BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047J13

Length=762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342    391   1e-128   Nicotiana sylvestris
ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859    388   5e-127   Nicotiana tomentosiformis
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696    377   6e-123   Solanum tuberosum [potatoes]
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710    377   9e-123   Solanum lycopersicum
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112    376   2e-122   Vitis vinifera
emb|CAN71280.1|  hypothetical protein VITISV_027089                     375   3e-122   Vitis vinifera
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                   365   6e-119   Citrus sinensis [apfelsine]
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537    367   9e-119   
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg             367   1e-118   
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg                363   8e-118   Erythranthe guttata [common monkey flower]
ref|XP_007051240.1|  TolB protein-related isoform 1                     364   1e-117   
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112    362   3e-117   Solanum tuberosum [potatoes]
emb|CDP01464.1|  unnamed protein product                                363   3e-117   Coffea canephora [robusta coffee]
ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107    363   4e-117   
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390             358   4e-116   
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825    358   5e-116   Solanum lycopersicum
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421    357   1e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_192096.1|  tolB-related protein                                  357   3e-115   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13860.1|  unknown protein                                         357   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515212.1|  conserved hypothetical protein                     357   3e-115   Ricinus communis
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg             356   3e-115   Capsella rubella
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg             355   4e-115   
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                     355   8e-115   Eucalyptus grandis [rose gum]
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605    356   1e-114   Eucalyptus grandis [rose gum]
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938    355   2e-114   Elaeis guineensis
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922    354   2e-114   Camelina sativa [gold-of-pleasure]
gb|KDP28318.1|  hypothetical protein JCGZ_14089                         355   3e-114   Jatropha curcas
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446    353   4e-114   Camelina sativa [gold-of-pleasure]
gb|KJB09508.1|  hypothetical protein B456_001G146700                    353   1e-113   Gossypium raimondii
ref|XP_010091406.1|  hypothetical protein L484_013861                   351   4e-113   
gb|KCW58167.1|  hypothetical protein EUGRSUZ_H008852                    337   1e-112   Eucalyptus grandis [rose gum]
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                    349   2e-112   Arabis alpina [alpine rockcress]
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322    348   4e-112   Tarenaya hassleriana [spider flower]
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982    347   7e-112   Cucumis melo [Oriental melon]
ref|XP_011467073.1|  PREDICTED: uncharacterized protein LOC105352244    347   3e-111   Fragaria vesca subsp. vesca
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                     345   9e-111   Eucalyptus grandis [rose gum]
emb|CDX74396.1|  BnaA03g26510D                                          343   4e-110   
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800    343   5e-110   Brassica rapa
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039    341   3e-109   Phoenix dactylifera
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg             341   3e-109   
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997    341   3e-109   Sesamum indicum [beniseed]
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858    339   1e-108   Cucumis sativus [cucumbers]
ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273    339   7e-108   Prunus mume [ume]
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949    324   8e-103   
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844    325   1e-102   Pyrus x bretschneideri [bai li]
ref|NP_001060406.1|  Os07g0638100                                       324   1e-102   
ref|XP_003562594.1|  PREDICTED: uncharacterized protein LOC100822199    323   3e-102   Brachypodium distachyon [annual false brome]
ref|XP_010679438.1|  PREDICTED: uncharacterized protein LOC104894805    322   9e-102   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ04851.1|  hypothetical protein OsI_27029                          321   2e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_006840287.1|  hypothetical protein AMTR_s00045p00058330          320   4e-101   
ref|XP_008653395.1|  PREDICTED: uncharacterized protein LOC103633477    320   5e-101   Zea mays [maize]
ref|XP_010456117.1|  PREDICTED: uncharacterized protein LOC104737601    311   3e-100   
dbj|BAJ89339.1|  predicted protein                                      316   1e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002461097.1|  hypothetical protein SORBIDRAFT_02g040640          316   1e-99    Sorghum bicolor [broomcorn]
dbj|BAJ94262.1|  predicted protein                                      314   6e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036    314   2e-98    Glycine max [soybeans]
ref|XP_004498256.1|  PREDICTED: uncharacterized protein LOC101515113    312   4e-98    Cicer arietinum [garbanzo]
ref|XP_004958463.1|  PREDICTED: uncharacterized protein LOC101757241    311   1e-97    Setaria italica
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g             311   3e-97    Phaseolus vulgaris [French bean]
gb|EPS68684.1|  hypothetical protein M569_06083                         308   1e-96    Genlisea aurea
ref|XP_006840288.1|  hypothetical protein AMTR_s00045p00058890          303   2e-94    Amborella trichopoda
ref|XP_003637686.1|  Protein tolB                                       299   3e-93    
gb|AJD80981.1|  ABA-activated 1 protein                                 293   4e-91    Lupinus luteus
ref|XP_002515210.1|  conserved hypothetical protein                     291   2e-90    
ref|XP_003637684.1|  Protein tolB                                       290   2e-89    
ref|XP_002985152.1|  hypothetical protein SELMODRAFT_121622             251   8e-75    
ref|XP_002993240.1|  hypothetical protein SELMODRAFT_136782             221   4e-63    Selaginella moellendorffii
ref|XP_002993781.1|  hypothetical protein SELMODRAFT_187603             221   4e-63    
gb|ABR17080.1|  unknown                                                 218   6e-62    Picea sitchensis
ref|XP_003630471.1|  Protein tolB                                       209   4e-59    
ref|XP_007137456.1|  hypothetical protein PHAVU_009G128300g             208   1e-58    Phaseolus vulgaris [French bean]
dbj|BAJ88545.1|  predicted protein                                      208   2e-58    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003562684.2|  PREDICTED: uncharacterized protein LOC100824160    206   1e-57    
ref|XP_003527947.1|  PREDICTED: uncharacterized protein LOC100791865    206   1e-57    Glycine max [soybeans]
ref|XP_007019162.1|  DPP6 N-terminal domain-like protein                206   2e-57    
ref|XP_008644344.1|  PREDICTED: uncharacterized protein LOC103625729    205   2e-57    Zea mays [maize]
gb|KJB29176.1|  hypothetical protein B456_005G088400                    205   3e-57    Gossypium raimondii
ref|XP_004981111.1|  PREDICTED: uncharacterized protein LOC101776730    204   5e-57    Setaria italica
ref|XP_006351203.1|  PREDICTED: uncharacterized protein LOC102604753    204   6e-57    Solanum tuberosum [potatoes]
ref|XP_004502520.1|  PREDICTED: uncharacterized protein LOC101497096    202   2e-56    Cicer arietinum [garbanzo]
gb|KFK44274.1|  hypothetical protein AALP_AA1G237000                    202   2e-56    Arabis alpina [alpine rockcress]
ref|XP_010270269.1|  PREDICTED: uncharacterized protein LOC104606655    203   2e-56    Nelumbo nucifera [Indian lotus]
emb|CDP10971.1|  unnamed protein product                                202   2e-56    Coffea canephora [robusta coffee]
ref|XP_011069633.1|  PREDICTED: uncharacterized protein LOC105155456    202   2e-56    Sesamum indicum [beniseed]
ref|XP_001780675.1|  predicted protein                                  202   3e-56    
emb|CDP10970.1|  unnamed protein product                                202   3e-56    Coffea canephora [robusta coffee]
gb|EYU32510.1|  hypothetical protein MIMGU_mgv1a026619mg                202   4e-56    Erythranthe guttata [common monkey flower]
ref|XP_010477409.1|  PREDICTED: uncharacterized protein LOC104756505    201   6e-56    Camelina sativa [gold-of-pleasure]
ref|XP_004249849.1|  PREDICTED: uncharacterized protein LOC101257324    201   6e-56    Solanum lycopersicum
ref|XP_010521282.1|  PREDICTED: uncharacterized protein LOC104800...    201   6e-56    Tarenaya hassleriana [spider flower]
ref|XP_010521281.1|  PREDICTED: uncharacterized protein LOC104800...    201   7e-56    Tarenaya hassleriana [spider flower]
ref|XP_010672499.1|  PREDICTED: uncharacterized protein LOC104889058    201   9e-56    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009411896.1|  PREDICTED: uncharacterized protein LOC103993528    201   9e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006434259.1|  hypothetical protein CICLE_v10000425mg             201   9e-56    Citrus clementina [clementine]
gb|EAZ29242.1|  hypothetical protein OsJ_13305                          200   1e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006304666.1|  hypothetical protein CARUB_v10011878mg             200   1e-55    Capsella rubella
ref|XP_002520326.1|  conserved hypothetical protein                     200   1e-55    Ricinus communis
ref|XP_002466125.1|  hypothetical protein SORBIDRAFT_01g001880          200   2e-55    Sorghum bicolor [broomcorn]
ref|NP_001051846.1|  Os03g0840200                                       200   2e-55    
ref|XP_002890452.1|  hypothetical protein ARALYDRAFT_472406             200   2e-55    
emb|CDY08186.1|  BnaA06g15400D                                          199   2e-55    Brassica napus [oilseed rape]
emb|CDY04662.1|  BnaC05g17000D                                          200   2e-55    
ref|XP_011027475.1|  PREDICTED: uncharacterized protein LOC105127763    200   2e-55    Populus euphratica
emb|CDX84088.1|  BnaC08g07650D                                          199   2e-55    
ref|XP_011027472.1|  PREDICTED: uncharacterized protein LOC105127760    199   2e-55    Populus euphratica
ref|XP_009149686.1|  PREDICTED: uncharacterized protein LOC103873010    199   2e-55    Brassica rapa
gb|KDO80522.1|  hypothetical protein CISIN_1g004971mg                   199   3e-55    Citrus sinensis [apfelsine]
ref|XP_006472827.1|  PREDICTED: uncharacterized protein LOC102617553    199   3e-55    Citrus sinensis [apfelsine]
ref|XP_006386357.1|  hypothetical protein POPTR_0002s08010g             199   3e-55    Populus trichocarpa [western balsam poplar]
ref|NP_564147.1|  DPP6 N-terminal domain-like protein                   199   4e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285876.2|  PREDICTED: uncharacterized protein LOC100267814    199   4e-55    Vitis vinifera
ref|XP_009593179.1|  PREDICTED: uncharacterized protein LOC104089880    199   4e-55    Nicotiana tomentosiformis
ref|XP_009796392.1|  PREDICTED: uncharacterized protein LOC104242978    199   5e-55    Nicotiana sylvestris
ref|XP_010269111.1|  PREDICTED: uncharacterized protein LOC104605872    197   6e-55    Nelumbo nucifera [Indian lotus]
emb|CAN73514.1|  hypothetical protein VITISV_037210                     198   7e-55    Vitis vinifera
ref|XP_010911317.1|  PREDICTED: uncharacterized protein LOC105037336    197   2e-54    Elaeis guineensis
gb|EAY92514.1|  hypothetical protein OsI_14253                          197   2e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_006416277.1|  hypothetical protein EUTSA_v10009943mg             196   3e-54    Eutrema salsugineum [saltwater cress]
gb|KDP32822.1|  hypothetical protein JCGZ_12114                         196   4e-54    Jatropha curcas
ref|XP_010498624.1|  PREDICTED: uncharacterized protein LOC104776288    196   5e-54    Camelina sativa [gold-of-pleasure]
ref|XP_010063935.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    196   6e-54    Eucalyptus grandis [rose gum]
ref|XP_008466749.1|  PREDICTED: uncharacterized protein LOC103504088    195   1e-53    Cucumis melo [Oriental melon]
ref|XP_007223068.1|  hypothetical protein PRUPE_ppa003730mg             192   1e-53    
ref|XP_004290903.2|  PREDICTED: uncharacterized protein LOC101292474    194   2e-53    Fragaria vesca subsp. vesca
ref|XP_009343980.1|  PREDICTED: uncharacterized protein LOC103935890    194   2e-53    Pyrus x bretschneideri [bai li]
gb|EAZ40813.1|  hypothetical protein OsJ_25290                          191   1e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008219596.1|  PREDICTED: uncharacterized protein LOC103319783    191   3e-52    Prunus mume [ume]
ref|XP_010095431.1|  hypothetical protein L484_013388                   191   3e-52    
ref|XP_004160721.1|  PREDICTED: protein TolB-like                       190   5e-52    
ref|XP_004149439.1|  PREDICTED: protein TolB-like                       190   6e-52    Cucumis sativus [cucumbers]
ref|XP_008338671.1|  PREDICTED: uncharacterized protein LOC103401727    190   6e-52    
ref|XP_006652005.1|  PREDICTED: uncharacterized protein LOC102702184    170   2e-46    
ref|XP_010539663.1|  PREDICTED: uncharacterized protein LOC104813673    171   2e-45    Tarenaya hassleriana [spider flower]
ref|XP_010477408.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    167   6e-44    
ref|XP_010488216.1|  PREDICTED: uncharacterized protein LOC104766097    161   1e-41    Camelina sativa [gold-of-pleasure]
ref|NP_564146.1|  uncharacterized protein                               160   2e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466456.1|  PREDICTED: uncharacterized protein LOC104746...    160   2e-41    Camelina sativa [gold-of-pleasure]
ref|XP_010510815.1|  PREDICTED: uncharacterized protein LOC104787018    160   3e-41    Camelina sativa [gold-of-pleasure]
ref|XP_010466457.1|  PREDICTED: uncharacterized protein LOC104746...    159   3e-41    
ref|XP_002890451.1|  hypothetical protein ARALYDRAFT_472405             159   6e-41    Arabidopsis lyrata subsp. lyrata
ref|XP_005646452.1|  tricorn protease N-terminal domain-containin...    154   5e-39    Coccomyxa subellipsoidea C-169
ref|XP_006416278.1|  hypothetical protein EUTSA_v10006965mg             153   6e-39    Eutrema salsugineum [saltwater cress]
emb|CBI18981.3|  unnamed protein product                                150   3e-38    Vitis vinifera
emb|CDY04661.1|  BnaC05g16990D                                          150   6e-38    
gb|EAY93383.1|  hypothetical protein OsI_15178                          149   7e-38    Oryza sativa Indica Group [Indian rice]
ref|XP_002520327.1|  conserved hypothetical protein                     148   2e-37    
emb|CDY08187.1|  BnaA06g15390D                                          149   2e-37    Brassica napus [oilseed rape]
ref|XP_009149685.1|  PREDICTED: uncharacterized protein LOC103873008    149   3e-37    Brassica rapa
gb|KFK44273.1|  hypothetical protein AALP_AA1G236600                    148   5e-37    Arabis alpina [alpine rockcress]
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                     142   3e-35    Eucalyptus grandis [rose gum]
gb|EMT16880.1|  hypothetical protein F775_15390                         134   4e-33    
gb|KCW71232.1|  hypothetical protein EUGRSUZ_F04330                     130   9e-31    Eucalyptus grandis [rose gum]
ref|XP_002467956.1|  hypothetical protein SORBIDRAFT_01g037140          130   2e-30    
gb|AEW08691.1|  hypothetical protein CL1213Contig1_01                   115   2e-28    Pinus lambertiana
