXKKGP-XPWLRMFXXAXEW  187
              P  +   K  P  PW+++F  A  +
Sbjct  1306  MPAEF---KAHPVSPWMQIFQNAKSF  1328



>gb|ETM46329.1| phosphoribosylformylglycinamidine synthase [Phytophthora parasitica]
Length=1365

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 84/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             +QPR  HNES R E  F SV IQES A+M +GM GS LGVW + GEGRA+F    I  + 
Sbjct  1219  AQPRFVHNESGRHESRFVSVQIQESNAVMLRGMAGSSLGVWVSHGEGRAHFTHPKIQEKY  1278

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S  A +R   D   PTE YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  1279  VASGAAAIRYVDDSNVPTEEYPFNPNGSPQGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  1338

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P  ++       PW+++F  A  +
Sbjct  1339  MPAEFEAHP--VSPWMQIFQNAKSF  1361



>gb|ETP44396.1| phosphoribosylformylglycinamidine synthase [Phytophthora parasitica 
P10297]
Length=1365

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 84/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             +QPR  HNES R E  F SV IQES A+M +GM GS LGVW + GEGRA+F    I  + 
Sbjct  1219  AQPRFVHNESGRHESRFVSVQIQESNAVMLRGMAGSSLGVWVSHGEGRAHFTHPKIQEKY  1278

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S  A +R   D   PTE YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  1279  VASGAAAIRYVDDSNVPTEEYPFNPNGSPQGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  1338

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P  ++       PW+++F  A  +
Sbjct  1339  MPAEFEAHP--VSPWMQIFQNAKSF  1361



>gb|ETL93031.1| phosphoribosylformylglycinamidine synthase [Phytophthora parasitica]
Length=1365

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 84/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             +QPR  HNES R E  F SV IQES A+M +GM GS LGVW + GEGRA+F    I  + 
Sbjct  1219  AQPRFVHNESGRHESRFVSVQIQESNAVMLRGMAGSSLGVWVSHGEGRAHFTHPKIQEKY  1278

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S  A +R   D   PTE YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  1279  VASGAAAIRYVDDSNVPTEEYPFNPNGSPQGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  1338

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P  ++       PW+++F  A  +
Sbjct  1339  MPAEFEAHP--VSPWMQIFQNAKSF  1361



>gb|ETK86489.1| phosphoribosylformylglycinamidine synthase [Phytophthora parasitica]
 gb|ETL39903.1| phosphoribosylformylglycinamidine synthase [Phytophthora parasitica]
 gb|ETP16352.1| phosphoribosylformylglycinamidine synthase [Phytophthora parasitica 
CJ01A1]
Length=1365

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 84/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             +QPR  HNES R E  F SV IQES A+M +GM GS LGVW + GEGRA+F    I  + 
Sbjct  1219  AQPRFVHNESGRHESRFVSVQIQESNAVMLRGMAGSSLGVWVSHGEGRAHFTHPKIQEKY  1278

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S  A +R   D   PTE YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  1279  VASGAAAIRYVDDSNVPTEEYPFNPNGSPQGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  1338

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P  ++       PW+++F  A  +
Sbjct  1339  MPAEFEAHP--VSPWMQIFQNAKSF  1361



>gb|ELT92693.1| hypothetical protein CAPTEDRAFT_187787 [Capitella teleta]
Length=1229

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 80/141 (57%), Gaps = 1/141 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFE  F++V I  SP+IM  GM GS LGVW A GEG+  F +  IL+ V    L 
Sbjct  1090  HNDSERFESRFSTVRISASPSIMLDGMHGSVLGVWVAHGEGKMVFANDRILDSVQKENLV  1149

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G PTE YP N NGS  G   +CS +GR    MP PERC L  Q+PW P+ + 
Sbjct  1150  CLQYVDDEGHPTETYPLNPNGSRAGIAGVCSQDGRHLALMPHPERCVLPWQWPWQPESFS  1209

Query  243   VXKKGPXPWLRMFXXAXEWXS  181
             +      PW RMF  A  W S
Sbjct  1210  M-DDARSPWFRMFQNAFNWCS  1229



>ref|XP_006623325.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like, partial 
[Apis dorsata]
Length=1322

 Score =   132 bits (332),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 63/139 (45%), Positives = 79/139 (57%), Gaps = 3/139 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC ++++ I +SP+IM  GME S LGVW A GEGR  F +  IL ++  +   
Sbjct  1182  HNISERFECRWSTIKIDKSPSIMLSGMENSILGVWVAHGEGRFTFRNDEILQKLKKNHCL  1241

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G PTE YPFN NGS      ICS +GR    MP PERC  + Q+PW P  W 
Sbjct  1242  AIKYTDDFGNPTEKYPFNPNGSIEAIAGICSMDGRHLALMPHPERCSQIWQWPWKPYDW-  1300

Query  243   VXKKGPXPWLRMFXXAXEW  187
               K    PW R+F  A  W
Sbjct  1301  --KYTISPWQRIFDNAYAW  1317



>ref|XP_005097983.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Aplysia 
californica]
Length=775

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 84/141 (60%), Gaps = 1/141 (1%)
 Frame = -1

Query  603  HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
            HN S RFE  F+++ IQ+SP+IM  GMEG+  G+W + GEGR  F    I  ++  S LA
Sbjct  633  HNTSGRFESRFSTMRIQKSPSIMLDGMEGTVWGMWVSHGEGRMVFSKPEIRTEMEQSNLA  692

Query  423  PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
            PV+   D G PTE YP N NGSP G  A+CSP+GR    MP PERC    Q PW P  + 
Sbjct  693  PVQYVNDAGDPTECYPANPNGSPDGLAALCSPDGRHLAVMPHPERCVWAWQCPWMPPAYR  752

Query  243  VXKKGPXPWLRMFXXAXEWXS  181
              K    PW+RMF  A +W +
Sbjct  753  -EKLKFSPWMRMFQNAYKWCT  772



>ref|XP_006271916.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Alligator 
mississippiensis]
Length=1340

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 80/138 (58%), Gaps = 1/138 (1%)
 Frame = -1

Query  600   NESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAP  421
             NES RFE  F +V++   PA+M +GM GS LGVW A GEGR  F   + L       L P
Sbjct  1195  NESGRFESRFVTVSVGPGPALMLRGMAGSTLGVWVAHGEGRVQFRSPARLAAAAERGLTP  1254

Query  420   VRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWDV  241
             +R   D G+PT+ YP N NGSPLG   ICSP+GR    MP PERC L  Q+PW P  W  
Sbjct  1255  LRYVDDGGQPTQEYPLNPNGSPLGIAGICSPDGRHLAMMPHPERCVLPWQWPWMPPSWR-  1313

Query  240   XKKGPXPWLRMFXXAXEW  187
                   PWLR+F  A +W
Sbjct  1314  RDLHISPWLRLFQNAYDW  1331



>gb|AAI68641.1| Unknown (protein for MGC:186503) [Xenopus (Silurana) tropicalis]
Length=1324

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 82/140 (59%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             +HN S RFE  F ++ IQ+SP+I+ +GM GS LGVW A GEG   F    + + V  + L
Sbjct  1177  SHNLSGRFESRFVTLKIQQSPSILLRGMAGSTLGVWVAHGEGYMRFRSPKVQDYVTSNHL  1236

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+    D GKPTE YP N NGSPLG   +CS +GR    MP PERC +  Q+PW P+ W
Sbjct  1237  APLCYVDDGGKPTEEYPMNPNGSPLGIAGLCSADGRHLAMMPHPERCVMKWQWPWMPESW  1296

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                     PW+R+F     W
Sbjct  1297  R-QSLDVSPWMRLFQNGYRW  1315



>ref|NP_001135692.2| phosphoribosylformylglycinamidine synthase [Xenopus (Silurana) 
tropicalis]
Length=1324

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 82/140 (59%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             +HN S RFE  F ++ IQ+SP+I+ +GM GS LGVW A GEG   F    + + V  + L
Sbjct  1177  SHNLSGRFESRFVTLKIQQSPSILLRGMAGSTLGVWVAHGEGYMRFRSPKVQDYVTSNHL  1236

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+    D GKPTE YP N NGSPLG   +CS +GR    MP PERC +  Q+PW P+ W
Sbjct  1237  APLCYVDDGGKPTEEYPMNPNGSPLGIAGLCSADGRHLAMMPHPERCVMKWQWPWMPESW  1296

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                     PW+R+F     W
Sbjct  1297  R-HSLDVSPWMRLFQNGYRW  1315