gb|EMT08438.1|  hypothetical protein F775_30261                         124   3e-28    
ref|NP_001173830.1|  Os04g0278101                                       120   3e-28    
ref|XP_002446045.1|  hypothetical protein SORBIDRAFT_06g000930          121   2e-27    Sorghum bicolor [broomcorn]
ref|XP_004963491.1|  PREDICTED: uncharacterized protein LOC101774581    120   4e-27    Setaria italica
ref|XP_010675836.1|  PREDICTED: uncharacterized protein LOC104891779    120   5e-27    Beta vulgaris subsp. vulgaris [field beet]
gb|AFG48602.1|  hypothetical protein CL1213Contig1_01                   111   5e-27    Pinus taeda
gb|AEW08692.1|  hypothetical protein CL1213Contig1_01                   111   5e-27    Pinus radiata
ref|XP_010102639.1|  hypothetical protein L484_010931                   120   6e-27    Morus notabilis
ref|XP_002519802.1|  conserved hypothetical protein                     118   3e-26    Ricinus communis
gb|AFG48601.1|  hypothetical protein CL1213Contig1_01                   109   3e-26    Pinus taeda
ref|XP_002519807.1|  conserved hypothetical protein                     117   4e-26    
ref|XP_008662981.1|  PREDICTED: uncharacterized protein LOC103641407    117   4e-26    Zea mays [maize]
gb|EAY89757.1|  hypothetical protein OsI_11300                          117   4e-26    Oryza sativa Indica Group [Indian rice]
dbj|BAJ92843.1|  predicted protein                                      117   5e-26    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001049934.1|  Os03g0314500                                       117   5e-26    
ref|XP_010675829.1|  PREDICTED: uncharacterized protein LOC104891772    116   1e-25    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002524160.1|  conserved hypothetical protein                     116   1e-25    Ricinus communis
gb|EAY90391.1|  hypothetical protein OsI_11968                          115   2e-25    Oryza sativa Indica Group [Indian rice]
ref|WP_041858684.1|  hypothetical protein                               115   2e-25    
ref|XP_010097765.1|  hypothetical protein L484_023906                   115   2e-25    Morus notabilis
gb|ABJ88479.1|  WD40 domain protein beta Propeller                      115   2e-25    Candidatus Solibacter usitatus Ellin6076
ref|XP_002524154.1|  conserved hypothetical protein                     115   3e-25    Ricinus communis
ref|XP_010676033.1|  PREDICTED: uncharacterized protein LOC104891943    115   4e-25    Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ27259.1|  hypothetical protein OsJ_11196                          114   6e-25    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050324.1|  Os03g0403400                                       113   1e-24    
ref|XP_004960704.1|  PREDICTED: uncharacterized protein LOC101777811    113   1e-24    Setaria italica
ref|XP_010676032.1|  PREDICTED: uncharacterized protein LOC104891942    112   1e-24    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT14934.1|  hypothetical protein F775_30553                         113   1e-24    
ref|XP_002437598.1|  hypothetical protein SORBIDRAFT_10g030220          112   2e-24    Sorghum bicolor [broomcorn]
gb|EMS49561.1|  hypothetical protein TRIUR3_11240                       110   5e-24    Triticum urartu
ref|XP_010675837.1|  PREDICTED: uncharacterized protein LOC104891780    110   7e-24    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK07068.1|  predicted protein                                      110   9e-24    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010675830.1|  PREDICTED: uncharacterized protein LOC104891773    110   1e-23    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT29283.1|  hypothetical protein F775_17496                         110   2e-23    
gb|EMT19136.1|  hypothetical protein F775_12749                         109   2e-23    
ref|XP_010105408.1|  hypothetical protein L484_008562                   107   3e-23    
ref|XP_004980674.1|  PREDICTED: uncharacterized protein LOC101756594    109   5e-23    Setaria italica
ref|XP_010235117.1|  PREDICTED: uncharacterized protein LOC100846313    108   5e-23    
ref|XP_010087211.1|  hypothetical protein L484_006140                   108   7e-23    Morus notabilis
ref|XP_003575792.1|  PREDICTED: uncharacterized protein LOC100821131    108   8e-23    Brachypodium distachyon [annual false brome]
gb|EMS54560.1|  hypothetical protein TRIUR3_19354                       100   2e-22    Triticum urartu
ref|XP_003574472.1|  PREDICTED: uncharacterized protein LOC100838501    106   2e-22    Brachypodium distachyon [annual false brome]
gb|EJL34752.1|  periplasmic component of the Tol biopolymer trans...    105   4e-22    Caulobacter sp. AP07
gb|AFB33555.1|  hypothetical protein 2_7121_02                        99.8    4e-22    Pinus mugo [mountain pine]
ref|XP_010097467.1|  hypothetical protein L484_024672                   105   6e-22    
ref|XP_010102640.1|  hypothetical protein L484_010932                   105   6e-22    Morus notabilis
gb|AFG49274.1|  hypothetical protein 2_7121_02                        99.4    6e-22    Pinus taeda
gb|AEW08359.1|  hypothetical protein 2_7121_02                        99.4    7e-22    Pinus radiata
ref|XP_010097483.1|  hypothetical protein L484_024689                   103   2e-21    Morus notabilis
gb|EMT06488.1|  hypothetical protein F775_06751                         103   3e-21    
gb|AFB33549.1|  hypothetical protein 2_7121_02                        97.1    4e-21    Abies alba [abete-blanco]
gb|AEW08360.1|  hypothetical protein 2_7121_02                        95.9    1e-20    Pinus lambertiana
ref|XP_006658881.1|  PREDICTED: uncharacterized protein LOC102705738    100   1e-20    Oryza brachyantha
gb|AFB33553.1|  hypothetical protein 2_7121_02                        95.5    2e-20    Pinus cembra [Arve]
emb|CDM86908.1|  unnamed protein product                                100   3e-20    Triticum aestivum [Canadian hard winter wheat]
ref|WP_035092853.1|  hypothetical protein                             98.6    9e-20    Caulobacter henricii
gb|AFB33550.1|  hypothetical protein 2_7121_02                        93.2    1e-19    Larix decidua
ref|WP_006298539.1|  hypothetical protein                             98.2    1e-19    
ref|WP_020604165.1|  hypothetical protein                             95.5    1e-18    Spirosoma spitsbergense
ref|WP_035205184.1|  hypothetical protein                             95.5    1e-18    Acidovorax
gb|EJE50504.1|  periplasmic component of the Tol biopolymer trans...  95.5    1e-18    Acidovorax sp. CF316
ref|NP_001066679.1|  Os12g0431300                                     95.5    1e-18    
gb|KFY81759.1|  hypothetical protein V500_11119                       94.4    3e-18    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFZ03462.1|  hypothetical protein V502_10931                       94.0    4e-18    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY12538.1|  hypothetical protein V491_06750                       93.2    8e-18    Pseudogymnoascus sp. VKM F-3775
ref|WP_029915040.1|  hypothetical protein                             92.8    9e-18    Caulobacter sp. UNC358MFTsu5.1
ref|WP_035035180.1|  hypothetical protein                             91.7    1e-17    
ref|WP_020383615.1|  hypothetical protein                             88.2    6e-17    
ref|WP_034400879.1|  translocation protein TolB                       89.0    8e-17    
ref|WP_043399319.1|  tolB protein precursor protein                   87.8    8e-17    
gb|KFY42678.1|  hypothetical protein V495_04387                       90.1    8e-17    Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY02373.1|  hypothetical protein O988_02191                       89.0    2e-16    Pseudogymnoascus sp. VKM F-3808
gb|KFX90155.1|  hypothetical protein V490_06619                       89.0    2e-16    Pseudogymnoascus sp. VKM F-3557
gb|KFY15902.1|  hypothetical protein V492_01680                       88.6    2e-16    Pseudogymnoascus sp. VKM F-4246
gb|ETI58852.1|  hypothetical protein C100_22665                       88.2    3e-16    Sphingobium sp. C100
ref|WP_041305462.1|  hypothetical protein                             83.6    4e-16    
ref|WP_031310342.1|  hypothetical protein                             87.8    4e-16    Sphingobium sp. C100
ref|XP_001545913.1|  hypothetical protein BC1G_15641                  87.8    4e-16    Botrytis cinerea B05.10
gb|KFZ05841.1|  hypothetical protein V501_07970                       87.0    7e-16    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|ABX03625.1|  WD40 domain protein beta Propeller                    84.3    9e-16    Herpetosiphon aurantiacus DSM 785
gb|KFY39698.1|  hypothetical protein V494_03875                       86.7    1e-15    Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY74302.1|  hypothetical protein V499_05663                       86.3    1e-15    Pseudogymnoascus sp. VKM F-103
ref|WP_020383554.1|  hypothetical protein                             84.0    1e-15    
gb|AFK45973.1|  unknown                                               80.1    1e-15    Medicago truncatula
gb|EKD68537.1|  Periplasmic component of the Tol biopolymer trans...  86.3    2e-15    uncultured bacterium
ref|XP_007835900.1|  hypothetical protein PFICI_09128                 85.9    2e-15    Pestalotiopsis fici W106-1
gb|KEZ20905.1|  Periplasmic component of the Tol biopolymer trans...  85.5    2e-15    Sphingobium yanoikuyae
ref|WP_037517431.1|  hypothetical protein                             85.5    2e-15    Sphingobium yanoikuyae
ref|WP_033378529.1|  MULTISPECIES: hypothetical protein               83.2    2e-15    
emb|CAI78611.1|  tolB protein                                         84.7    2e-15    uncultured delta proteobacterium
gb|EJK81239.1|  periplasmic component of the Tol biopolymer trans...  85.5    3e-15    Sphingobium sp. AP49
ref|WP_037486764.1|  hypothetical protein                             85.5    3e-15    
gb|ENH85242.1|  WD40 domain protein beta propeller                    85.5    3e-15    
ref|XP_007914327.1|  putative tat pathway signal sequence domain-...  85.1    3e-15    Phaeoacremonium minimum UCRPA7
ref|WP_026159723.1|  hypothetical protein                             82.8    3e-15    
gb|EMS34061.1|  tolB protein precursor, periplasmic protein invol...  82.8    3e-15    Mariniradius saccharolyticus AK6
ref|WP_040479380.1|  translocation protein TolB                       82.4    4e-15    
ref|WP_015754374.1|  translocation protein TolB                       82.4    5e-15    Robiginitalea biformata
ref|WP_041978883.1|  hypothetical protein                             82.4    5e-15    
ref|WP_041569562.1|  hypothetical protein                             82.0    6e-15    
emb|CDM66426.1|  periplasmic component of the Tol biopolymer tran...  82.8    6e-15    Pyrinomonas methylaliphatogenes
ref|WP_015838788.1|  translocation protein TolB                       82.8    7e-15    Geobacter sp. M21
ref|WP_027978304.1|  hypothetical protein                             84.0    8e-15    
gb|AEP11793.1|  Periplasmic component of the Tol biopolymer trans...  82.0    9e-15    Chloracidobacterium thermophilum B
gb|AGH96540.1|  adventurous gliding motility protein W                83.2    9e-15    Bdellovibrio exovorus JSS
ref|WP_041576117.1|  translocation protein TolB                       83.2    9e-15    
ref|WP_020383555.1|  hypothetical protein                             81.6    1e-14    
gb|ESZ89568.1|  hypothetical protein SBOR_10048                       83.6    1e-14    Sclerotinia borealis F-4128
ref|XP_010091904.1|  hypothetical protein L484_001053                 80.1    1e-14    
ref|WP_026842125.1|  translocation protein TolB                       82.4    1e-14    Geobacter bremensis
ref|WP_020384321.1|  hypothetical protein                             81.3    1e-14    
gb|AHI25037.1|  hypothetical protein H845_1092                        82.8    2e-14    Komagataeibacter xylinus E25
dbj|GAA89133.1|  tat pathway signal sequence domain-containing pr...  82.8    2e-14    Aspergillus kawachii IFO 4308
ref|WP_025438063.1|  hypothetical protein                             82.8    2e-14    Komagataeibacter xylinus
gb|KEQ78669.1|  tricorn protease N-terminal domain-containing pro...  82.4    2e-14    Aureobasidium pullulans EXF-150
ref|WP_000615434.1|  hypothetical protein                             80.1    2e-14    
ref|WP_015718924.1|  translocation protein TolB                       81.3    3e-14    
ref|XP_001395414.2|  hypothetical protein ANI_1_1672104               82.0    3e-14    Aspergillus niger CBS 513.88
gb|EHA25732.1|  hypothetical protein ASPNIDRAFT_50375                 82.0    4e-14    Aspergillus niger ATCC 1015
dbj|GAK58097.1|  WD40-like Beta Propeller                             81.3    4e-14    Candidatus Vecturithrix granuli
ref|WP_020384323.1|  hypothetical protein                             79.7    4e-14    
emb|CAE05101.3|  OSJNBa0009K15.21                                     76.6    5e-14    Oryza sativa Japonica Group [Japonica rice]
ref|WP_036546999.1|  hypothetical protein                             78.2    6e-14    
ref|WP_012531942.1|  translocation protein TolB                       80.1    6e-14    Geobacter bemidjiensis
ref|WP_020384320.1|  hypothetical protein                             78.6    7e-14    
emb|CBH22796.1|  TolB protein precursor                               80.5    8e-14    
ref|WP_039744998.1|  translocation protein TolB                       80.1    9e-14    
ref|WP_027716026.1|  translocation protein TolB                       79.7    1e-13    
gb|AHG92466.1|  WD40-like beta Propeller containing protein           80.5    1e-13    
ref|WP_019091574.1|  hypothetical protein                             80.5    1e-13    
ref|WP_030901696.1|  hypothetical protein                             80.5    1e-13    
ref|WP_015250253.1|  Tol biopolymer transport system periplasmic ...  78.2    1e-13    
ref|WP_020258740.1|  hypothetical protein                             78.2    1e-13    
ref|WP_033198113.1|  WD40 domain protein beta propeller               77.8    1e-13    
ref|WP_010509656.1|  hypothetical protein                             80.1    1e-13    
ref|WP_019086650.1|  hypothetical protein                             80.1    1e-13    
ref|XP_007798560.1|  putative tat pathway signal sequence domain-...  80.1    1e-13    
dbj|GAD95313.1|  hypothetical protein ANI_1_1672104                   80.1    2e-13    
ref|WP_012831477.1|  hypothetical protein                             78.6    2e-13    
dbj|BAJ63516.1|  hypothetical protein ANT_14880                       77.0    2e-13    
ref|WP_044188701.1|  tolB protein precursor protein                   78.2    3e-13    
ref|XP_007595649.1|  TOXD                                             79.7    3e-13    
ref|WP_012115032.1|  beta-propeller repeat-containing to-pal syst...  78.6    3e-13    
ref|WP_004513696.1|  translocation protein TolB                       78.2    3e-13    
ref|WP_013226661.1|  translocation protein TolB                       79.3    4e-13    
ref|WP_044021394.1|  hypothetical protein                             78.6    4e-13    
ref|WP_029968882.1|  hypothetical protein                             78.6    4e-13    
gb|EDT09480.1|  hypothetical protein BgramDRAFT_3858                  78.6    4e-13    
ref|XP_007588104.1|  putative tat pathway signal sequence domain-...  78.6    4e-13    
dbj|BAL54994.1|  TolB protein                                         76.6    4e-13    
gb|EKD55533.1|  WD40-like protein Beta Propeller                      79.0    4e-13    
ref|XP_003040341.1|  hypothetical protein NECHADRAFT_34811            78.2    5e-13    
ref|WP_038283157.1|  translocation protein TolB                       77.8    5e-13    
gb|EMD82160.1|  TolB protein precursor                                77.8    5e-13    
ref|WP_025779649.1|  hypothetical protein                             75.1    6e-13    
ref|WP_038036308.1|  translocation protein TolB                       77.4    6e-13    
gb|EKG10177.1|  Six-bladed beta-propeller TolB-like protein           78.2    6e-13    
ref|WP_040334620.1|  hypothetical protein                             76.6    7e-13    
emb|CAK46110.1|  unnamed protein product                              78.2    7e-13    
ref|WP_029206303.1|  translocation protein TolB                       77.0    8e-13    
ref|WP_006403962.1|  hypothetical protein                             77.8    8e-13    
ref|WP_022817416.1|  translocation protein TolB                       78.2    9e-13    
ref|WP_039218915.1|  hypothetical protein                             77.4    9e-13    
dbj|GAK49571.1|  WD40-like Beta Propeller                             75.5    9e-13    
ref|WP_006399669.1|  hypothetical protein                             77.4    1e-12    
ref|WP_035954400.1|  hypothetical protein                             77.4    1e-12    
ref|WP_029877303.1|  translocation protein TolB                       77.0    1e-12    
ref|WP_029557867.1|  translocation protein TolB                       76.6    1e-12    
ref|WP_035474624.1|  hypothetical protein                             77.4    1e-12    
ref|WP_027818119.1|  hypothetical protein                             77.4    1e-12    
ref|WP_041872499.1|  translocation protein TolB                       76.6    1e-12    
ref|WP_043539896.1|  translocation protein TolB                       76.6    1e-12    
ref|WP_044595669.1|  hypothetical protein                             75.5    1e-12    
ref|WP_043201552.1|  hypothetical protein                             76.6    2e-12    
ref|WP_011550484.1|  hypothetical protein                             75.9    2e-12    
emb|CBE67573.1|  Protein tolB precursor                               75.9    2e-12    
ref|WP_040198549.1|  translocation protein TolB                       75.9    2e-12    
gb|EQB54739.1|  hypothetical protein CGLO_05391                       76.3    2e-12    
ref|WP_013942199.1|  translocation protein TolB                       75.5    3e-12    
ref|WP_020678259.1|  hypothetical protein                             75.5    3e-12    
ref|WP_040095900.1|  translocation protein TolB                       75.5    3e-12    
ref|WP_027211084.1|  hypothetical protein                             75.9    3e-12    
ref|XP_007275047.1|  WD40 domain protein beta propeller               75.9    3e-12    
ref|XP_007828048.1|  hypothetical protein PFICI_01276                 75.9    3e-12    
gb|KIL85442.1|  hypothetical protein FAVG1_11399                      75.9    3e-12    
ref|WP_043623202.1|  translocation protein TolB                       75.5    3e-12    
ref|WP_034806253.1|  translocation protein TolB                       75.5    3e-12    
ref|WP_012640704.1|  translocation protein TolB                       75.5    3e-12    
ref|WP_036196430.1|  hypothetical protein                             73.6    3e-12    
dbj|BAQ44058.1|  translocation protein TolB                           75.5    3e-12    
ref|WP_010921063.1|  translocation protein TolB                       75.1    4e-12    
ref|XP_010094534.1|  hypothetical protein L484_024827                 72.8    4e-12    
ref|WP_025306923.1|  translocation protein TolB                       75.1    4e-12    
ref|WP_042305737.1|  hypothetical protein                             75.5    4e-12    
ref|WP_043949727.1|  translocation protein TolB                       75.1    4e-12    
ref|WP_039647551.1|  translocation protein TolB                       75.1    4e-12    
ref|WP_011937148.1|  translocation protein TolB                       75.1    4e-12    
ref|WP_006000501.1|  translocation protein TolB                       74.7    5e-12    
ref|WP_033260684.1|  translocation protein TolB                       75.9    5e-12    
ref|WP_015930945.1|  Tol-Pal system beta propeller repeat-contain...  74.7    5e-12    
ref|WP_040889071.1|  WD40 domain protein beta propeller               73.2    5e-12    
ref|WP_035277427.1|  hypothetical protein                             74.7    5e-12    
ref|WP_034427159.1|  hypothetical protein                             73.9    5e-12    
ref|WP_012169055.1|  twin-arginine translocation pathway signal       74.7    5e-12    
ref|XP_003570812.2|  PREDICTED: uncharacterized protein LOC100837266  75.5    6e-12    
ref|WP_038327981.1|  translocation protein TolB                       74.7    6e-12    
ref|WP_010973273.1|  MULTISPECIES: translocation protein TolB         74.7    6e-12    
gb|EGL66673.1|  translocation protein                                 74.7    6e-12    
gb|ETW93507.1|  hypothetical protein ETSY1_38930                      73.9    6e-12    
ref|WP_026181509.1|  MULTISPECIES: translocation protein TolB         74.3    6e-12    
ref|WP_002615693.1|  hypothetical protein                             73.9    6e-12    
ref|WP_002638920.1|  translocation protein TolB                       74.3    7e-12    
ref|WP_040498617.1|  translocation protein TolB                       73.9    8e-12    
ref|WP_041870465.1|  hypothetical protein                             72.8    8e-12    
gb|KGO45093.1|  WD40-like Beta Propeller                              74.7    8e-12    
ref|WP_036514540.1|  translocation protein TolB                       74.3    8e-12    
gb|EKV04294.1|  hypothetical protein PDIP_88020                       74.7    8e-12    
gb|KGO53636.1|  WD40-like Beta Propeller                              74.7    8e-12    
ref|WP_043431595.1|  tolB protein precursor protein                   73.6    9e-12    
ref|WP_004445729.1|  MULTISPECIES: tol-pal system beta propeller ...  73.9    9e-12    
ref|WP_028318597.1|  hypothetical protein                             73.9    1e-11    
ref|WP_038053671.1|  translocation protein TolB                       73.9    1e-11    
gb|AIO73947.1|  hypothetical protein DM80_3777                        74.3    1e-11    
ref|WP_007678383.1|  TolB protein                                     71.2    1e-11    
ref|WP_022563044.1|  Protein tolB precursor                           73.9    1e-11    
gb|AEB09960.1|  Protein tolB                                          73.9    1e-11    
gb|ADG09198.1|  Tol-Pal system beta propeller repeat protein TolB     73.9    1e-11    
ref|WP_041538454.1|  translocation protein TolB                       73.6    1e-11    
ref|WP_011555707.1|  translocation protein TolB                       73.6    1e-11    
ref|WP_006697167.1|  MULTISPECIES: translocation protein TolB         73.6    1e-11    
ref|WP_025322946.1|  hypothetical protein                             73.2    1e-11    
ref|WP_036316959.1|  translocation protein TolB                       73.6    1e-11    
gb|EPX59664.1|  tolB protein precursor, periplasmic protein           73.2    1e-11    
dbj|GAK55986.1|  protein tolB                                         73.6    1e-11    
ref|WP_019872746.1|  hypothetical protein                             73.6    1e-11    
ref|WP_024348846.1|  translocation protein TolB                       73.6    1e-11    
ref|WP_015828440.1|  hypothetical protein                             73.9    1e-11    
ref|WP_007661449.1|  tol-pal system beta propeller repeat protein...  73.6    1e-11    
ref|WP_029638152.1|  translocation protein TolB                       73.6    1e-11    
ref|WP_026364039.1|  MULTISPECIES: translocation protein TolB         73.6    1e-11    
ref|WP_003523242.1|  translocation protein TolB                       73.6    1e-11    
ref|WP_011582484.1|  translocation protein TolB                       73.6    1e-11    
ref|WP_003506242.1|  translocation protein TolB                       73.6    1e-11    
gb|ADY66818.1|  protein tolB precursor                                73.6    1e-11    
dbj|GAA92300.1|  tat pathway signal sequence domain-containing pr...  73.9    1e-11    
ref|WP_003511387.1|  MULTISPECIES: translocation protein TolB         73.6    1e-11    
ref|WP_009208751.1|  tolB protein, periplasmic component, biopoly...  73.6    1e-11    
ref|WP_017943217.1|  hypothetical protein                             73.6    1e-11    
ref|WP_026331166.1|  translocation protein TolB                       73.2    2e-11    
ref|WP_026091053.1|  translocation protein TolB                       73.2    2e-11    
ref|WP_015345983.1|  beta-propeller repeat-containing to-pal syst...  72.8    2e-11    
dbj|GAK58088.1|  WD40-like Beta Propeller                             72.4    2e-11    
ref|WP_007068778.1|  translocation protein TolB precursor             73.2    2e-11    
ref|WP_030055158.1|  MULTISPECIES: hypothetical protein               73.2    2e-11    
ref|WP_035992689.1|  hypothetical protein                             73.6    2e-11    
dbj|BAJ07029.1|  WD40-like beta propeller protein                     72.4    2e-11    
ref|WP_044278321.1|  tolB protein precursor protein                   72.8    2e-11    
ref|WP_010813737.1|  MULTISPECIES: translocation protein TolB         73.2    2e-11    
ref|WP_025585162.1|  translocation protein TolB                       73.2    2e-11    
ref|WP_041970151.1|  translocation protein TolB                       73.2    2e-11    
ref|WP_035513763.1|  hypothetical protein                             73.6    2e-11    
ref|WP_041187541.1|  hypothetical protein                             72.0    2e-11    
ref|WP_012353553.1|  translocation protein TolB                       73.2    2e-11    
ref|WP_006726830.1|  translocation protein TolB                       72.8    2e-11    
ref|WP_012973608.1|  TolB protein                                     72.8    2e-11    
ref|WP_043436880.1|  hypothetical protein                             73.2    2e-11    
emb|CDM26673.1|  Six-bladed beta-propeller, TolB-like                 73.2    2e-11    
ref|WP_029914308.1|  translocation protein TolB                       72.8    2e-11    
ref|WP_020402308.1|  hypothetical protein                             73.6    2e-11    
ref|WP_042291254.1|  hypothetical protein                             72.4    2e-11    
dbj|GAK88347.1|  TolB protein precursor                               72.4    2e-11    
ref|WP_020383553.1|  hypothetical protein                             71.2    2e-11    
ref|XP_008082401.1|  DPP6 N-terminal                                  73.2    2e-11    
ref|WP_031448221.1|  translocation protein TolB                       72.8    2e-11    
ref|WP_038037302.1|  MULTISPECIES: translocation protein TolB         72.8    2e-11    
ref|WP_026353894.1|  translocation protein TolB                       72.8    2e-11    
ref|WP_029564674.1|  translocation protein TolB                       72.8    3e-11    
ref|WP_038035303.1|  MULTISPECIES: translocation protein TolB         72.8    3e-11    
gb|KGO75694.1|  WD40-like Beta Propeller                              73.2    3e-11    
ref|WP_028484711.1|  translocation protein TolB                       72.8    3e-11    
dbj|GAM35983.1|  hypothetical protein TCE0_018f04727                  73.2    3e-11    
emb|CBK43047.1|  Protein TolB precursor                               72.4    3e-11    
ref|WP_013957626.1|  translocation protein TolB                       72.4    3e-11    
ref|WP_038454721.1|  hypothetical protein                             72.8    3e-11    
ref|WP_023666083.1|  translocation protein TolB                       72.4    3e-11    
ref|WP_035459582.1|  translocation protein TolB                       72.4    3e-11    
ref|WP_026190563.1|  translocation protein TolB                       72.4    3e-11    
gb|KJF66339.1|  translocation protein TolB                            72.4    3e-11    
ref|WP_023399162.1|  periplasmic component of the Tol biopolymer ...  71.6    3e-11    
ref|WP_015089363.1|  adventurous gliding motility protein W           72.4    3e-11    
gb|EGP55224.1|  translocation protein TolB                            72.4    3e-11    
gb|KJF73262.1|  translocation protein TolB                            72.4    3e-11    
ref|WP_004616244.1|  tol-pal system beta propeller repeat protein...  72.4    3e-11    
ref|WP_012333176.1|  beta-propeller repeat-containing to-pal syst...  72.4    3e-11    
ref|WP_029131120.1|  translocation protein TolB                       72.4    3e-11    
gb|EHA23695.1|  hypothetical protein ASPNIDRAFT_180130                72.8    3e-11    
dbj|GAK98792.1|  TolB protein precursor                               72.0    3e-11    
ref|WP_035243252.1|  translocation protein TolB                       72.4    3e-11    
ref|WP_041455426.1|  hypothetical protein                             69.7    3e-11    
ref|WP_035222753.1|  translocation protein TolB                       72.4    3e-11    
ref|WP_035047731.1|  translocation protein TolB                       72.4    4e-11    
ref|WP_038028868.1|  translocation protein TolB                       72.0    4e-11    
ref|WP_034307572.1|  translocation protein TolB                       72.8    4e-11    
ref|WP_014247215.1|  periplasmic protein of the Tol-Pal system        72.4    4e-11    
ref|WP_038321358.1|  hypothetical protein                             71.2    4e-11    
ref|WP_042703626.1|  translocation protein TolB                       71.6    4e-11    
gb|AGC72141.1|  tolB protein precursor, periplasmic protein invol...  72.0    4e-11    
gb|EYE99209.1|  TolB, C-terminal domain-containing protein            72.4    4e-11    
ref|WP_009763441.1|  tol-pal system beta propeller repeat protein...  72.0    4e-11    
ref|WP_008626827.1|  tolB protein precursor, periplasmic protein ...  72.4    4e-11    
ref|WP_027390703.1|  hypothetical protein                             72.0    4e-11    
ref|WP_011162787.1|  translocation protein TolB                       72.0    4e-11    
ref|WP_029907214.1|  translocation protein TolB                       72.0    4e-11    
ref|WP_010263042.1|  translocation protein TolB                       72.0    4e-11    
ref|WP_043785949.1|  translocation protein TolB                       72.8    4e-11    
gb|KIN05407.1|  hypothetical protein OIDMADRAFT_39656                 72.4    4e-11    
gb|ABF42485.1|  WD40-like beta Propeller                              71.6    4e-11    
ref|WP_041726769.1|  hypothetical protein                             70.9    5e-11    
ref|WP_028038046.1|  translocation protein TolB                       72.0    5e-11    
gb|EAS20779.1|  putative periplasmic component of the Tol biopoly...  71.6    5e-11    
sp|A7HV03.1|TOLB_PARL1  RecName: Full=Protein TolB; Flags: Precursor  72.0    5e-11    
ref|WP_023386598.1|  translocation protein TolB                       72.0    5e-11    
ref|WP_010267163.1|  translocation protein TolB                       72.0    5e-11    
ref|WP_035071525.1|  translocation protein TolB                       72.0    5e-11    
ref|WP_020186384.1|  translocation protein TolB                       71.6    5e-11    
ref|WP_041856891.1|  hypothetical protein                             71.2    5e-11    
ref|WP_028036323.1|  translocation protein TolB                       72.0    5e-11    
ref|WP_041536626.1|  translocation protein TolB                       71.6    5e-11    
ref|WP_037351878.1|  translocation protein TolB                       71.6    5e-11    
dbj|GAK68872.1|  protein TolB                                         71.6    5e-11    
ref|WP_040003083.1|  hypothetical protein                             71.6    5e-11    
ref|WP_023854308.1|  tol-pal system beta propeller repeat protein...  71.6    5e-11    
gb|ABW31820.1|  WD40-like Beta Propeller, putative                    71.2    6e-11    
ref|WP_010940703.1|  translocation protein TolB                       71.6    6e-11    
ref|XP_010262814.1|  PREDICTED: uncharacterized protein LOC104601238  66.2    6e-11    
gb|EJQ51187.1|  hypothetical protein IEQ_02127                        68.2    6e-11    
gb|AEI63304.1|  beta-propeller repeat-containing to-pal system pr...  71.2    6e-11    
ref|WP_030247898.1|  hypothetical protein                             71.6    6e-11    
ref|WP_014240516.1|  periplasmic protein of the Tol-Pal system        71.6    6e-11    
ref|WP_043709552.1|  tolB protein precursor protein                   71.2    6e-11    
dbj|GAK52271.1|  WD40-like Beta Propeller                             71.6    6e-11    
ref|WP_012880966.1|  translocation protein TolB                       71.6    6e-11    
ref|XP_002378780.1|  hypothetical protein AFLA_060360                 68.9    7e-11    
ref|WP_044602070.1|  hypothetical protein                             69.3    7e-11    
gb|ADU66304.1|  TolB protein                                          71.6    7e-11    
gb|EQB62921.1|  hypothetical protein RBG1_1C00001G0500                71.2    7e-11    