>ref|XP_002405859.1| phosphoribosylformylglycinamidine synthase, putative [Ixodes 
scapularis]
 gb|EEC03415.1| phosphoribosylformylglycinamidine synthase, putative [Ixodes 
scapularis]
Length=1311

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 80/139 (58%), Gaps = 0/139 (0%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC FT+V I+  PAIM  GME S LGVW A GEGR  F   ++L+++    L 
Sbjct  1167  HNRSGRFECRFTTVRIEPGPAIMLAGMEDSVLGVWVAHGEGRFEFRHDALLDEMESQRLV  1226

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D G PT  YP N NGSP G  A+CS +GR    MP PERC L  Q+ + P+ W 
Sbjct  1227  GMRYVNDAGAPTIEYPLNPNGSPRGVAALCSRDGRHLAVMPHPERCSLPWQWAYVPQEWK  1286

Query  243   VXKKGPXPWLRMFXXAXEW  187
               K    PW +M+  A  W
Sbjct  1287  RTKFAVSPWAKMYDNAYAW  1305



>ref|XP_002788692.1| Phosphoribosylformylglycinamidine synthase, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER20488.1| Phosphoribosylformylglycinamidine synthase, putative [Perkinsus 
marinus ATCC 50983]
Length=1398

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 85/147 (58%), Gaps = 5/147 (3%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQE-SPAIM--FKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             +PR  HN S R+E  F SVA+   SPA    F+GM GS LGVW A GEGRA FP+  +  
Sbjct  1222  RPRFIHNRSGRYESRFVSVALDAASPATGTWFRGMGGSVLGVWVAHGEGRALFPERDVYT  1281

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             +V  S LAP+R   D G PT VYPFN NGS  G   + +P+GR    MP PERC +  Q+
Sbjct  1282  KVIESHLAPLRYVDDQGAPTSVYPFNPNGSLDGIAGLVTPDGRHLAMMPHPERCSMTWQW  1341

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             PW P+ W   +    PW  MF    EW
Sbjct  1342  PWMPREWKGIRG--SPWATMFRNIVEW  1366



>ref|XP_011311335.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Fopius 
arisanus]
Length=1326

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 85/139 (61%), Gaps = 3/139 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +++V I++SPA+M K MEG+ +GVW A GEG+  F +  IL ++  +   
Sbjct  1187  HNASERFECRWSTVRIEKSPALMLKDMEGTVMGVWVAHGEGKFTFRNNEILRELRENQCL  1246

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             P++   D G+PTE+YPFN NGS  G  AICS +GR    MP PERC  M Q+P+ P  W 
Sbjct  1247  PIKYVDDDGEPTEIYPFNPNGSVEGIAAICSLDGRHLALMPHPERCTEMWQWPYTPPSW-  1305

Query  243   VXKKGPXPWLRMFXXAXEW  187
                    PW ++F  A  W
Sbjct  1306  --TNTTSPWYKIFNNAFMW  1322



>ref|XP_008905954.1| hypothetical protein PPTG_22971 [Phytophthora parasitica INRA-310]
 gb|ETN08767.1| hypothetical protein PPTG_22971 [Phytophthora parasitica INRA-310]
Length=1034

 Score =   131 bits (329),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 64/131 (49%), Positives = 77/131 (59%), Gaps = 0/131 (0%)
 Frame = -1

Query  621  SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
            +QPR  HNES R E  F SV IQES A+M +GM GS LGVW + GEGRA+F    I  + 
Sbjct  745  AQPRFVHNESGRHESRFVSVQIQESNAVMLRGMAGSSLGVWVSHGEGRAHFTHPKIQEKY  804

Query  441  PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
              S  A +R   D   PTE YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  805  VASGAAAIRYVDDSNVPTEEYPFNPNGSPQGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  864

Query  261  YPKXWDVXKKG  229
             P  ++    G
Sbjct  865  MPAEFEAHPVG  875



>ref|XP_009047509.1| hypothetical protein LOTGIDRAFT_172386 [Lottia gigantea]
 gb|ESP01829.1| hypothetical protein LOTGIDRAFT_172386 [Lottia gigantea]
Length=1250

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 81/139 (58%), Gaps = 1/139 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S R+E  + +V IQ++ ++M K MEG+  G+W + GEG+  F    +  Q+    LA
Sbjct  1107  HNTSERYESRYVTVKIQDNNSVMLKDMEGTMFGMWVSHGEGKMCFKTPELHQQILSKNLA  1166

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             PVR   D G+ T++YPFN NGSP    A+CS NGR    MP PERCFL  Q PW P    
Sbjct  1167  PVRYIDDDGQNTQIYPFNPNGSPDAIAAVCSENGRHLAIMPHPERCFLSWQCPWMPSVMK  1226

Query  243   VXKKGPXPWLRMFXXAXEW  187
               K    PW+RMF  A +W
Sbjct  1227  -EKLVFTPWIRMFQNAYDW  1244



>ref|XP_005827926.1| hypothetical protein GUITHDRAFT_159919 [Guillardia theta CCMP2712]
 gb|EKX40946.1| hypothetical protein GUITHDRAFT_159919 [Guillardia theta CCMP2712]
Length=1324

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 83/143 (58%), Gaps = 0/143 (0%)
 Frame = -1

Query  615   PRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPX  436
             PR  HN+S RFE  + +V I++S  + FK MEGS LG+W+A GEGR  FP+    +QV  
Sbjct  1178  PRLEHNKSARFESRWINVKIEKSKCMWFKDMEGSLLGIWSAHGEGRFSFPNEQHYHQVEN  1237

Query  435   SXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYP  256
                  +R   D G PTE YPFN NGSP G   +C+ +GR    MP PERC L  Q PW P
Sbjct  1238  DGQVALRFVDDDGLPTERYPFNPNGSPGGIAGLCTKDGRHLAMMPHPERCVLKWQIPWMP  1297

Query  255   KXWDVXKKGPXPWLRMFXXAXEW  187
             + W        PWL+MF  A ++
Sbjct  1298  RDWQPTGPQAAPWLQMFINARKF  1320



>ref|XP_003399743.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Bombus 
terrestris]
Length=1325

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 83/149 (56%), Gaps = 5/149 (3%)
 Frame = -1

Query  627   DPSQPRX--THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSI  454
             D  QP    +HN S RFEC +++V I +SP+IM  GME S LGVW A GEGR  F +  +
Sbjct  1175  DIKQPDIFLSHNVSERFECRWSTVRIDKSPSIMLSGMENSVLGVWVAHGEGRFTFRNNEV  1234

Query  453   LNQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMX  274
             L ++  S    ++   D G PTE YP N NGS  G   ICS NGR    MP PERC  + 
Sbjct  1235  LKKLKESHCLAIKYTDDYGNPTERYPLNPNGSTEGIAGICSENGRHLAMMPHPERCSQIW  1294

Query  273   QFPWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             Q+PW P  W+       PW R+F  A  W
Sbjct  1295  QWPWKPSNWEYT---ISPWQRIFDNAYAW  1320



>gb|ETO75251.1| phosphoribosylformylglycinamidine synthase [Phytophthora parasitica 
P1976]
Length=1365

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 84/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             +QPR  HNES R E  F SV IQES A+M +GM GS LGVW + GEGRA+F    I  + 
Sbjct  1219  AQPRFVHNESGRHESRFVSVQIQESNAVMLRGMAGSSLGVWVSHGEGRAHFTHPKIQEKY  1278

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S  A +R   D   P+E YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  1279  VASGAAAIRYVDDSNVPSEEYPFNPNGSPQGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  1338

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P  ++       PW+++F  A  +
Sbjct  1339  MPAEFEAHP--VSPWMQIFQNAKSF  1361



>gb|ETI46549.1| phosphoribosylformylglycinamidine synthase [Phytophthora parasitica 
P1569]
Length=1365

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 84/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             +QPR  HNES R E  F SV IQES A+M +GM GS LGVW + GEGRA+F    I  + 
Sbjct  1219  AQPRFVHNESGRHESRFVSVQIQESNAVMLRGMAGSSLGVWVSHGEGRAHFTHPKIQEKY  1278

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S  A +R   D   P+E YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  1279  VASGAAAIRYVDDSNVPSEEYPFNPNGSPQGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  1338

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P  ++       PW+++F  A  +
Sbjct  1339  MPAEFEAHP--VSPWMQIFQNAKSF  1361



>ref|NP_001038667.1| phosphoribosylformylglycinamidine synthase [Danio rerio]
Length=1314

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 80/145 (55%), Gaps = 1/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S    THN+S RFE  F SV I  SPAIM KGMEGS LGVW A GEG   F       ++
Sbjct  1167  SDVTLTHNKSGRFESRFVSVGILPSPAIMLKGMEGSALGVWVAHGEGLMQFRSPEAQQKL  1226

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S LAP+R   D G PTE+YP N NGS  G   ICS +GR    MP PER  L  Q+ W
Sbjct  1227  IGSSLAPLRYVDDSGNPTEIYPINPNGSAQGVAGICSADGRHLAMMPHPERAVLSWQWAW  1286

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P+      + P PWL MF  A  W
Sbjct  1287  APQHLRGSLE-PSPWLSMFRNAAAW  1310



>ref|XP_003493767.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Bombus 
impatiens]
Length=1325

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 80/140 (57%), Gaps = 3/140 (2%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             +HN S RFEC +++V I +SP+IM  GME S LGVW A GEGR  F +  +L ++  S  
Sbjct  1184  SHNVSERFECRWSTVRIDKSPSIMLNGMENSVLGVWVAHGEGRFTFRNNEVLQKLKESHC  1243

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
               ++   D G PTE YP N NGS  G   ICS NGR    MP PERC  + Q+PW P  W
Sbjct  1244  LAIKYTDDYGNPTERYPLNPNGSTEGIAGICSANGRHLAMMPHPERCSQIWQWPWKPSNW  1303

Query  246   DVXKKGPXPWLRMFXXAXEW  187
             +       PW R+F  A  W
Sbjct  1304  EYT---ISPWQRIFDNAYTW  1320



>ref|XP_003704098.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Megachile 
rotundata]
Length=1325

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 80/141 (57%), Gaps = 3/141 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +++V I +SP+IM  GME S LGVW A GEGR  F +   L ++  +   
Sbjct  1185  HNISERFECRWSTVKINKSPSIMLNGMENSVLGVWVAHGEGRFTFRNNEALKKLKDNHCV  1244

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G PTE YP N NGS  G  AICS +GR    MP PERC  M Q+PW P  W 
Sbjct  1245  AIKYTDDYGNPTERYPLNPNGSTEGIAAICSADGRHLAMMPHPERCTQMWQWPWKPVNW-  1303

Query  243   VXKKGPXPWLRMFXXAXEWXS  181
               K    PW R+F  A  W S
Sbjct  1304  --KYKISPWQRIFDNAYAWCS  1322



>ref|WP_015403497.1| phosphoribosylformylglycinamidine synthase, single chain form 
[Desulfocapsa sulfexigens]
 gb|AGF77805.1| phosphoribosylformylglycinamidine synthase, single chain form 
[Desulfocapsa sulfexigens DSM 10523]
Length=1267

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 84/144 (58%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN S RFE  +++V +++SPA+M KGMEG   G+    GEG   FPD ++  +V 
Sbjct  1123  QPRFIHNLSGRFESRWSTVKVEKSPALMLKGMEGLVFGIHVDHGEGHLTFPDSAVKERVL  1182

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                LAP+    D G  TE YPFN NGSP G   +CSP+GR    MP PER FL  Q  + 
Sbjct  1183  AENLAPICYVDDDGNATESYPFNPNGSPGGLAGLCSPDGRHLAMMPHPERVFLAWQAHYL  1242

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+  D+      PW++MF  A EW
Sbjct  1243  PE--DMKGLKVTPWMQMFRNAYEW  1264



>ref|XP_001605732.2| PREDICTED: phosphoribosylformylglycinamidine synthase [Nasonia 
vitripennis]
 ref|XP_008206390.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Nasonia 
vitripennis]
Length=1324

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 79/139 (57%), Gaps = 3/139 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC +++V I++SPAIM +GMEGS  GVW A GEG+  F +  +L ++      
Sbjct  1184  HNDSERFECRWSTVKIEKSPAIMLQGMEGSVFGVWVAHGEGKFTFRNKDVLAKLKQQNCL  1243

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G PTE YP N NGS  G   +CS +GR    MP PERC    Q PW P  W 
Sbjct  1244  AIKYTDDNGVPTEKYPMNPNGSIEGIAGVCSADGRHLAMMPHPERCTQAWQLPWVPADW-  1302

Query  243   VXKKGPXPWLRMFXXAXEW  187
               +    PW R+F  A  W
Sbjct  1303  --QHKATPWQRIFQNAYAW  1319



>ref|XP_009527762.1| hypothetical protein PHYSODRAFT_544320 [Phytophthora sojae]
 gb|EGZ18704.1| hypothetical protein PHYSODRAFT_544320 [Phytophthora sojae]
Length=1333

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 83/145 (57%), Gaps = 2/145 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             +QPR  HNES R E  F SV IQES +IM +GM GS LGVW + GEGRA+F    I  + 
Sbjct  1187  AQPRFVHNESGRHESRFVSVQIQESNSIMLRGMAGSSLGVWVSHGEGRAHFTHPKIQEKY  1246

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
               S  A +R   D   PT  YPFN NGSP G   + S +GR    MP PERCFL  Q+P+
Sbjct  1247  VSSGAAAIRYVDDSNVPTTEYPFNPNGSPEGIAGLVSSDGRHMCLMPHPERCFLKYQWPY  1306

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEW  187
              P  ++       PW+++F  A  +
Sbjct  1307  MPAEFEAHP--VSPWMQIFQNAKTF  1329



>ref|XP_008870446.1| phosphoribosylformylglycinamidine synthase [Aphanomyces invadans]
 gb|ETW01448.1| phosphoribosylformylglycinamidine synthase [Aphanomyces invadans]
Length=1357

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 82/144 (57%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
              PR   N   ++ C F +V IQES A++ KGM GS LGVW A GEGRAYFPD  +L  V 
Sbjct  1211  NPRFIDNACEKYVCNFVTVQIQESNAVLLKGMAGSSLGVWVAHGEGRAYFPDPRLLQNVL  1270

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
              + LAPVR   D  + TE YPF+ NGSP G   + S +GR    MP PER  L  Q+P+ 
Sbjct  1271  DNQLAPVRYVNDANEVTEAYPFSPNGSPHGIAGLVSDDGRHFCMMPHPERTSLKFQWPYK  1330

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
              K   +      PWL+MF  A  +
Sbjct  1331  TKA--IQDAKVSPWLQMFQNAKTF  1352



>ref|XP_006038090.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Alligator 
sinensis]
Length=1244

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 79/138 (57%), Gaps = 1/138 (1%)
 Frame = -1

Query  600   NESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAP  421
             NES RFE  F +V++   PA+M +GM GS LGVW A GEGR  F   + L       L P
Sbjct  1099  NESGRFESRFVTVSVGPGPALMLRGMAGSTLGVWVAHGEGRVQFRSPARLAAAAERGLTP  1158

Query  420   VRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWDV  241
             +R   D G+PT+ YP N NGSPLG   I SP+GR    MP PERC L  Q+PW P  W  
Sbjct  1159  LRYVDDGGQPTQEYPLNPNGSPLGVAGISSPDGRHLAMMPHPERCVLPWQWPWMPPSWR-  1217

Query  240   XKKGPXPWLRMFXXAXEW  187
                   PWLR+F  A +W
Sbjct  1218  RDLHISPWLRLFQNAHDW  1235



>ref|XP_010870190.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Esox lucius]
Length=1318

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 79/140 (56%), Gaps = 0/140 (0%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             THN+S RFE  F SV IQ S ++  +GM+GS LGVW A GEG   F       ++  S L
Sbjct  1175  THNQSGRFESRFVSVGIQASSSVWLQGMDGSALGVWVAHGEGLVQFRSPQARQRIISSGL  1234

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
             AP+R   D G PTEVYP N NGSP G   + S +GR    MP PERC +  Q+PW P  +
Sbjct  1235  APLRYLDDTGTPTEVYPQNPNGSPEGLAGLSSRDGRHLAMMPHPERCTMGWQWPWAPPEF  1294

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                     PWLRMF  A  W
Sbjct  1295  RSSLGTTSPWLRMFTNAVAW  1314



>ref|XP_011156619.1| PREDICTED: phosphoribosylformylglycinamidine synthase isoform 
X1 [Solenopsis invicta]
 ref|XP_011156620.1| PREDICTED: phosphoribosylformylglycinamidine synthase isoform 
X1 [Solenopsis invicta]
Length=1342

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 79/139 (57%), Gaps = 4/139 (3%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +T+V I+ SP+IM KGM+ S LGVW A GEGR  F +  +L  +  +   
Sbjct  1203  HNLSERFECRWTTVKIENSPSIMLKGMQNSVLGVWVAHGEGRFTFRE-EVLKTLERNKCL  1261