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 211/244 (86%), Gaps = 2/244 (1%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VKATVQIAR++FDP NLT++      EIPVEIKVLTKE TGNNAFPSCSPDGKH+VFRSG
Sbjct  421  VKATVQIARVSFDPLNLTNEDCAG--EIPVEIKVLTKEETGNNAFPSCSPDGKHVVFRSG  478

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++ GEL+GG IRQLT G WIDTMPSWSPDGKLIAFSSNRHNP N  CFS
Sbjct  479  RSGHKNLYIVDAIKGELEGGEIRQLTKGPWIDTMPSWSPDGKLIAFSSNRHNPDNITCFS  538

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVV PDGTGLRRI+VAG EGS+E ++ERLNHVCFS D EW+LFTANLGGVTAEPVS+PN
Sbjct  539  IYVVHPDGTGLRRIYVAGPEGSDEADKERLNHVCFSKDCEWLLFTANLGGVTAEPVSLPN  598

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEP  43
            Q+QPYGDLY+++LDG+GLQRLTWNGYENGTPAWHP A   +        G+KLRG+FD+ 
Sbjct  599  QYQPYGDLYLVKLDGSGLQRLTWNGYENGTPAWHPSATTTVEVKRSLLVGDKLRGEFDDV  658

Query  42   LWIN  31
            LW+N
Sbjct  659  LWMN  662



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 188/246 (76%), Positives = 215/246 (87%), Gaps = 6/246 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V+ATVQIAR++FD  +LT++      EIPVEIKVLTKE TGNNAFPSCSPDGKH+VFRSG
Sbjct  458  VQATVQIARVSFDSLDLTNEDCAR--EIPVEIKVLTKEETGNNAFPSCSPDGKHVVFRSG  515

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++ GEL+GG I QLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFS
Sbjct  516  RSGHKNLYIVDAVKGELEGGEICQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNITCFS  575

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVV PDGTGLRRIHVAG EGS+EV++ERLNHVCFS D EW+LFTANLGGVTAEPVS+PN
Sbjct  576  IYVVHPDGTGLRRIHVAGPEGSDEVDKERLNHVCFSKDCEWLLFTANLGGVTAEPVSLPN  635

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA--EVDLARLSLGKSGEKLRGKFD  49
            Q+QPYGDLY+++LDG+GLQRLTWNGYENGTPAWHP A   VD+ R  L   G+KLRG+FD
Sbjct  636  QYQPYGDLYLVKLDGSGLQRLTWNGYENGTPAWHPSATITVDVKRSLL--VGDKLRGEFD  693

Query  48   EPLWIN  31
            + LW+N
Sbjct  694  DVLWMN  699



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score =   377 bits (969),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/247 (74%), Positives = 215/247 (87%), Gaps = 7/247 (3%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VKATVQIAR++F+  NLT+D      +IPVEI+VLTKE TGNNAFPSCSPDGKHIVFRSG
Sbjct  455  VKATVQIARVSFNSLNLTNDDCG---KIPVEIEVLTKEETGNNAFPSCSPDGKHIVFRSG  511

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++ GEL+GGGIRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFS
Sbjct  512  RSGHKNLYIMDAVKGELEGGGIRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNVTCFS  571

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+ P+GTGLRRIHVAG EGS+EV++ERLNHVCFS D EW+LFT NLGGVTAEPVS+PN
Sbjct  572  IYVIHPNGTGLRRIHVAGPEGSDEVDKERLNHVCFSKDCEWLLFTGNLGGVTAEPVSLPN  631

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS---GEKLRGKF  52
            Q+QPYGDLY+++LDG+GL+RLT N YENGTPAWHP A + +  L + ++   G+KLRG+F
Sbjct  632  QYQPYGDLYLVKLDGSGLRRLTCNAYENGTPAWHPSA-MPMTALDIERNVIVGDKLRGEF  690

Query  51   DEPLWIN  31
            D+ LW+N
Sbjct  691  DDVLWMN  697



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score =   377 bits (968),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 213/248 (86%), Gaps = 9/248 (4%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VKATVQIAR++F+  NLT+D      EIPVEI+VLTKE TGNNAFPSCSPDGKHIVFRSG
Sbjct  454  VKATVQIARVSFNSLNLTNDDCG---EIPVEIEVLTKEETGNNAFPSCSPDGKHIVFRSG  510

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+DS+ GEL+GGGIRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFS
Sbjct  511  RSGHKNLYIMDSVKGELEGGGIRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNVTCFS  570

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+ P+GTGLRRIHVAG EGS+EV++ERLNHVCFS D EW+LFT NLGGVTAEPVS+PN
Sbjct  571  IYVIHPNGTGLRRIHVAGPEGSDEVDKERLNHVCFSKDCEWLLFTGNLGGVTAEPVSLPN  630

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK----AEVDLARLSLGKSGEKLRGK  55
            Q+QPYGDLY+++LDG+GL++LT N YENGTPAWHP       +D+ R  +   G+KLRG+
Sbjct  631  QYQPYGDLYLVKLDGSGLRQLTCNAYENGTPAWHPSGTPMTALDIERNVI--VGDKLRGE  688

Query  54   FDEPLWIN  31
            FD+ LW+N
Sbjct  689  FDDVLWMN  696



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 219/248 (88%), Gaps = 6/248 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VKATVQIAR++FDPS L DD +    +IP ++K+LT+E TGNNAFPSCSPDGK +VFRSG
Sbjct  435  VKATVQIARISFDPSYLDDDRE----DIPADVKILTREETGNNAFPSCSPDGKSVVFRSG  490

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSG+KNLYIID++NGEL+GG IRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N + FS
Sbjct  491  RSGNKNLYIIDAVNGELEGG-IRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNLNAFS  549

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+RPDG+ LRR++VAG+EGS +V+RER+NHVCFS D EW+LF ANLGG+TAEP+S+PN
Sbjct  550  IYVIRPDGSDLRRVYVAGSEGSVDVDRERINHVCFSADCEWLLFAANLGGMTAEPISLPN  609

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDE  46
            QFQPYGDL+++RLDG+GL+RLTWNGYENGTPAWH   EVD+ R+ LG ++G+KL G+FDE
Sbjct  610  QFQPYGDLFVVRLDGSGLKRLTWNGYENGTPAWHTGNEVDMGRMCLGSENGDKLTGEFDE  669

Query  45   PLWINSDF  22
            PLWI+ + 
Sbjct  670  PLWISCEL  677



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score =   375 bits (963),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 219/248 (88%), Gaps = 6/248 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VKATVQIAR++FDPS L    DDD ++IP ++K+LT+E TGNNAFPSCSPDGK +VFRSG
Sbjct  435  VKATVQIARISFDPSYL----DDDREDIPADVKILTREETGNNAFPSCSPDGKSVVFRSG  490

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSG+KNLYIID++NGEL+GG IRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N + FS
Sbjct  491  RSGNKNLYIIDAVNGELEGG-IRQLTEGXWIDTMPSWSPDGKLIAFSSNRHNPDNLNAFS  549

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+RPDG+ LRR++VAG+EGS +V+RER+NHVCFS D EW+LF ANLGG TAEP+S+PN
Sbjct  550  IYVIRPDGSDLRRVYVAGSEGSVDVDRERINHVCFSADCEWLLFAANLGGXTAEPISLPN  609