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             P+R   D   PTE YP N NGS  G   ICS NGR    MP PERC  + Q+PW P  W+
Sbjct  1262  PIRYTDDHANPTERYPMNPNGSVNGIAGICSKNGRHLAMMPHPERCTRIWQWPWKPVGWN  1321

Query  243   VXKKGPXPWLRMFXXAXEW  187
                    PW R+F  A  W
Sbjct  1322  YE---ASPWQRLFDNAYTW  1337



>ref|XP_008275697.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Stegastes 
partitus]
Length=1318

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 83/147 (56%), Gaps = 1/147 (1%)
 Frame = -1

Query  621   SQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQV  442
             S+   THN+S RFE  F SV IQ+SP++  +GM+GS LGVW A GEG   F      + +
Sbjct  1170  SEVVLTHNKSGRFESRFVSVGIQDSPSVWLRGMQGSALGVWVAHGEGLMQFRSSQAQDLI  1229

Query  441   PXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW  262
                  AP+R   D G+PTE YP N NGSP G   +CS +GR    MP PER  L  Q+PW
Sbjct  1230  ISRGFAPLRYLDDQGRPTEQYPLNPNGSPQGVAGLCSRDGRHLAMMPHPERSTLGWQWPW  1289

Query  261   YPKXWDVXKKGPXPWLRMFXXAXEWXS  181
              P+ +      P PWL MF  A  W S
Sbjct  1290  APRDFR-PSLTPSPWLGMFRNAAAWCS  1315



>ref|XP_011156621.1| PREDICTED: phosphoribosylformylglycinamidine synthase isoform 
X2 [Solenopsis invicta]
Length=1324

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 79/139 (57%), Gaps = 4/139 (3%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +T+V I+ SP+IM KGM+ S LGVW A GEGR  F +  +L  +  +   
Sbjct  1185  HNLSERFECRWTTVKIENSPSIMLKGMQNSVLGVWVAHGEGRFTFRE-EVLKTLERNKCL  1243

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             P+R   D   PTE YP N NGS  G   ICS NGR    MP PERC  + Q+PW P  W+
Sbjct  1244  PIRYTDDHANPTERYPMNPNGSVNGIAGICSKNGRHLAMMPHPERCTRIWQWPWKPVGWN  1303

Query  243   VXKKGPXPWLRMFXXAXEW  187
                    PW R+F  A  W
Sbjct  1304  YE---ASPWQRLFDNAYTW  1319



>dbj|GAM20022.1| hypothetical protein SAMD00019534_031970, partial [Acytostelium 
subglobosum LB1]
Length=1341

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 82/144 (57%), Gaps = 3/144 (2%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN S RFE  + ++ I +S AIM  GMEGS LG W+  GEG AYFPD SIL+ V 
Sbjct  1192  QPRFIHNASGRFESRWLTLTIGKSNAIMLAGMEGSVLGCWSQHGEGLAYFPDTSILDDVN  1251

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
              + LAP+R   D G+ + VYP+N NGS  G  ++ S +GR    MP PER      +PW 
Sbjct  1252  ANNLAPIRYANDQGEVSTVYPYNPNGSTDGIASLVSRDGRHLAMMPHPERSLNAWNWPWM  1311

Query  258   PKXWDVXKKG---PXPWLRMFXXA  196
                      G   P PWLRMF  A
Sbjct  1312  SDNITNAIGGPSQPSPWLRMFQNA  1335



>ref|XP_011500809.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Ceratosolen 
solmsi marchali]
Length=1327

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 80/141 (57%), Gaps = 3/141 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
              N+S RFEC +++V I++SPAIM +GMEG+  GVW A  EG+  F +  +L ++      
Sbjct  1187  ENDSERFECRWSTVVIEKSPAIMLQGMEGNVFGVWVAHKEGKFTFRNDKVLAKLKEQNCI  1246

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             P++   D G PT  YP N NGS  G  AICS +GR    MP PERC    Q PW P  W 
Sbjct  1247  PIKYVDDKGAPTTSYPLNPNGSIDGIAAICSSDGRHLAMMPHPERCTQTWQMPWVPANW-  1305

Query  243   VXKKGPXPWLRMFXXAXEWXS  181
               K    PW+++F  A  W S
Sbjct  1306  --KYKSSPWIKLFQNAYVWCS  1324



>ref|XP_009841639.1| phosphoribosylformylglycinamidine synthase [Aphanomyces astaci]
 gb|ETV68962.1| phosphoribosylformylglycinamidine synthase [Aphanomyces astaci]
Length=1354

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 82/144 (57%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
              PR   N   ++ C F +V IQES A+M KGM GS LGVW A GEGRAYF D  +L  V 
Sbjct  1206  NPRFIDNACEKYVCNFVTVQIQESNAVMLKGMAGSSLGVWVAHGEGRAYFSDPRLLQDVL  1265

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
              + LAPVR   D  + TE YPF+ NGSP G   + S +GR    MP PER  L  Q+P+ 
Sbjct  1266  DNKLAPVRYVNDANEVTEAYPFSPNGSPHGIAGLVSDDGRHFCLMPHPERTSLKFQWPYK  1325

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
              K   + +    PWL++F  A  +
Sbjct  1326  TKA--IQEAKVSPWLQLFQNAKTF  1347



>dbj|BAD93902.1| putative phosphoribosylformylglycinamidine synthase [Arabidopsis 
thaliana]
Length=89

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  435  SXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYP  256
            S LAP+R   D G  TE YPFN NGSPLG  AICSP+GR    MP PERCFLM QFPWYP
Sbjct  3    SDLAPLRYCDDDGNVTEAYPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQFPWYP  62

Query  255  KXWDVXKKGPXPWLRMFXXAXEW  187
              WDV K GP PWL+MF  A +W
Sbjct  63   TSWDVEKAGPSPWLKMFQNARDW  85



>ref|XP_011069258.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Acromyrmex 
echinatior]
 ref|XP_011069259.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Acromyrmex 
echinatior]
 gb|EGI68877.1| Phosphoribosylformylglycinamidine synthase [Acromyrmex echinatior]
Length=1326

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 77/139 (55%), Gaps = 4/139 (3%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +T+V I+ SP+IM K M+ S LGVW A GEGR  F    +L  +  +   
Sbjct  1187  HNLSERFECRWTTVRIENSPSIMLKDMQDSVLGVWVAHGEGRFTFRK-EVLKTLEQNNCV  1245

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D G PTE YP N NGS  G   ICS NGR    MP PERC  M Q+PW P  W+
Sbjct  1246  AIRYTDDYGNPTECYPMNPNGSVNGIAGICSKNGRHLAMMPHPERCTQMWQWPWKPAEWN  1305

Query  243   VXKKGPXPWLRMFXXAXEW  187
                    PW R+F  A  W
Sbjct  1306  YE---ASPWQRLFDNAYMW  1321



>ref|XP_011395662.1| putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM22797.1| putative phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial 
[Auxenochlorella protothecoides]
Length=1410

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = -1

Query  579   CXFTSVAIQ-ESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAPVRXXXD  403
             C ++SVAI  ++PA+M +GM G+ LGVW A GEG+A FPD ++   V    LAP+R    
Sbjct  1272  CRWSSVAIDPDTPAVMLRGMGGARLGVWVAHGEGQALFPDEAVRRDVLDRHLAPIRYVDA  1331

Query  402   XGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWDVXKKGPX  223
              G+ T+ YP+N NGS     A+CSP GR    MP PERC  M Q PW+P    +    P 
Sbjct  1332  VGRETQEYPYNPNGSSDAVAALCSPCGRHLALMPHPERCLQMWQNPWWPAETGLKPTDPS  1391

Query  222   PWLRMFXXAXEWXS  181
             PWL++F  A EW +
Sbjct  1392  PWLKLFQNAAEWAA  1405



>ref|XP_005704110.1| phosphoribosylformylglycinamidine synthase isoform 1 [Galdieria 
sulphuraria]
 gb|EME27590.1| phosphoribosylformylglycinamidine synthase isoform 1 [Galdieria 
sulphuraria]
Length=1437

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 83/147 (56%), Gaps = 3/147 (2%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQ     N+S RFE  F+SV I  S +IM +GME S LG+W A GEG+  F   S   
Sbjct  1285  DSSQALFIQNKSGRFESRFSSVKILPSVSIMLRGMEDSVLGIWCAHGEGQTVFTSESYYE  1344

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             QV    LAP+R   D G PTE YP+N NGS  G  A+CS NGR    MP PER     Q+
Sbjct  1345  QVVKLGLAPIRYVDDEGIPTEDYPWNPNGSRQGIAALCSMNGRHLALMPHPERVVFPWQW  1404

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
              +YP+ +    +   PW+RMF  A EW
Sbjct  1405  SYYPETF---PQDTSPWIRMFQNAREW  1428



>ref|XP_005704111.1| phosphoribosylformylglycinamidine synthase isoform 2 [Galdieria 
sulphuraria]
 gb|EME27591.1| phosphoribosylformylglycinamidine synthase isoform 2 [Galdieria 
sulphuraria]
Length=1439

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 83/147 (56%), Gaps = 3/147 (2%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             D SQ     N+S RFE  F+SV I  S +IM +GME S LG+W A GEG+  F   S   
Sbjct  1287  DSSQALFIQNKSGRFESRFSSVKILPSVSIMLRGMEDSVLGIWCAHGEGQTVFTSESYYE  1346

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
             QV    LAP+R   D G PTE YP+N NGS  G  A+CS NGR    MP PER     Q+
Sbjct  1347  QVVKLGLAPIRYVDDEGIPTEDYPWNPNGSRQGIAALCSMNGRHLALMPHPERVVFPWQW  1406

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
              +YP+ +    +   PW+RMF  A EW
Sbjct  1407  SYYPETF---PQDTSPWIRMFQNAREW  1430



>gb|EFA11871.1| hypothetical protein TcasGA2_TC005250 [Tribolium castaneum]
Length=246

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  603  HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
            HN S RFEC ++++ I++SPAIM K M  S  GVW+A GEG+  F + S+ + +  +   
Sbjct  107  HNVSERFECRWSTIRIEKSPAIMLKDMHQSVFGVWSAHGEGQFTFKNSSVYDDLVKNHCV  166

Query  423  PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
             +R   D G PTE YP N NGS  G   ICS  GR    MP PERC     +P+ P  W 
Sbjct  167  CLRFTDDEGNPTETYPMNPNGSIAGTAGICSKGGRHLAMMPHPERCDQSYLWPYMPPSWQ  226

Query  243  VXKKGPXPWLRMFXXAXEW  187
              +K   PW +MF  A EW
Sbjct  227  HFQKS--PWEKMFRNAYEW  243



>ref|XP_008546689.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Microplitis 
demolitor]
 gb|EZA46216.1| phosphoribosylformylglycinamidine synthase [Microplitis demolitor]
Length=1310

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 80/143 (56%), Gaps = 3/143 (2%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC ++SV I++S AIM KGM+ + +GVW A GEG+  F    +L  +      
Sbjct  1171  HNNSERFECRWSSVRIEKSKAIMLKGMDQTVMGVWVAHGEGKFTFRTAHVLETLIREGCV  1230

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D G+ TE YP N NGS  G   +CS +GR    MP PERC  M Q+P+ P  W 
Sbjct  1231  AIRYADDAGQATESYPMNPNGSIGGVAGVCSTDGRHLAMMPHPERCTQMWQWPYVPAGW-  1289

Query  243   VXKKGPXPWLRMFXXAXEWXSXD  175
                    PWLR+F  A +W S +
Sbjct  1290  --SNKTSPWLRIFQNAFDWCSDN  1310



>gb|ERG82296.1| putative phosphoribosylformylglycinamidine synthase [Ascaris 
suum]
Length=1331

 Score =   125 bits (314),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 57/140 (41%), Positives = 81/140 (58%), Gaps = 2/140 (1%)
 Frame = -1

Query  600   NESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAP  421
             N+  R++  F++V I  SP+IM  GME S LGVW A GEG+  +    IL+++  + L P
Sbjct  1185  NDCGRYQSCFSTVVINRSPSIMLAGMEDSVLGVWCAHGEGKFCYRHDEILDELEANQLVP  1244

Query  420   VRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW--  247
             ++     GKP+ ++P N NGS     A+CS +GR    MP PER F+  Q+P YPK W  
Sbjct  1245  IQYCNGAGKPSMIFPENPNGSARSVAALCSMDGRHLGMMPHPERSFVTWQWPNYPKRWKS  1304

Query  246   DVXKKGPXPWLRMFXXAXEW  187
              +      PW+RMF  A +W
Sbjct  1305  SIHNNNNSPWMRMFINAYKW  1324



>gb|KFM75369.1| Phosphoribosylformylglycinamidine synthase, partial [Stegodyphus 
mimosarum]
Length=1314

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 79/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             + N S RFE  F +V I +SPA+MFK ME S LGVW A GEG+  F +  IL +V    L
Sbjct  1171  SRNLSERFESRFVTVKIIKSPALMFKDMENSILGVWIAHGEGQFEFKNSQILQKVQSQNL  1230

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXW  247
              P+    D G PT  YPFN NGS  G  +ICS +GR    MP PERC L  Q+ W P+  
Sbjct  1231  TPLLYVDDTGSPTTEYPFNPNGSVGGIASICSADGRHLAMMPHPERCVLPWQWAWIPEHL  1290

Query  246   DVXKKGPXPWLRMFXXAXEW  187
                     PWL+MF  A +W
Sbjct  1291  K-STMTVSPWLKMFTNAYDW  1309



>emb|CDP12877.1| unnamed protein product [Coffea canephora]
Length=1410

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             DPSQPR  HNES RFEC FTSV I+ESPAIMFKGMEGS LGVWAA GEGRA+FPD  + N
Sbjct  1267  DPSQPRFIHNESGRFECRFTSVRIEESPAIMFKGMEGSTLGVWAAHGEGRAFFPDEGVWN  1326

Query  447   QVPXSXLAPVRXXXDXGKPTEVY  379
              V  S LAPVR   D GKPTEV+
Sbjct  1327  SVLNSKLAPVRYCDDDGKPTEVW  1349



>emb|CBK22815.2| unnamed protein product [Blastocystis hominis]
Length=1440

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 82/147 (56%), Gaps = 3/147 (2%)
 Frame = -1

Query  627   DPSQPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILN  448
             +  QPR   N+S RFE  F +V +++S A+M +GMEGS LGVW   GEGR ++PD  +  
Sbjct  1289  ETKQPRFLQNKSGRFESRFVNVRVEKSNAVMLQGMEGSTLGVWVCHGEGRCFWPDEEVRK  1348

Query  447   QVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQF  268
                      +R   D G+PT  YP N NGS      + SP+GR    MP PER F+  Q+
Sbjct  1349  AAFEQNCVALRYVDDDGQPTMEYPMNPNGSEYSVVGLTSPDGRHLCMMPHPERVFMKFQW  1408

Query  267   PWYPKXWDVXKKGPXPWLRMFXXAXEW  187
             P++P+ W        PWL+MF  A EW
Sbjct  1409  PYWPEKW---TNPVSPWLKMFQNAREW  1432



>ref|XP_008615067.1| phosphoribosylformylglycinamidine synthase [Saprolegnia diclina 
VS20]
 gb|EQC31668.1| phosphoribosylformylglycinamidine synthase [Saprolegnia diclina 
VS20]
Length=1354

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
              PR   N   ++ C F SV IQES AIM KGM GS LGVW A GEGRA+FP   +L  V 
Sbjct  1208  NPRFIDNACEKYVCNFVSVQIQESNAIMLKGMAGSSLGVWVAHGEGRAHFPHPRLLEDVL  1267

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                LAP+R   D  + T  YPF  NGSP G   + S +GR    MP PER FL  Q+P+ 
Sbjct  1268  DKKLAPIRYVNDANEITSEYPFCPNGSPEGIAGLSSADGRHFCMMPHPERAFLKFQWPY-  1326

Query  258   PKXWDVXKKGPXPWLRMFXXA  196
              K  ++      PWL+MF  A
Sbjct  1327  -KTPEIEHAKVSPWLQMFQNA  1346



>gb|ADW16679.1| phosphoribosylformylglycinamidine synthase [Desulfobulbus propionicus 
DSM 2032]
Length=1266

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 81/144 (56%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN+S RFE  +T+V +  S AIM +GME    G+    GEG  +FPD +I  QV 
Sbjct  1122  QPRFIHNQSGRFESRWTTVKVLPSKAIMLQGMEELVFGIHVDHGEGYLHFPDEAIRQQVW  1181

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                +A V    D G+ TE YPFN NGSP G   ICSP+GR    MP PER FL  Q  W 
Sbjct  1182  NEGMAAVVFVDDQGQATETYPFNPNGSPGGLTGICSPDGRHLAMMPHPERAFLPWQCHWL  1241

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+  ++      PWLRMF  A  W
Sbjct  1242  PE--EMKNLPVSPWLRMFQNAYAW  1263