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDE  46
            QFQPYGDL+++RLDG+GL+RLTWNGYENGTPAWH   EVD+ R+ LG ++G+KL G+FDE
Sbjct  610  QFQPYGDLFVVRLDGSGLKRLTWNGYENGTPAWHTGNEVDMGRMCLGSENGDKLTGEFDE  669

Query  45   PLWINSDF  22
            PLWI+ + 
Sbjct  670  PLWISCEL  677



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/249 (71%), Positives = 213/249 (86%), Gaps = 9/249 (4%)
 Frame = -1

Query  759  KATVQIARLTF--DPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRS  586
            +ATVQIAR++F  DPS+     D++ +EIP ++K+LTKE TGNNAFPSCSPDGK +VFRS
Sbjct  400  RATVQIARVSFQLDPSD-----DNNREEIPCDVKILTKEETGNNAFPSCSPDGKFLVFRS  454

Query  585  GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  406
            GRSGHKNL+++D++NGE +G  IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + F
Sbjct  455  GRSGHKNLFVLDAVNGEFNGD-IRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAF  513

Query  405  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            S+YV++PDG+GLRRIHVAG EGS +V+RER+NHVCFS D EW+LFTANLG V AEPVS P
Sbjct  514  SLYVIKPDGSGLRRIHVAGPEGSGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWP  573

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFD  49
            NQFQPYGDLY+++LDG+GL+RLTWNGYENGTPAWHP  ++DL +L L    G+KLRG+FD
Sbjct  574  NQFQPYGDLYVVKLDGSGLRRLTWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFD  633

Query  48   EPLWINSDF  22
            EPLWI+ DF
Sbjct  634  EPLWISCDF  642



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score =   367 bits (941),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 176/249 (71%), Positives = 213/249 (86%), Gaps = 9/249 (4%)
 Frame = -1

Query  759  KATVQIARLTF--DPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRS  586
            +ATVQIAR++F  DPS+     D++ +EIP ++K+LTKE TGNNAFPSCSPDGK +VFRS
Sbjct  458  RATVQIARVSFQLDPSD-----DNNREEIPCDVKILTKEETGNNAFPSCSPDGKFLVFRS  512

Query  585  GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  406
            GRSGHKNL+++D++NGE +G  IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + F
Sbjct  513  GRSGHKNLFVLDAVNGEFNGD-IRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAF  571

Query  405  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            S+YV++PDG+GLRRIHVAG EGS +V+RER+NHVCFS D EW+LFTANLG V AEPVS P
Sbjct  572  SLYVIKPDGSGLRRIHVAGPEGSGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWP  631

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFD  49
            NQFQPYGDLY+++LDG+GL+RLTWNGYENGTPAWHP  ++DL +L L    G+KLRG+FD
Sbjct  632  NQFQPYGDLYVVKLDGSGLRRLTWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFD  691

Query  48   EPLWINSDF  22
            EPLWI+ DF
Sbjct  692  EPLWISCDF  700



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/249 (71%), Positives = 213/249 (86%), Gaps = 9/249 (4%)
 Frame = -1

Query  759  KATVQIARLTF--DPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRS  586
            +ATVQIAR++F  DPS+     D++ +EIP ++K+LTKE TGNNAFPSCSPDGK +VFRS
Sbjct  458  RATVQIARVSFQLDPSD-----DNNREEIPCDVKILTKEETGNNAFPSCSPDGKFLVFRS  512

Query  585  GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  406
            GRSGHKNL+++D++NGE +G  IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + F
Sbjct  513  GRSGHKNLFVLDAVNGEFNGD-IRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAF  571

Query  405  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            S+YV++PDG+GLRRIHVAG EGS +V+RER+NHVCFS D EW+LFTANLG V AEPVS P
Sbjct  572  SLYVIKPDGSGLRRIHVAGPEGSGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWP  631

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFD  49
            NQFQPYGDLY+++LDG+GL+RLTWNGYENGTPAWHP  ++DL +L L    G+KLRG+FD
Sbjct  632  NQFQPYGDLYVVKLDGSGLRRLTWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFD  691

Query  48   EPLWINSDF  22
            EPLWI+ DF
Sbjct  692  EPLWISCDF  700



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score =   363 bits (932),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 209/250 (84%), Gaps = 11/250 (4%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             +A VQIAR+TFDPS+++DD D    EIPVEIK+LTKE TGNNAFP CSPDGK +VFRSG
Sbjct  413  ARAAVQIARVTFDPSHMSDDRD----EIPVEIKILTKEETGNNAFPCCSPDGKSVVFRSG  468

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++NGEL+GG +RQLTDG WIDTMPSWSPDGKLIAFSSNRHNP N   F 
Sbjct  469  RSGHKNLYIMDAVNGELEGGMVRQLTDGNWIDTMPSWSPDGKLIAFSSNRHNPENEGAFG  528

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IY+V P+G G+RR+ VA  E  EE  RERLNHVCFS D EW+LFT+NLGGVTAEPVSIPN
Sbjct  529  IYLVEPNGKGVRRVQVAVIE--EE--RERLNHVCFSADGEWLLFTSNLGGVTAEPVSIPN  584

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL--GKSGE-KLRGKF  52
            QFQPYGD+Y++RLDG+GLQRLTWNGYENGTPAWHP   + L+ LSL   K GE KL+G+F
Sbjct  585  QFQPYGDMYLVRLDGSGLQRLTWNGYENGTPAWHPTPGLSLSALSLEGNKDGEDKLKGQF  644

Query  51   DEPLWINSDF  22
            DEPLWI  D 
Sbjct  645  DEPLWILCDL  654



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 207/248 (83%), Gaps = 6/248 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VK TVQ+AR+TFDPS+   D +    EIP ++K+LT+E TGNNAFPSCSPDGK +VFRSG
Sbjct  461  VKTTVQVARITFDPSDFNGDLE----EIPCDVKMLTREDTGNNAFPSCSPDGKSLVFRSG  516

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++NGE +GG IR+LTDG WIDTMPSWSP G LIAFSSN HNP   D FS
Sbjct  517  RSGHKNLYILDAVNGEFNGG-IRKLTDGPWIDTMPSWSPSGDLIAFSSNMHNPDRVDAFS  575

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV++PDG+ LRRI VAG  GS +V+RER+NHVCFS D EW+LF  N+GGVT EPVS PN
Sbjct  576  IYVIKPDGSDLRRIFVAGPRGSSDVDRERINHVCFSQDGEWLLFATNIGGVTVEPVSWPN  635

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDE  46
            QFQPYGDLY++RLDG+GL+RLTWNG+ENGTPAWHP +E+D+ RL LG ++G KL+G F+E
Sbjct  636  QFQPYGDLYVVRLDGSGLRRLTWNGFENGTPAWHPWSELDMGRLCLGNEAGVKLKGDFEE  695

Query  45   PLWINSDF  22
            PLWI  DF
Sbjct  696  PLWITCDF  703



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score =   362 bits (928),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/249 (72%), Positives = 209/249 (84%), Gaps = 14/249 (6%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VK TVQIAR++F   NL DD      EIPV+IKVLT E TGNNAFPSCSPDGKHIVFRSG
Sbjct  416  VKTTVQIARVSFSSLNLNDD------EIPVDIKVLTGEETGNNAFPSCSPDGKHIVFRSG  469

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYIID++NGE++GG IRQLT+GAWIDTMP+WSPDGKLIAFSSN HNP + +CFS
Sbjct  470  RSGHKNLYIIDAVNGEMEGGEIRQLTNGAWIDTMPNWSPDGKLIAFSSNMHNPDDINCFS  529

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVV PDG+GLRRI+VAG EGSEEV++ERLNHVCFS DSEW+LFT NL GVTAEPVS+PN
Sbjct  530  IYVVHPDGSGLRRIYVAGPEGSEEVDKERLNHVCFSKDSEWLLFTGNLSGVTAEPVSLPN  589

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS------GEKLR  61
            QFQPYGDLY+++LDG+GL+RLT NGYENGTPAWH  +       + G++      GEKL+
Sbjct  590  QFQPYGDLYVVKLDGSGLRRLTCNGYENGTPAWH--SSTMPMETTTGETERNVLVGEKLK  647

Query  60   GKFDEPLWI  34
            G+FD+ LW+
Sbjct  648  GEFDDVLWM  656



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   363 bits (933),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/250 (72%), Positives = 211/250 (84%), Gaps = 10/250 (4%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            + TVQIAR+TFDP+NLT D D    EIPV+IK+LT E TGNNAFPSCSPDGK IVFRSGR
Sbjct  473  RTTVQIARVTFDPANLTADRDA---EIPVDIKILTNEDTGNNAFPSCSPDGKFIVFRSGR  529

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            SGHKNLYI+D++NGE +GG IR+LTDG WIDTMPSWSPDGK IAFSSN HNP + + FSI
Sbjct  530  SGHKNLYIVDAVNGEFNGGSIRRLTDGPWIDTMPSWSPDGKWIAFSSNMHNPDDVEHFSI  589

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            YV+  DG+GLRRI +AG EGS  ++RERLNHVC+S D EW+LFTANLGGVTAEPVS+PNQ
Sbjct  590  YVIGADGSGLRRIRIAGNEGSGRLDRERLNHVCWSADCEWLLFTANLGGVTAEPVSLPNQ  649

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK---AEVDLARL-SLGKS---GEKLR  61
            FQPYGDLYM+R+DGTGL+RLTWNGYENGTPAW+P     E+D+ RL +L +S   G+KL+
Sbjct  650  FQPYGDLYMVRVDGTGLRRLTWNGYENGTPAWYPTGGDVELDMGRLMNLKRSETVGDKLK  709

Query  60   GKFDEPLWIN  31
            G F EPLW++
Sbjct  710  GDFIEPLWLH  719



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score =   363 bits (932),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 212/250 (85%), Gaps = 10/250 (4%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VK+TVQIAR+TF+P ++     DD ++IP E+K+LTKE TGNNAFPSCSPDGK +VFRSG
Sbjct  471  VKSTVQIARVTFNPKDM-----DDREDIPAEVKILTKEETGNNAFPSCSPDGKFVVFRSG  525

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D+++GE +GG IRQLTDG WIDTMP+WSPDGKLI FSSNRHNP N + FS
Sbjct  526  RSGHKNLYIMDAVDGEFNGG-IRQLTDGPWIDTMPNWSPDGKLIVFSSNRHNPSNVEAFS  584

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IY++RPDGT LRR++VAG EGS E  RER+NHVCFSPDS W++FTANLGGV  EPVS+PN
Sbjct  585  IYLIRPDGTDLRRVYVAGVEGSAEAERERINHVCFSPDSLWLVFTANLGGVLTEPVSMPN  644

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP---KAEVDLARLSLGK-SGEKLRGK  55
            QFQPYGDLY++RLDG+GL+RLTWNGYENGTP W+    + ++D+ RLS+    G++L G+
Sbjct  645  QFQPYGDLYVVRLDGSGLKRLTWNGYENGTPTWNSTTGEMDMDMDRLSVETVVGDRLMGQ  704

Query  54   FDEPLWINSD  25
            FDEPLWI+ D
Sbjct  705  FDEPLWISCD  714



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   358 bits (920),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 205/243 (84%), Gaps = 5/243 (2%)
 Frame = -1

Query  750  VQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH  571
            VQIAR+ FDPS+LT D +    E+P ++K+LT E TGNNAFPSCSPDGK IVFRSGRSGH
Sbjct  413  VQIARIKFDPSDLTADKE----ELPCDVKILTLENTGNNAFPSCSPDGKSIVFRSGRSGH  468

Query  570  KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVV  391
            KNLYI+D++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N D F  YVV
Sbjct  469  KNLYIVDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPANIDAFGAYVV  528

Query  390  RPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQP  211
            RPDG+GLRRI ++G EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV++PNQFQP
Sbjct  529  RPDGSGLRRILISGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAMPNQFQP  588

Query  210  YGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWI  34
            YGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL+R+SL G+ G+KL G+F+EPLWI
Sbjct  589  YGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTADELDLSRMSLNGQDGDKLDGQFEEPLWI  648

Query  33   NSD  25
            + D
Sbjct  649  SCD  651



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score =   358 bits (920),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 207/251 (82%), Gaps = 18/251 (7%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VK TVQIAR++F   N+  D      EIPVEIKVLT E TGNNAFPSCSPDGKH+VFRSG
Sbjct  418  VKTTVQIARVSFSSLNVNSD------EIPVEIKVLTGEETGNNAFPSCSPDGKHLVFRSG  471

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSG+KNLYIID +NGE++GG +RQLT+GAWIDTMP+WSPDGKLIAFSSNRHNP + + FS
Sbjct  472  RSGYKNLYIIDGVNGEMEGGEVRQLTNGAWIDTMPNWSPDGKLIAFSSNRHNPNDINRFS  531

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVV PDG+GLRRI+VAG EGSEEV++ERLNHVCFS DSEW+LFT NL GVTAEPVS+PN
Sbjct  532  IYVVHPDGSGLRRIYVAGPEGSEEVDKERLNHVCFSKDSEWLLFTGNLSGVTAEPVSLPN  591

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA--------EVDLARLSLGKSGEK  67
            QFQPYGDLY+++LDG+GL+RLT NGYENGTPAWHP          E + + L     GEK
Sbjct  592  QFQPYGDLYVVKLDGSGLRRLTCNGYENGTPAWHPSTMPMETTAGETERSVL----VGEK  647

Query  66   LRGKFDEPLWI  34
            L+G+FD+ LW+
Sbjct  648  LKGEFDDLLWM  658



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 199/248 (80%), Gaps = 5/248 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             KATVQIAR+TFDP++L        +E+  E+KVLT+   GNNAF +CSPDG+++VFRSG
Sbjct  411  AKATVQIARVTFDPADL---DGSRDEEVKTEMKVLTRADAGNNAFAACSPDGRYLVFRSG  467

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++ GE  GGG+R+LT+G WIDTMP WSPDG+LIAFSSNRH+P N D F 
Sbjct  468  RSGHKNLYIVDAVEGETSGGGVRRLTEGEWIDTMPVWSPDGELIAFSSNRHDPSNPDVFG  527

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IY+VRPDGTGLRR+HVAG  GS EV RERLNHVCFSPDS W++F ANLG VTAEPVS+PN
Sbjct  528  IYLVRPDGTGLRRVHVAGPPGSAEVGRERLNHVCFSPDSRWLVFAANLGAVTAEPVSLPN  587

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV-DLARLSLGKS-GEKLRGKFD  49
             FQPYGDLY  RLDGTGL RLT+N YENGTP WH   +V  L  LSLG   GEKLRG+FD
Sbjct  588  HFQPYGDLYACRLDGTGLTRLTYNCYENGTPTWHSGGDVPSLGSLSLGPHVGEKLRGQFD  647

Query  48   EPLWINSD  25
            EPLWI  D
Sbjct  648  EPLWITFD  655



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score =   357 bits (915),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 204/247 (83%), Gaps = 5/247 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             +  VQIAR+ FDPS+LT D +    ++P ++K+LT E TGNNAFPSCSPDGK IVFRSG
Sbjct  409  ARIAVQIARIKFDPSDLTADKE----DLPCDVKILTLENTGNNAFPSCSPDGKSIVFRSG  464

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++NGE +GGGIR+LTDG WIDTMP WSP G LI FSSNRHNP N   F 
Sbjct  465  RSGHKNLYIVDAVNGESNGGGIRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPENTAVFG  524

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
             YVVRPDGTGLRRI ++G EGSEE  RER+NHV F+ D +W++F ANL GVTAEPV++PN
Sbjct  525  AYVVRPDGTGLRRIQISGPEGSEEAARERVNHVSFNKDGDWLVFAANLSGVTAEPVTMPN  584

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDE  46
            QFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL++L+L G+ G+KL G+F+E
Sbjct  585  QFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTADELDLSQLNLNGQDGDKLEGQFEE  644

Query  45   PLWINSD  25
            PLWI+ D
Sbjct  645  PLWISCD  651



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score =   357 bits (915),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 204/247 (83%), Gaps = 5/247 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             +  VQIAR+ FDPS+LT D +    ++P ++K+LT E TGNNAFPSCSPDGK IVFRSG
Sbjct  414  ARIAVQIARIKFDPSDLTADKE----DLPCDVKILTLENTGNNAFPSCSPDGKSIVFRSG  469

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++NGE +GGGIR+LTDG WIDTMP WSP G LI FSSNRHNP N   F 
Sbjct  470  RSGHKNLYIVDAVNGESNGGGIRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPENTAVFG  529

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
             YVVRPDGTGLRRI ++G EGSEE  RER+NHV F+ D +W++F ANL GVTAEPV++PN
Sbjct  530  AYVVRPDGTGLRRIQISGPEGSEEAARERVNHVSFNKDGDWLVFAANLSGVTAEPVTMPN  589

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDE  46
            QFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL++L+L G+ G+KL G+F+E
Sbjct  590  QFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTADELDLSQLNLNGQDGDKLEGQFEE  649

Query  45   PLWINSD  25
            PLWI+ D
Sbjct  650  PLWISCD  656



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score =   357 bits (915),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/247 (70%), Positives = 204/247 (83%), Gaps = 6/247 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR+TF PS+L  D +    E+  ++K+LT+E TGNNAFPSCSPDG+ +VFRSG
Sbjct  424  AKTTVQIARVTFKPSDLKSDHN----EVSCDVKILTREDTGNNAFPSCSPDGESLVFRSG  479

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYIID++ GE +GG IRQLT+G WIDTMPSWSP G LIAFSSNRHNP N + FS
Sbjct  480  RSGHKNLYIIDAVEGEFNGG-IRQLTEGPWIDTMPSWSPKGDLIAFSSNRHNPNNVNAFS  538

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+RPDG+GL+RIHVAG+EGS E  R R+NHVCFS D EW+LFT NLG VTAEPVS PN
Sbjct  539  IYVIRPDGSGLKRIHVAGSEGSSEGERGRINHVCFSRDGEWLLFTGNLGSVTAEPVSWPN  598

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGE-KLRGKFDE  46
            QFQPYGDL++ RLDG+GL RLTWNG+ENGTPAWHP++E++L  L L +  E KL G+FD+
Sbjct  599  QFQPYGDLHVTRLDGSGLSRLTWNGFENGTPAWHPRSELELDSLCLDEDVEDKLTGQFDD  658

Query  45   PLWINSD  25
            PLWIN D
Sbjct  659  PLWINCD  665



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score =   356 bits (914),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 203/243 (84%), Gaps = 5/243 (2%)
 Frame = -1

Query  750  VQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH  571
            VQIAR+ FDPS+LT D +    E+P ++K+LT + TGNNAFPSCSPDGK IVFRSGRSGH
Sbjct  411  VQIARIKFDPSDLTADKE----ELPCDVKILTLDNTGNNAFPSCSPDGKSIVFRSGRSGH  466

Query  570  KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVV  391
            KNLYI+D++NGE DGG IR+LT+G WIDTMP WSP G LI FSSNRHNP +   F  YVV
Sbjct  467  KNLYIVDAVNGESDGGEIRRLTEGEWIDTMPCWSPKGDLIGFSSNRHNPADTSAFGAYVV  526

Query  390  RPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQP  211
            RPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV++PNQFQP
Sbjct  527  RPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAMPNQFQP  586

Query  210  YGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWI  34
            YGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL+RLSL G+ G+KL G+F+EPLWI
Sbjct  587  YGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTVDELDLSRLSLNGQDGDKLEGQFEEPLWI  646

Query  33   NSD  25
            + D
Sbjct  647  SCD  649



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score =   355 bits (910),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 203/244 (83%), Gaps = 7/244 (3%)
 Frame = -1

Query  750  VQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH  571
            VQIAR+ FDPS+LT D +    E+P E+K LT + TGNNAFPSCSPDGK +VFRSGRSGH
Sbjct  364  VQIARIKFDPSDLTADKE----ELPCEVKYLTLDNTGNNAFPSCSPDGKSVVFRSGRSGH  419

Query  570  KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVV  391
            KNLY++D++NGE DG  IR+LTDG WIDTMP WSP G LI FSSNRHNP N + F +YVV
Sbjct  420  KNLYVVDAVNGESDG--IRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPANTEAFGVYVV  477

Query  390  RPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQP  211
            RPDG+GLRRI VAG EGSEE  RER+NHV F+ D +W++FTANLGGV AEPV++PNQFQP
Sbjct  478  RPDGSGLRRIQVAGPEGSEEAARERVNHVSFNKDGDWLVFTANLGGVMAEPVAMPNQFQP  537

Query  210  YGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWI  34
            YG+LY+++LDGTGL+RLTWNGYENGTP WH   +VDL++LSL G+ G+KL G+F+EPLWI
Sbjct  538  YGELYVVKLDGTGLRRLTWNGYENGTPTWHTVDDVDLSQLSLNGQDGDKLEGQFEEPLWI  597

Query  33   NSDF  22
            + D 
Sbjct  598  SCDI  601



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score =   355 bits (912),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 204/249 (82%), Gaps = 12/249 (5%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATVQIARL FD S            +  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR
Sbjct  417  KATVQIARLEFDLSG-------PEGGVKCDVKVLTREDTGNNAFPSCSPDGKWLVFRSGR  469

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            +GHKNLY +D++NGE  GGGIRQLTDG WIDTMPSWSP+G LIAFSSNRHNP N + FSI
Sbjct  470  TGHKNLYAVDAVNGEF-GGGIRQLTDGPWIDTMPSWSPNGDLIAFSSNRHNPDNVNAFSI  528

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+++PDG+GLRR+HVAG EGS EV+RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQ
Sbjct  529  YLIKPDGSGLRRVHVAGPEGSPEVDRERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQ  588

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS----GEKLRGKF  52
            FQPYG+LY++RLDG+GLQRLTWNG+ENGTPAWH   +V  + L  G S    G+KLRG+F
Sbjct  589  FQPYGELYVVRLDGSGLQRLTWNGFENGTPAWHSSDDVSPSDLRSGISEDWDGDKLRGQF  648

Query  51   DEPLWINSD  25
            +EPLWI+ D
Sbjct  649  EEPLWISCD  657



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 204/249 (82%), Gaps = 12/249 (5%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATVQIARL FD S            +  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR
Sbjct  461  KATVQIARLEFDLSG-------PEGGVKCDVKVLTREDTGNNAFPSCSPDGKWLVFRSGR  513

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            +GHKNLY +D++NGE  GGGIRQLTDG WIDTMPSWSP+G LIAFSSNRHNP N + FSI
Sbjct  514  TGHKNLYAVDAVNGEF-GGGIRQLTDGPWIDTMPSWSPNGDLIAFSSNRHNPDNVNAFSI  572

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+++PDG+GLRR+HVAG EGS EV+RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQ
Sbjct  573  YLIKPDGSGLRRVHVAGPEGSPEVDRERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQ  632

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS----GEKLRGKF  52
            FQPYG+LY++RLDG+GLQRLTWNG+ENGTPAWH   +V  + L  G S    G+KLRG+F
Sbjct  633  FQPYGELYVVRLDGSGLQRLTWNGFENGTPAWHSSDDVSPSDLRSGISEDWDGDKLRGQF  692

Query  51   DEPLWINSD  25
            +EPLWI+ D
Sbjct  693  EEPLWISCD  701



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 206/248 (83%), Gaps = 7/248 (3%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATVQIAR++FDP++LTDD +    E+PV +K+LT+   GNNAFP+CSPDGK +VFRSGR
Sbjct  412  KATVQIARISFDPNDLTDDRE----EVPVAVKILTRSDAGNNAFPACSPDGKSLVFRSGR  467

Query  579  SGHKNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            SG KNLYI+D++NGE DGG GIRQLT+G W DTMP+WSPDG+LIAFSSNRH P N D FS
Sbjct  468  SGQKNLYILDAVNGESDGGEGIRQLTEGKWTDTMPTWSPDGELIAFSSNRHAPSNPDVFS  527

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IY++RPDGTGLRR+HVAG  GS  V+RER+NHVCFSPDS+W+LFTANLG VT+EPVS PN
Sbjct  528  IYLIRPDGTGLRRVHVAGPAGSSYVDRERINHVCFSPDSKWLLFTANLGSVTSEPVSWPN  587

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKFD  49
            QFQPYGDLY+ RLDGTGL+RLT   YENGTPAW  +    DL  LSL   +G+KLRG+FD
Sbjct  588  QFQPYGDLYVCRLDGTGLRRLTCGSYENGTPAWSSRGGPDDLGSLSLRSPTGDKLRGQFD  647

Query  48   EPLWINSD  25
            EPLWI  D
Sbjct  648  EPLWITCD  655



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 203/243 (84%), Gaps = 5/243 (2%)
 Frame = -1

Query  750  VQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH  571
            VQIAR+ FDPS+LT D +    E+P ++K+LT + TGNNAFPSCSPDGK +VFRSGRSGH
Sbjct  412  VQIARIKFDPSDLTADKE----ELPCDVKILTLDNTGNNAFPSCSPDGKSVVFRSGRSGH  467

Query  570  KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVV  391
            KNLYI+D++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVV
Sbjct  468  KNLYILDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVV  527

Query  390  RPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQP  211
            RPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV+IPNQFQP
Sbjct  528  RPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAIPNQFQP  587

Query  210  YGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWI  34
            YGDLY++++DGTGL+RLTWNGYE+GTP WH   E+DL RLSL G+ G+KL G+F+EPLWI
Sbjct  588  YGDLYIVKVDGTGLRRLTWNGYEDGTPTWHTVDELDLTRLSLNGQDGDKLGGQFEEPLWI  647

Query  33   NSD  25
            + D
Sbjct  648  SCD  650



>gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score =   355 bits (912),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/247 (72%), Positives = 203/247 (82%), Gaps = 6/247 (2%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            K TVQIAR+ FDPS+L  D +    EIP E+K+LT+E TGNNAFPSCSPDGK IVFRSGR
Sbjct  462  KTTVQIARVMFDPSHLNGDRE----EIPSEVKILTREDTGNNAFPSCSPDGKSIVFRSGR  517

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            SGHKNLYIID++ GE +G  +RQLT+GAWIDTMPSWSP G LIAFSSNRHNP N   FSI
Sbjct  518  SGHKNLYIIDTVYGEFNGT-VRQLTNGAWIDTMPSWSPKGDLIAFSSNRHNPDNPAVFSI  576

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            YV++PDG+ LRRIHVAGAEGS EV RER+NHVCFS D EW+LF +NL  VTAEPVS  NQ
Sbjct  577  YVIKPDGSDLRRIHVAGAEGSSEVVRERINHVCFSKDGEWLLFASNLDSVTAEPVSWANQ  636

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEP  43
            FQPYGDL+++RLDG+GL+RLT NGYENGTPAW    E+DL RLSL K  G+KL G+FDEP
Sbjct  637  FQPYGDLHVVRLDGSGLRRLTCNGYENGTPAWFSGNELDLDRLSLDKQVGDKLTGQFDEP  696

Query  42   LWINSDF  22
            LWI+ D 
Sbjct  697  LWISCDL  703



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score =   353 bits (907),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 202/243 (83%), Gaps = 5/243 (2%)
 Frame = -1