>ref|WP_043769564.1| phosphoribosylformylglycinamidine synthase [Desulfobulbus propionicus]
Length=1269

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 81/144 (56%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN+S RFE  +T+V +  S AIM +GME    G+    GEG  +FPD +I  QV 
Sbjct  1125  QPRFIHNQSGRFESRWTTVKVLPSKAIMLQGMEELVFGIHVDHGEGYLHFPDEAIRQQVW  1184

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                +A V    D G+ TE YPFN NGSP G   ICSP+GR    MP PER FL  Q  W 
Sbjct  1185  NEGMAAVVFVDDQGQATETYPFNPNGSPGGLTGICSPDGRHLAMMPHPERAFLPWQCHWL  1244

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+  ++      PWLRMF  A  W
Sbjct  1245  PE--EMKNLPVSPWLRMFQNAYAW  1266



>ref|XP_002051449.1| GJ12184 [Drosophila virilis]
 gb|EDW63604.1| GJ12184 [Drosophila virilis]
Length=1360

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +++V I  S AIM   M    LG W A GEGR  F    +LNQ+    L 
Sbjct  1216  HNRSKRFECRWSTVRIPPSRAIMLSNMHDLVLGCWVAHGEGRFAFQREELLNQLHDEHLV  1275

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G PTE+YP N NGSP G   ICSP+GR    MP PERC  M Q+P+ P  ++
Sbjct  1276  TLQYVDDEGAPTELYPMNPNGSPRGIAGICSPDGRHLALMPHPERCSAMYQWPYVPHDFN  1335

Query  243   V-XKKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A +W
Sbjct  1336  VPATQVESPWQLMFNNAYKW  1355



>ref|WP_028317064.1| phosphoribosylformylglycinamidine synthase [Desulfobulbus elongatus]
Length=1265

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 79/144 (55%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN S RFE  + +V +  S AIM +GME    G+    GEG  +FPD +I ++V 
Sbjct  1121  QPRFIHNASGRFESRWVTVKVLPSKAIMLQGMEDLVFGIHVDHGEGFLHFPDAAIRDRVW  1180

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                +A V    D G+PTE YPFN NGSP G   ICSP+GR    MP PER FL  Q  W 
Sbjct  1181  NEQMAAVVFVDDEGQPTEAYPFNPNGSPGGLTGICSPDGRHLAMMPHPERAFLPWQCHWL  1240

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P+          PWLRMF  A  W
Sbjct  1241  PEAMQAMP--VSPWLRMFQNAYRW  1262



>ref|XP_008482177.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Diaphorina 
citri]
Length=1687

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 82/144 (57%), Gaps = 8/144 (6%)
 Frame = -1

Query  606   THNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXL  427
             +HN S RFEC +++V I +SPAIM + +E S LGVW A GEGR  F +  I + +  S  
Sbjct  1538  SHNNSERFECRYSTVKIMKSPAIMLRNLESSVLGVWIAHGEGRFAFKNHGIYDHLDRSQC  1597

Query  426   APVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ--FPWYPK  253
              P+R   D  K TE YP N NGSP G  AICS +GR    MP PERC+   Q  +P YP 
Sbjct  1598  LPIRYVDDNNKITEDYPMNPNGSPGGVAAICSSDGRHLAMMPHPERCYQSWQCPYPSYP-  1656

Query  252   XWDVXKKGP--XPWLRMFXXAXEW  187
                  +  P   PW+ +F  A +W
Sbjct  1657  ---TGQTSPRFTPWVMLFQNAYDW  1677



>gb|KDO20696.1| phosphoribosylformylglycinamidine synthase [Saprolegnia parasitica 
CBS 223.65]
Length=1354

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
              PR   N   ++ C F SV IQES AIM KGM GS LGVW A GEGRA+FP   +L  V 
Sbjct  1208  NPRFIDNACEKYVCNFVSVQIQESNAIMLKGMAGSSLGVWVAHGEGRAHFPHPRLLEDVL  1267

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                LAP+R   D  + T  YPF  NGSP G   + S +GR    MP PER FL  Q+P+ 
Sbjct  1268  DKKLAPIRYVNDHNEITSEYPFCPNGSPEGIAGLASADGRHFCMMPHPERAFLKFQWPY-  1326

Query  258   PKXWDVXKKGPXPWLRMFXXA  196
              +  ++      PWL+MF  A
Sbjct  1327  -QTPEIEHAKVSPWLQMFQNA  1346



>ref|XP_002089136.1| GE18953 [Drosophila yakuba]
 gb|EDW88848.1| GE18953 [Drosophila yakuba]
Length=1359

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC + +V I  + +IM   M+   LG W A GEGR  F D  ++NQ+    L 
Sbjct  1214  HNRSQRFECRWATVKIPSNRSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLINQLQSEQLV  1273

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D GKPTE+YP N NGSP G   +CS +GR    MP PERC  M Q+P+ P  ++
Sbjct  1274  TLQYVDDEGKPTELYPLNPNGSPQGIAGLCSTDGRHLALMPHPERCSSMYQWPYVPSSFE  1333

Query  243   VX-KKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1334  VSPTQSESPWQIMFNNAYNW  1353



>ref|XP_005177836.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Musca 
domestica]
Length=1348

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 76/139 (55%), Gaps = 1/139 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC ++SV +  S A+M   ++GS LG W A GEGR  F D  ILN +      
Sbjct  1208  HNKSERFECRWSSVRVANSKAMMLSKLQGSVLGCWVAHGEGRFSFRDTGILNNLKQQKCV  1267

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +    D GK TE YP N NGS  G   +CS +GR    MP PERC  M Q+P+    ++
Sbjct  1268  VLHYVDDDGKATETYPMNPNGSTEGIAGLCSEDGRHLALMPHPERCHAMYQWPYVSPGFN  1327

Query  243   VXKKGPXPWLRMFXXAXEW  187
             V K    PW  MF  A EW
Sbjct  1328  V-KSQASPWQVMFNTAYEW  1345



>gb|EKD40334.1| hypothetical protein ACD_75C00086G0001 [uncultured bacterium]
Length=553

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 83/148 (56%), Gaps = 2/148 (1%)
 Frame = -1

Query  618  QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
            QPR   N S RFE  +++V +++S AIM KGMEG   G+    GEGR +FPD +I  Q  
Sbjct  406  QPRFVRNLSGRFESRWSTVKVEKSQAIMLKGMEGLVFGIHVDHGEGRLHFPDTAIFAQAK  465

Query  438  XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
               +AP+    D  + TE YPFN NGSP G   +CS +GR    MP  ER FL  Q  + 
Sbjct  466  AGGMAPMFYVDDDAQSTEKYPFNPNGSPEGLAGLCSADGRHLALMPHAERVFLPWQAHYL  525

Query  258  PKXWDVXKKGPXPWLRMFXXAXEWXSXD  175
            P+  ++      PW++MF  A EW S +
Sbjct  526  PE--ELKDLQVTPWMQMFRNAYEWCSKN  551



>ref|XP_008191757.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Tribolium 
castaneum]
Length=1311

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC + ++ I++SPAIM K M  S  GVW+A GEGR  F + SI + +  +   
Sbjct  1172  HNISERFECRWNTIRIEKSPAIMLKDMHDSVFGVWSAHGEGRFTFKNSSIYDDLVKNNCV  1231

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D G PTE YP N NGS  G   ICS +GR    MP PERC     +P+ P  W 
Sbjct  1232  GLRFTDDEGNPTETYPMNPNGSIAGTAGICSKDGRHLAMMPHPERCDQPYLWPYMPPSWQ  1291

Query  243   VXKKGPXPWLRMFXXAXEW  187
               +K   PW +MF  A EW
Sbjct  1292  HFQK--SPWEKMFRNAYEW  1308



>gb|EFA02192.1| hypothetical protein TcasGA2_TC007848 [Tribolium castaneum]
Length=1277

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC + ++ I++SPAIM K M  S  GVW+A GEGR  F + SI + +  +   
Sbjct  1138  HNISERFECRWNTIRIEKSPAIMLKDMHDSVFGVWSAHGEGRFTFKNSSIYDDLVKNNCV  1197

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D G PTE YP N NGS  G   ICS +GR    MP PERC     +P+ P  W 
Sbjct  1198  GLRFTDDEGNPTETYPMNPNGSIAGTAGICSKDGRHLAMMPHPERCDQPYLWPYMPPSWQ  1257

Query  243   VXKKGPXPWLRMFXXAXEW  187
               +K   PW +MF  A EW
Sbjct  1258  HFQK--SPWEKMFRNAYEW  1274



>ref|XP_002078316.1| GD22605 [Drosophila simulans]
 gb|EDX03901.1| GD22605 [Drosophila simulans]
Length=1353