Query  750  VQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH  571
            VQIAR+ FDPS+LT D +    E+P ++K+LT   TGNNAFPSCSPDGK IVFRSGRSGH
Sbjct  412  VQIARIKFDPSDLTADKE----ELPCDVKILTLANTGNNAFPSCSPDGKSIVFRSGRSGH  467

Query  570  KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVV  391
            KNLYIID++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVV
Sbjct  468  KNLYIIDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVV  527

Query  390  RPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQP  211
            RPDG+GLRRI +AG EGSEE  RER+NHV F+ + +W++FTANL G+TAEPV+IPNQFQP
Sbjct  528  RPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKEGDWIVFTANLCGITAEPVAIPNQFQP  587

Query  210  YGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWI  34
            YGDLY++++DGTGL+RLTWNGYE+GTP WH   E+DL +LSL G+ G+KL G+F+EPLWI
Sbjct  588  YGDLYVVKVDGTGLRRLTWNGYEDGTPTWHTVDELDLTQLSLNGQDGDKLEGQFEEPLWI  647

Query  33   NSD  25
            + D
Sbjct  648  SCD  650



>gb|KJB09508.1| hypothetical protein B456_001G146700 [Gossypium raimondii]
Length=710

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 203/248 (82%), Gaps = 6/248 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR+TF+PS L  D      EIP ++K+LT+E TGNNAFPSCSPDGK +VFRSG
Sbjct  467  TKTTVQIARVTFEPSYLNSDLQ----EIPCDVKILTREDTGNNAFPSCSPDGKSLVFRSG  522

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++NGE + G IR+LT G WIDTMPSWSP+G LIAFSSN HNP N D FS
Sbjct  523  RSGHKNLYILDAVNGEFNDG-IRKLTAGPWIDTMPSWSPNGDLIAFSSNMHNPNNVDAFS  581

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV++PDG+ LRRI+ AG +GS +V+ ER+NHVCFSP+ EW++F AN+GGVTAEPVS PN
Sbjct  582  IYVIKPDGSDLRRIYAAGPKGSSDVDMERINHVCFSPNGEWLVFAANIGGVTAEPVSFPN  641

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDE  46
            QFQPYGDLY+MRLDG+GL+RLT +GYENGTP WH   E+D+ RL LG  +G +L G FDE
Sbjct  642  QFQPYGDLYVMRLDGSGLRRLTCDGYENGTPTWHFGGELDMRRLCLGNDAGVELTGGFDE  701

Query  45   PLWINSDF  22
            PLWI SDF
Sbjct  702  PLWITSDF  709



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 205/252 (81%), Gaps = 6/252 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            VKATVQIAR+TFD  +   +GD    +I  ++K+LT+E TGNNAFPSCSPDGK +VFRSG
Sbjct  410  VKATVQIARVTFDFDSSEINGDRGDKDITCDVKILTREETGNNAFPSCSPDGKSLVFRSG  469

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++NGE DGG +RQLTDG WIDTMP WSP G LIAFSSNRHNP + + F+
Sbjct  470  RSGHKNLYILDAVNGEFDGGSLRQLTDGPWIDTMPCWSPKGDLIAFSSNRHNPDDVNAFN  529

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+  DG+ LRRI++AG EGS + +RER+NHVCFS D EW+LFTANLGGVTAEPV+ PN
Sbjct  530  IYVITSDGSELRRIYLAGPEGSGDADRERINHVCFSEDGEWLLFTANLGGVTAEPVTWPN  589

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEVDLARLSLGKS----GEKLR  61
            QFQPYGDLYM+RLDG+GL+RLTWNGYENGTPAW    + +VD+  LSL       GE+LR
Sbjct  590  QFQPYGDLYMVRLDGSGLRRLTWNGYENGTPAWKNFGRDDVDMGPLSLAGDDRLVGEELR  649

Query  60   GKFDEPLWINSD  25
            G+FDEPLWI  D
Sbjct  650  GQFDEPLWITCD  661



>gb|KCW58167.1| hypothetical protein EUGRSUZ_H008852, partial [Eucalyptus grandis]
Length=276

 Score =   337 bits (864),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 198/250 (79%), Gaps = 12/250 (5%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            K TVQIAR+ FD S           ++  ++KVLT+E TGNNAFP+CSPDGK +VFRSGR
Sbjct  35   KTTVQIARIKFDLSG-------PERDVACDVKVLTREDTGNNAFPACSPDGKWLVFRSGR  87

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            +GHKNL+I+D+ NGE DGG IRQLTDG WIDTMPSWSP+  LIAFSSNRHN G+A  FSI
Sbjct  88   TGHKNLFIVDAANGEFDGG-IRQLTDGPWIDTMPSWSPNNDLIAFSSNRHNSGDASTFSI  146

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y++RPDG+ LRR+H+AG EGS EV+RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQ
Sbjct  147  YLIRPDGSDLRRVHLAGPEGSPEVDRERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQ  206

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL----ARLSLGKSGEKLRGKF  52
            FQPYG+LY+ RLDG+GL+RLTWNG+ENGTPAWH    V L    +    G   +KLRG+F
Sbjct  207  FQPYGELYVARLDGSGLKRLTWNGFENGTPAWHSTHAVGLGDPWSATGEGWDEDKLRGQF  266

Query  51   DEPLWINSDF  22
            +EPLWI+ + 
Sbjct  267  EEPLWISCNI  276



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 202/245 (82%), Gaps = 6/245 (2%)
 Frame = -1

Query  753  TVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSG  574
            +VQIAR+ FDP NL  D +    EIP E+K LT E TGNNAFPSCSPDGK +VFRSGRSG
Sbjct  407  SVQIARVKFDPVNLVADKE----EIPCEVKFLTLENTGNNAFPSCSPDGKSVVFRSGRSG  462

Query  573  HKNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIY  397
            +KNLYI+D++NGE +GG GIR+LT+G WIDTMP WSP G LI FSSNRHNP N + F  Y
Sbjct  463  YKNLYILDAVNGESNGGDGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPTNTEAFGAY  522

Query  396  VVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQF  217
            VVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQF
Sbjct  523  VVRPDGSGLRRIEIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLGGITAEPVTIPNQF  582

Query  216  QPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPL  40
            QPYGDLY++++DGTGL+RLTWNGYE+GTP WH   ++DL+ LSL G+ G+KL G+F+EPL
Sbjct  583  QPYGDLYVVKVDGTGLKRLTWNGYEDGTPTWHSVDDLDLSGLSLNGQDGDKLEGQFEEPL  642

Query  39   WINSD  25
            WI  D
Sbjct  643  WITCD  647



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score =   348 bits (893),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 203/249 (82%), Gaps = 8/249 (3%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K  VQIAR+ FDPS+LTDD +    EIP E+K+LT+E TGNNAFPSCSPDGK +VFRSG
Sbjct  407  AKTAVQIARIKFDPSDLTDDKE----EIPCEVKILTEEDTGNNAFPSCSPDGKSVVFRSG  462

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RS HKNLYI+D++ GE   GGIR+LT+G WIDTMP WSP G LIAFSSNRHN GN + F 
Sbjct  463  RSSHKNLYIVDAIAGE--SGGIRRLTEGPWIDTMPCWSPKGDLIAFSSNRHNQGNTEGFG  520

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
             YVVRPDG+G+RRI VAG EGSEE  RER+NH+ FS D EW++FTANLGGVT EPV++PN
Sbjct  521  AYVVRPDGSGVRRIKVAGTEGSEEAERERINHLSFSKDGEWLVFTANLGGVTVEPVAVPN  580

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH-PKAEVDLARLSL-GKSGEKLRGKFD  49
            QFQPYG++Y++R+DGTGL+RLTWNGYE+GTP WH    E+DL RLSL G+ G+KL G+ D
Sbjct  581  QFQPYGEVYVVRVDGTGLRRLTWNGYEDGTPTWHTADDELDLTRLSLDGQDGDKLTGQID  640

Query  48   EPLWINSDF  22
            EPLWI+ D 
Sbjct  641  EPLWISCDL  649



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score =   347 bits (891),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 202/248 (81%), Gaps = 6/248 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V ATVQIAR+T +  +L D   D   E+  E+K+LTK+ TGNNAFP+CSPDGK +VFRSG
Sbjct  404  VTATVQIARITINSDDLKDGDSD---EVSSEVKILTKDDTGNNAFPACSPDGKFLVFRSG  460

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++ GE +G  +R+LTDGAWIDTMP+WSP G LI FSSN HNP N + FS
Sbjct  461  RSGHKNLYIVDAVKGEFEGE-LRRLTDGAWIDTMPNWSPRGDLIVFSSNMHNPKNTEAFS  519

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+RPDG+GLRR++VAG EGS EV+RER+NHVCFS D +W+LFTANL GVTAEPVS PN
Sbjct  520  IYVIRPDGSGLRRVYVAGPEGSSEVDRERINHVCFSRDGKWLLFTANLSGVTAEPVSWPN  579

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS--GEKLRGKFD  49
            QFQPYGDL+++RLDGTGL RLTWNGYENGTP W+  +EV L+ LSL     GEKL+G FD
Sbjct  580  QFQPYGDLFVVRLDGTGLSRLTWNGYENGTPTWYYGSEVALSGLSLKDEVVGEKLKGNFD  639

Query  48   EPLWINSD  25
            EPLWI  D
Sbjct  640  EPLWITFD  647



>ref|XP_011467073.1| PREDICTED: uncharacterized protein LOC105352244 [Fragaria vesca 
subsp. vesca]
Length=685

 Score =   347 bits (890),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 204/249 (82%), Gaps = 12/249 (5%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR+ FDPS+L  D +    +IP  +K+LT+E TGNNAF SCSPDGK +VFRSG
Sbjct  445  AKMTVQIARIEFDPSDLNGDKE----DIPCTVKILTREDTGNNAFASCSPDGKSLVFRSG  500

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            R+G+KNLY++D++NGE +GG I +LT+G  IDTMPSWSP G LIAFSSNRH P +A  FS
Sbjct  501  RTGNKNLYVVDAVNGEFNGG-IHRLTEGPCIDTMPSWSPKGDLIAFSSNRHKPEDAAVFS  559

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV++PDG+GLRRIHVAG    ++V+RER+NHVCFS D EW+LFTANLGGVTAEPVS PN
Sbjct  560  IYVIKPDGSGLRRIHVAG----DDVDRERINHVCFSNDGEWLLFTANLGGVTAEPVSFPN  615

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS---GEKLRGKF  52
            QFQPYGDLY MRLDG+GL RLTWNGYENGTP WH   +VDL RL LG++   G+KL+G+F
Sbjct  616  QFQPYGDLYTMRLDGSGLTRLTWNGYENGTPTWHTGDDVDLGRLRLGEACEVGDKLKGQF  675

Query  51   DEPLWINSD  25
            DEPLWI+ D
Sbjct  676  DEPLWISCD  684



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score =   345 bits (884),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 200/249 (80%), Gaps = 12/249 (5%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            K TVQIAR+ FD S           ++  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR
Sbjct  407  KTTVQIARIKFDLSG-------PERDVACDVKVLTREDTGNNAFPSCSPDGKWLVFRSGR  459

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            +GHKNL+I+D+ NGE DGG IRQLTDG WIDTMPSWSP+  LIAFSSNRHNPG+A  FSI
Sbjct  460  TGHKNLFIVDAANGEFDGG-IRQLTDGPWIDTMPSWSPNNDLIAFSSNRHNPGDASTFSI  518

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y++RPDG+ LRR+H+AG EGS EV+RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQ
Sbjct  519  YLIRPDGSDLRRVHLAGPEGSPEVDRERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQ  578

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL----ARLSLGKSGEKLRGKF  52
            FQPYG+LY++RLDG+GL+RLTWNG+ENGTPAWH    V L    +    G   +KLRG+F
Sbjct  579  FQPYGELYVVRLDGSGLKRLTWNGFENGTPAWHSMHAVGLGDPWSATGEGWDEDKLRGQF  638

Query  51   DEPLWINSD  25
            +EPLWI+ D
Sbjct  639  EEPLWISCD  647



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 201/244 (82%), Gaps = 6/244 (2%)
 Frame = -1

Query  750  VQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH  571
            VQIAR+ F PS+L DD D    E+P E+K LT + TGNNAFPSCSPDGK +VFRSGRSGH
Sbjct  410  VQIARIQFSPSDLIDDRD----EVPCEVKFLTLDNTGNNAFPSCSPDGKSVVFRSGRSGH  465

Query  570  KNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYV  394
            KNLYI+D++NGE +GG GIR+LT+GAWIDTMP WSP G LI FSSNRH+P N   F  YV
Sbjct  466  KNLYILDAVNGESEGGEGIRRLTEGAWIDTMPCWSPKGDLIGFSSNRHDPSNDAAFGAYV  525

Query  393  VRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQ  214
            VRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQ
Sbjct  526  VRPDGSGLRRIEIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLGGITAEPVAIPNQFQ  585

Query  213  PYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLW  37
            PYGDLY+++LDGTGL+RLTWNGYE+GTP WH   ++ L+ LSL G+ G+KL G+F+EPLW
Sbjct  586  PYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTVDDLGLSGLSLNGQDGDKLEGQFEEPLW  645

Query  36   INSD  25
            I  D
Sbjct  646  ITCD  649



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 201/248 (81%), Gaps = 6/248 (2%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             +  VQIAR+ F PS+L DD D    E+P E+K LT + TGNNAFPSCSPDGK +VFRSG
Sbjct  406  ARIAVQIARIQFSPSDLIDDRD----EVPCEVKFLTLDNTGNNAFPSCSPDGKSVVFRSG  461