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 79/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC + +V I  + +IM   M+   LG W A GEGR  F D  +++Q+    L 
Sbjct  1209  HNKSQRFECRWATVKIPSNRSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISQLQSEQLV  1268

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D GKPTE+YP N NGSP G   +CS +GR    MP PERC  M Q+P+ P  ++
Sbjct  1269  TLQYVDDVGKPTELYPLNPNGSPQGIAGLCSTDGRHLALMPHPERCSSMYQWPYVPSSFE  1328

Query  243   VX-KKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1329  VSPTQSESPWQIMFNNAYNW  1348



>gb|KIZ03655.1| phosphoribosylformylglycinamidinesynthase [Monoraphidium neglectum]
Length=123

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 68/117 (58%), Gaps = 0/117 (0%)
 Frame = -1

Query  525  MEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGX  346
            M G+ +GVW A GEG+A FPD ++  +V  S LAP+R     G  TE YPFN NGSP G 
Sbjct  1    MGGAKVGVWCAHGEGQALFPDPAVEKRVLDSGLAPIRYVDTSGSATERYPFNPNGSPHGI  60

Query  345  XAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWDVXKKGPXPWLRMFXXAXEWXSXD  175
             A+CS NGR    MP PERCFL  Q P  P    +   G  PWLR+F  A EW   +
Sbjct  61   AALCSANGRHLAMMPHPERCFLAWQLPHSPPEVGLDPYGAGPWLRLFQNAREWAEAN  117



>ref|WP_028584169.1| phosphoribosylformylglycinamidine synthase [Desulfobulbus mediterraneus]
Length=1267

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 82/144 (57%), Gaps = 2/144 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN S RFE  +++V ++  PAIM +GME    G+    GEG  +FPD ++  +V 
Sbjct  1122  QPRFVHNRSGRFESRWSTVRVKPGPAIMLQGMEELVFGIHVDHGEGCLHFPDPAVQTRVE  1181

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                L P+    D G P+E YPFN NGSP G   +CSP+GR    MP PER FL  Q  W 
Sbjct  1182  TEGLVPLVYVDDEGVPSERYPFNPNGSPGGIAGLCSPDGRHLALMPHPERAFLPWQAHWL  1241

Query  258   PKXWDVXKKGPXPWLRMFXXAXEW  187
             P   ++ +    PWL+MF  A +W
Sbjct  1242  PA--EMEELEVSPWLQMFQNAYQW  1263



>ref|XP_008191211.1| PREDICTED: LOW QUALITY PROTEIN: phosphoribosylformylglycinamidine 
synthase-like [Tribolium castaneum]
Length=1311

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC ++++ I++SPAIM K M  S  GVW+A GEG+  F + S+ + +  +   
Sbjct  1172  HNVSERFECRWSTIRIEKSPAIMLKDMHQSVFGVWSAHGEGQFTFKNSSVYDDLVKNHCV  1231

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              +R   D G PTE YP N NGS  G   ICS  GR    MP PERC     +P+ P  W 
Sbjct  1232  CLRFTDDEGNPTETYPMNPNGSIAGTAGICSKGGRHLAMMPHPERCDQSYLWPYMPPSWQ  1291

Query  243   VXKKGPXPWLRMFXXAXEW  187
               +K   PW +MF  A EW
Sbjct  1292  HFQK--SPWEKMFRNAYEW  1308



>ref|XP_004931911.1| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Bombyx 
mori]
Length=1340

 Score =   120 bits (300),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 65/145 (45%), Positives = 81/145 (56%), Gaps = 6/145 (4%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPA---IMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXS  433
             HN S RFEC +++V I E+     + F+GM GS LGVW A GEGR    DGS+L+++  +
Sbjct  1192  HNSSERFECRWSAVKIHENENKEDVWFRGMGGSVLGVWVAHGEGRFTVADGSLLDKLYKN  1251

Query  432   XLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPW-YP  256
                 V+   D GKPTEVYP N NGSP G   + S +GR    MP PERC L  Q P   P
Sbjct  1252  GQVAVQYVDDDGKPTEVYPMNPNGSPDGLAGVRSRDGRHIAMMPHPERCVLRWQCPAPCP  1311

Query  255   KXWD--VXKKGPXPWLRMFXXAXEW  187
                +  V      PWLR+F  A  W
Sbjct  1312  TVTNPSVRNSQASPWLRLFQNAYSW  1336



>ref|XP_003293198.1| phosphoribosylformylglycinamide synthase [Dictyostelium purpureum]
 gb|EGC30271.1| phosphoribosylformylglycinamide synthase [Dictyostelium purpureum]
Length=1353

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 90/150 (60%), Gaps = 8/150 (5%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             QPR  HN S RFE  + +V I +S +++ KGMEGS LGVWA  GEG+ +  D SI++++ 
Sbjct  1202  QPRFIHNASGRFESRWVNVKILQSNSVLLKGMEGSVLGVWAQHGEGKLWCEDQSIIDEIN  1261

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
              + L+P+R   D G+ TE YPFN +G+  G  ++ S +GR    MP PER FL  Q+P  
Sbjct  1262  KNNLSPIRYVDDNGEITESYPFNPSGTQNGMGSLVSKDGRHLAMMPHPERSFLSWQWPHV  1321

Query  258   PKXW------DVXKKGPXPWLRMFXXAXEW  187
             P         DV ++   PW+++F  A ++
Sbjct  1322  PDNIKQNIASDVNQQ--SPWMKIFQNAKQF  1349



>dbj|BAC36269.1| unnamed protein product [Mus musculus]
Length=359

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 81/152 (53%), Gaps = 4/152 (3%)
 Frame = -1

Query  624  PSQP--RXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSIL  451
            P+QP     HN S RFE  + +V ++  PA+M +GMEGS L VW+A GEG   F    + 
Sbjct  208  PTQPGLLLRHNLSGRFESRWATVRVEPGPALMLRGMEGSVLPVWSAHGEGYMAFSSPELQ  267

Query  450  NQVPXSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQ  271
             ++    L P+    D G PTE YP N NGSP G   ICS +GR    MP PER   + Q
Sbjct  268  AKIEAKGLVPLHWADDDGNPTEQYPLNPNGSPGGIAGICSQDGRHLALMPHPERAVRLWQ  327

Query  270  FPWYPKXWDVXKKGPXPWLRMFXXAXEWXSXD  175
            + W P  +DV      PWL++F  A  W   D
Sbjct  328  WAWRPSPFDVLPT--SPWLQLFINARNWTQED  357



>ref|XP_002038039.1| GM17967 [Drosophila sechellia]
 gb|EDW54457.1| GM17967 [Drosophila sechellia]
Length=1353

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC + +V I  + +IM   M+   LG W A GEGR  F D   ++Q+    L 
Sbjct  1209  HNKSQRFECRWATVKIPSNRSIMVGSMKDLVLGCWVAHGEGRFAFRDEKFISQLQSEQLV  1268

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D GKPTE+YP N NGSP G   +CS +GR    MP PERC  M Q+P+ P  ++
Sbjct  1269  TLQYVDDVGKPTELYPLNPNGSPQGIAGLCSTDGRHLALMPHPERCSSMYQWPYVPSSFE  1328

Query  243   VX-KKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1329  VSPTQSESPWQIMFNNAYNW  1348



>ref|NP_477212.1| adenosine 2, isoform A [Drosophila melanogaster]
 ref|NP_723146.1| adenosine 2, isoform B [Drosophila melanogaster]
 ref|NP_723147.1| adenosine 2, isoform C [Drosophila melanogaster]
 sp|P35421.2|PUR4_DROME RecName: Full=Phosphoribosylformylglycinamidine synthase; Short=FGAM 
synthase; Short=FGAMS; AltName: Full=Formylglycinamide 
ribonucleotide amidotransferase; Short=FGAR amidotransferase; 
Short=FGAR-AT; AltName: Full=Formylglycinamide ribotide 
amidotransferase; AltName: Full=Protein adenosine-2 [Drosophila 
melanogaster]
 gb|AAF52329.1| adenosine 2, isoform A [Drosophila melanogaster]
 gb|AAN10573.1| adenosine 2, isoform B [Drosophila melanogaster]
 gb|AAN10574.1| adenosine 2, isoform C [Drosophila melanogaster]
Length=1354

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC + +V I  + +IM   M+   LG W A GEGR  F D  +++ +    L 
Sbjct  1209  HNKSQRFECRWATVKIPSNRSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISHLQSEQLV  1268

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D GKPTE+YP N NGSP G   +CS +GR    MP PERC  M Q+P+ P  ++
Sbjct  1269  TLQYVDDVGKPTELYPLNPNGSPQGIAGLCSSDGRHLALMPHPERCSSMYQWPYVPSSFE  1328

Query  243   VX-KKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1329  VSPTQSESPWQIMFNNAYNW  1348



>ref|XP_011194055.1| PREDICTED: phosphoribosylformylglycinamidine synthase [Bactrocera 
cucurbitae]
Length=1354

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 80/141 (57%), Gaps = 1/141 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC +T++ +++S +IM   ++GS LG W + GEGR  F +  ILN +  +   
Sbjct  1214  HNKSERFECRWTTIRVEDSISIMLSKLKGSVLGCWISHGEGRFSFRNTEILNSLKSNRCV  1273

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G  TE+YP N NG+  G   +CS +GR    MP PERC  M Q+P+ P  + 
Sbjct  1274  AIKYADDMGNATEIYPMNPNGTVDGIAGLCSEDGRHLALMPHPERCSAMFQWPYVPADFK  1333

Query  243   VXKKGPXPWLRMFXXAXEWXS  181
             +      PW  MF  A +W S
Sbjct  1334  I-NSVESPWQIMFNTAYDWCS  1353



>ref|XP_001969506.1| GG10143 [Drosophila erecta]
 gb|EDV58565.1| GG10143 [Drosophila erecta]
Length=1354

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC + +V I  + +IM   M+   LG W A GEGR  F D  +++Q+    L 
Sbjct  1209  HNRSQRFECRWATVKIPSNRSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISQLHSEQLV  1268

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G+PTE+YP N NGSP G   +CS +GR    MP PERC  M Q+P+ P  ++
Sbjct  1269  TLQYVDDGGRPTELYPLNPNGSPQGIAGLCSTDGRHLALMPHPERCSSMYQWPYVPSSFE  1328

Query  243   VX-KKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1329  VSPTQSESPWQIMFNNAYNW  1348



>gb|AAR82811.1| GM01721p [Drosophila melanogaster]
Length=1373

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC + +V I  + +IM   M+   LG W A GEGR  F D  +++ +    L 
Sbjct  1228  HNKSQRFECRWATVKIPSNRSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISHLQSEQLV  1287

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D GKPTE+YP N NGSP G   +CS +GR    MP PERC  M Q+P+ P  ++
Sbjct  1288  TLQYVDDVGKPTELYPLNPNGSPQGIAGLCSSDGRHLALMPHPERCSSMYQWPYVPSSFE  1347

Query  243   VX-KKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1348  VSPTQSESPWQIMFNNAYNW  1367



>gb|AAC46468.1| formylglycineamide ribotide amidotransferase [Drosophila melanogaster]
Length=1354

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN+S RFEC + +V I  + +IM   M+   LG W A GEGR  F D  +++ +    L 
Sbjct  1209  HNKSQRFECRWATVKIPSNRSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISHLQSEQLV  1268

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D GKPTE+YP N NGSP G   +CS +GR    MP PERC  M Q+P+ P  ++
Sbjct  1269  TLQYVDDVGKPTELYPLNPNGSPQGIAGLCSSDGRHLALMPHPERCSSMYQWPYVPSSFE  1328

Query  243   VX-KKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1329  VSPTQSESPWQIMFNNAYNW  1348



>ref|XP_001357193.2| GA21563 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL34261.2| GA21563 [Drosophila pseudoobscura pseudoobscura]
Length=1355

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +++V I  + +IM   M+   LG W A GEGR  F    +++Q+    L 
Sbjct  1209  HNRSQRFECRWSTVKIPANRSIMMANMQDLVLGCWVAHGEGRFAFRSEKLIDQLQAEKLV  1268

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G PTE+YP N NGSP G   +CSP+GR    MP PERC  M Q+P+ P  ++
Sbjct  1269  TLQYVDDVGSPTELYPMNPNGSPQGIAGLCSPDGRHLALMPHPERCSTMYQWPYVPPGFE  1328

Query  243   V-XKKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1329  VAATQDESPWQLMFNNAYNW  1348



>ref|XP_002014228.1| GL19084 [Drosophila persimilis]
 gb|EDW28224.1| GL19084 [Drosophila persimilis]
Length=1355

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 78/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC +++V I  + +IM   M+   LG W A GEGR  F    +++Q+    L 
Sbjct  1209  HNRSQRFECRWSTVKIPANRSIMMANMQDLVLGCWVAHGEGRFAFRSEKLVDQLQAEQLV  1268

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G PTE+YP N NGSP G   +CSP+GR    MP PERC  M Q+P+ P  ++
Sbjct  1269  TLQYVDDVGSPTELYPMNPNGSPQGIAGLCSPDGRHLALMPHPERCSTMYQWPYVPPGFE  1328

Query  243   V-XKKGPXPWLRMFXXAXEW  187
             V   +   PW  MF  A  W
Sbjct  1329  VAATQDESPWQLMFNNAYNW  1348



>ref|XP_002002285.1| GI13543 [Drosophila mojavensis]
 gb|EDW11727.1| GI13543 [Drosophila mojavensis]
Length=1362

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 79/145 (54%), Gaps = 1/145 (1%)
 Frame = -1

Query  618   QPRXTHNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVP  439
             Q     N S RFEC +++V I  + +IM   ME   LG W A GEGR  F D  +L Q+ 
Sbjct  1209  QLALLQNRSQRFECRWSTVRIPPNRSIMLSNMEDLVLGCWVAHGEGRFAFQDEQLLEQLQ  1268

Query  438   XSXLAPVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWY  259
                L  ++   D G PTE+YP N NGSP G   +CSP+GR    MP PERC  M Q+P+ 
Sbjct  1269  SEKLVTLQYVDDTGVPTELYPMNPNGSPKGIAGLCSPDGRHLALMPHPERCSAMYQWPYV  1328

Query  258   PKXWDV-XKKGPXPWLRMFXXAXEW  187
             P  ++V   +   PW  MF  A +W
Sbjct  1329  PPGFEVPATQVESPWQLMFNNAYKW  1353



>ref|XP_001962326.1| GF15410 [Drosophila ananassae]
 gb|EDV31547.1| GF15410 [Drosophila ananassae]
Length=1353

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 79/140 (56%), Gaps = 1/140 (1%)
 Frame = -1

Query  603   HNESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLA  424
             HN S RFEC ++SV I  + +IM   M+   LG W A GEGR  F + +++  +    L 
Sbjct  1208  HNRSQRFECRWSSVRIPPNRSIMLGNMQDLILGCWVAHGEGRFAFREENLIKTLQSEQLV  1267

Query  423   PVRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWD  244
              ++   D G+PTE+YP N NGSPLG   +CSP+GR    MP PERC  M Q+P+ P  ++
Sbjct  1268  TLQYVNDQGEPTELYPMNPNGSPLGIAGLCSPDGRHLALMPHPERCSSMTQWPYVPPGFE  1327

Query  243   V-XKKGPXPWLRMFXXAXEW  187
             V       PW  MF  A  W
Sbjct  1328  VPATNTESPWQLMFNNAYNW  1347



>gb|KFD49934.1| LOW QUALITY PROTEIN: hypothetical protein M513_09148 [Trichuris 
suis]
 gb|KFD60040.1| LOW QUALITY PROTEIN: hypothetical protein M514_09148 [Trichuris 
suis]
Length=1454

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 82/140 (59%), Gaps = 1/140 (1%)
 Frame = -1

Query  600   NESXRFECXFTSVAIQESPAIMFKGMEGSXLGVWAAXGEGRAYFPDGSILNQVPXSXLAP  421
             N S RFE  F++V I+ SP+I F+ MEG  LGVW A GEGR  F +   L+ +    L P
Sbjct  1288  NISGRFESRFSTVRIEPSPSIFFRRMEGFVLGVWVAHGEGRFNFSNDQALDVLEHHHLIP  1347

Query  420   VRXXXDXGKPTEVYPFNXNGSPLGXXAICSPNGRXXXXMPXPERCFLMXQFPWYPKXWDV  241
             +R   + G+PT +YPFN NGSP G   ICSP+GR    MP PERCF++ Q+P  P+  + 
Sbjct  1348  IRYVGERGEPTVLYPFNPNGSPHGIAGICSPDGRCLALMPHPERCFMLWQWPHCPEMPN-  1406

Query  240   XKKGPXPWLRMFXXAXEWXS  181
                   PWL  F  A  W +
Sbjct  1407  ETCLVSPWLFFFRNAYCWCT  1426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250