Query  582  RSGHKNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  406
            RSGHKNLYI+D++NGE +GG GIR+LT+G WIDTMP WSP G LI FSSNRH+P N   F
Sbjct  462  RSGHKNLYILDAVNGESEGGEGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHDPSNDAAF  521

Query  405  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
              YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IP
Sbjct  522  GAYVVRPDGSGLRRIEIAGPEGSEEAARERVNHVSFNKDGDWIVFTANLGGITAEPVAIP  581

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFD  49
            NQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   ++ L+ LSL G+ G+KL G+F+
Sbjct  582  NQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTVDDLGLSGLSLNGQDGDKLEGQFE  641

Query  48   EPLWINSD  25
            EPLWI  D
Sbjct  642  EPLWITCD  649



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score =   341 bits (875),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/249 (68%), Positives = 204/249 (82%), Gaps = 7/249 (3%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            +KATVQIAR++FDPS+LTDD +     +PV +K+LT+   GNNAFP+CSPDGK +VFRSG
Sbjct  411  IKATVQIARISFDPSDLTDDREV----VPVAVKILTRSDAGNNAFPACSPDGKSLVFRSG  466

Query  582  RSGHKNLYIIDSLNGELDG-GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  406
            RSGHKNLYI+D++NGE DG  GIR+LT+G W DTMP WSPDG+LIAFSSNRH P + D F
Sbjct  467  RSGHKNLYILDAVNGESDGREGIRRLTEGEWTDTMPCWSPDGELIAFSSNRHAPTSPDVF  526

Query  405  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            SIY++RPDGTGLRR+HVAG  GS  V++ER+NHVCFS DS+W+LFTANLG VTAEPVS P
Sbjct  527  SIYLIRPDGTGLRRVHVAGPAGSCYVDKERVNHVCFSQDSKWLLFTANLGSVTAEPVSWP  586

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKF  52
            N FQPYGDL++ RLDGTGL+RLT + YENGTPAW  +    DL  LSL   +G+KL+G+F
Sbjct  587  NHFQPYGDLFLCRLDGTGLRRLTCDPYENGTPAWSSRGGPDDLETLSLRSPTGDKLQGQF  646

Query  51   DEPLWINSD  25
            DEPLWI  D
Sbjct  647  DEPLWITCD  655



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 202/250 (81%), Gaps = 12/250 (5%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR+ F+PS+L  D +    EIP  +K+LTKE TGNNAFPSCSPDGK +VFRSG
Sbjct  421  AKTTVQIARVEFNPSDLDGDKE----EIPCNVKILTKEDTGNNAFPSCSPDGKSLVFRSG  476

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            R+GHKNLYIID++NGE +G   R+LT+G  IDTMPSWSP G LIAFSSNRHNP +   F 
Sbjct  477  RTGHKNLYIIDAVNGEFNGDA-RRLTEGQCIDTMPSWSPKGDLIAFSSNRHNPDDVAVFG  535

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV++PDG+GLRR+H AG    ++V RER+NHVCFS D EW+LFTANLGGVTAEPVS+PN
Sbjct  536  IYVIKPDGSGLRRVHAAG----DDVERERINHVCFSKDGEWLLFTANLGGVTAEPVSLPN  591

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE-VDLARLSLGKS--GEKLRGKF  52
            QFQPYGDLY++RLDG+GL+RLTWNGYENGTPAW    E VD+ RL L     G+KL+G+F
Sbjct  592  QFQPYGDLYVVRLDGSGLRRLTWNGYENGTPAWLEGDEVVDMGRLRLENEVGGDKLKGRF  651

Query  51   DEPLWINSDF  22
            +EPLWI+ DF
Sbjct  652  EEPLWISCDF  661



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/255 (69%), Positives = 208/255 (82%), Gaps = 18/255 (7%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            +A+VQIAR+TFDP +L++D D    +IPV+IK+LTKE TGNN FPSCSPDGK +VFRSGR
Sbjct  414  RASVQIARVTFDPEHLSNDRD----KIPVDIKILTKEETGNNGFPSCSPDGKSVVFRSGR  469

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            SGHKNLYI+D++ GE++GG IRQLT+G WIDTMPSWSP+G+LIAFSSNRHNP N D F I
Sbjct  470  SGHKNLYIVDAIKGEVEGG-IRQLTEGPWIDTMPSWSPNGELIAFSSNRHNPDNVDAFGI  528

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+++PDGTGLRR+ VA  E  EE  RERLNHVCFS D EW+LF ANLGGVT EPV++PN 
Sbjct  529  YLIKPDGTGLRRVKVA--EFEEE--RERLNHVCFSGDGEWLLFAANLGGVTVEPVALPNH  584

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK------AEVDLARLSLGKSG---EK  67
            FQPYGDLY++RLDG+GL+RLTWNGYENGTPAWHP        E+ L  LSLG      E+
Sbjct  585  FQPYGDLYLVRLDGSGLRRLTWNGYENGTPAWHPNRVLGGAEELKLCGLSLGGGKKGEEE  644

Query  66   LRGKFDEPLWINSDF  22
            L+G+FDEPLWI  DF
Sbjct  645  LKGQFDEPLWIKCDF  659



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 ref|XP_004158170.1| PREDICTED: uncharacterized protein LOC101226808 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 199/248 (80%), Gaps = 11/248 (4%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V ATVQIAR+T +  +        SDE+  E+K+LTK+ TGNNAFP+CSPDGK +VFRSG
Sbjct  404  VTATVQIARITINSGD--------SDEVSNEVKILTKDNTGNNAFPACSPDGKFLVFRSG  455

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            R+GHKNLYI+D++ GE +G  +RQLTDG WIDTMP+WSP G LI FSSN HNP N + FS
Sbjct  456  RTGHKNLYIVDAMKGEFEGE-LRQLTDGPWIDTMPNWSPRGDLIVFSSNMHNPKNTEAFS  514

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+RPDG+GLRR++VAG EGS EV+RER+NHVCFS D  W+LFTANL GVTAEPVS+PN
Sbjct  515  IYVIRPDGSGLRRVYVAGPEGSSEVDRERINHVCFSRDGNWLLFTANLSGVTAEPVSLPN  574

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS--GEKLRGKFD  49
            QFQPYGDL+++RLDGTGL+RLT N YENGTP W+  +E+ L+ LSL     GEKL+G FD
Sbjct  575  QFQPYGDLFVVRLDGTGLRRLTCNAYENGTPTWYYGSELALSGLSLKDEVVGEKLKGDFD  634

Query  48   EPLWINSD  25
            EPLWI  D
Sbjct  635  EPLWIKFD  642



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score =   339 bits (869),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 202/250 (81%), Gaps = 12/250 (5%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR+ F+PS+L    D D +EIP  +K+LTKE TGNNAFPSCSPDGK +VFRSG
Sbjct  472  AKTTVQIARIEFNPSDL----DGDKEEIPCNVKILTKEDTGNNAFPSCSPDGKSLVFRSG  527

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            R+GHKNLYIID++NGE +G   R+LT+G  IDTMPSWSP G LIAFSSNRHNP +   F 
Sbjct  528  RTGHKNLYIIDAVNGEFNGDA-RRLTEGQCIDTMPSWSPKGDLIAFSSNRHNPDDVAVFG  586

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV++PDG+GLRR++ AG    ++V RER+NHVCFS D EW+LFTANLGGV AEPVS+PN
Sbjct  587  IYVIKPDGSGLRRVYAAG----DDVERERINHVCFSKDGEWLLFTANLGGVIAEPVSLPN  642

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW-HPKAEVDLARLSLGKS--GEKLRGKF  52
            QFQPYGDLY++RLDG+GL+RLTWNGYENGTPAW     EVD+ RL L     G+KL+G+F
Sbjct  643  QFQPYGDLYVVRLDGSGLRRLTWNGYENGTPAWLEGDEEVDMGRLRLDNEVGGDKLKGQF  702

Query  51   DEPLWINSDF  22
            +EPLWI+ DF
Sbjct  703  EEPLWISCDF  712



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score =   324 bits (831),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 196/250 (78%), Gaps = 12/250 (5%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR+ F PS+     D D +++P  +K LT E TGNNAFPSCSPDG  +VFRSG
Sbjct  421  AKTTVQIARVEFXPSDJ----DGDKEDVPCNVKXLTXEETGNNAFPSCSPDGMSLVFRSG  476

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            R+GHKNLYIID+++GE +G  +RQLT+G  IDTMPSWSP G LIAFSSNRHNP +A  F 
Sbjct  477  RTGHKNLYIIDAVDGEFNGS-VRQLTEGPCIDTMPSWSPKGDLIAFSSNRHNPDDAAVFG  535

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVV+PDGTGLRRI VAG E     +RER+NHVCFS D EW+LFTANL GV AEPVS+PN
Sbjct  536  IYVVKPDGTGLRRIPVAGNES----HRERINHVCFSKDXEWLLFTANLSGVIAEPVSLPN  591

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA-EVDLARLSLGKS--GEKLRGKF  52
            QFQPYGDLY++R DG+GL+RLTWNGYENGTPAWH    E+D+  L LG    G++L+G+F
Sbjct  592  QFQPYGDLYVVRXDGSGLRRLTWNGYENGTPAWHEGGDELDMGGLRLGNEVGGDELKGQF  651

Query  51   DEPLWINSDF  22
            ++P WI+ DF
Sbjct  652  EDPHWISCDF  661



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 198/250 (79%), Gaps = 12/250 (5%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR+ F PS+L    D D +++P  +K+LTKE TGNNAFPSCSPDG  +VFRSG
Sbjct  475  AKTTVQIARVEFHPSDL----DGDKEDVPCNVKMLTKEETGNNAFPSCSPDGMSLVFRSG  530

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            R+GHKNLYIID+++GE +   +RQLT+G  IDTMPSWSP G LI FSSNRHNP +A  F 
Sbjct  531  RTGHKNLYIIDAVDGEFNDS-VRQLTEGPCIDTMPSWSPKGDLIVFSSNRHNPDDAAVFG  589

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVV+PDGT LRRI VAG E     +RER+NHVCFS D EW+LFTANL GVTAEPVS PN
Sbjct  590  IYVVKPDGTDLRRIPVAGNES----HRERINHVCFSKDGEWLLFTANLSGVTAEPVSWPN  645

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA-EVDLARLSLGKS--GEKLRGKF  52
            QFQPYG+LY++RLDG+GL+RLTWNGYENGTPAWH    E+D+  L LG    G++L+G+F
Sbjct  646  QFQPYGELYVVRLDGSGLRRLTWNGYENGTPAWHEGGDELDMGGLRLGNEVGGDELKGRF  705

Query  51   DEPLWINSDF  22
            +EPLWI+ DF
Sbjct  706  EEPLWISCDF  715



>ref|NP_001060406.1| Os07g0638100 [Oryza sativa Japonica Group]
 dbj|BAC45195.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22320.1| Os07g0638100 [Oryza sativa Japonica Group]
Length=659

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 191/251 (76%), Gaps = 10/251 (4%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV+IARL FD   LT   D    E+   +KVLT+   GN+AFP+ SP GK +VFRSGR
Sbjct  412  KATVRIARLEFDAGELTTGRD----EVAATLKVLTRPEAGNDAFPAVSPCGKWVVFRSGR  467

Query  579  SGHKNLYIIDSLNGELDGGG---IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  409
            SGHKNLYI+D+ +GE  G G   IR+LTDG WIDTMPSWSPDG LIAFSSNRH+P NA  
Sbjct  468  SGHKNLYIVDAAHGEDVGAGEGTIRRLTDGEWIDTMPSWSPDGSLIAFSSNRHDPTNAAV  527

Query  408  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSI  229
            FSIY+VRPDG+GLRR+HVAG  GS   +RER+NHVCFSPDS W+LFTAN GGV AEP+S 
Sbjct  528  FSIYLVRPDGSGLRRVHVAGPAGSAAADRERINHVCFSPDSRWLLFTANFGGVMAEPISA  587

Query  228  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLRG  58
            PNQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P +     L  LSLG  +G++  G
Sbjct  588  PNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPASSPAAGLESLSLGPGAGDESLG  647

Query  57   KFDEPLWINSD  25
            +FDEPLW+  D
Sbjct  648  EFDEPLWLTCD  658



>ref|XP_003562594.1| PREDICTED: uncharacterized protein LOC100822199 [Brachypodium 
distachyon]
Length=674

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 198/250 (79%), Gaps = 8/250 (3%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV+IAR+ FDP+ L    D+++D++ V +KVLT+   GN+AFP+ SP G+ +VFRSGR
Sbjct  427  KATVRIARVEFDPAQL---RDNNNDKVDVALKVLTRPEAGNDAFPAVSPCGRWVVFRSGR  483

Query  579  SGHKNLYIIDSLNGELDGGG--IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  406
            SGHKNLYIID+ +GE +     I++LTDG WIDTMP W+PDGKL+AFSSNRH+PGNA  F
Sbjct  484  SGHKNLYIIDAAHGENEPATAPIQRLTDGEWIDTMPCWAPDGKLVAFSSNRHDPGNAAVF  543

Query  405  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            SIY+VRPDGTGLRR+HVAG  GSEE ++ER+NHVCFSPD EW+LFTANLGGV AEPVS P
Sbjct  544  SIYLVRPDGTGLRRVHVAGPPGSEEADKERINHVCFSPDGEWLLFTANLGGVNAEPVSGP  603

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG---KSGEKLRGK  55
            NQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P  +++    SLG    + E   G+
Sbjct  604  NQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPALDLEDGVGSLGLGNPAAEDSLGE  663

Query  54   FDEPLWINSD  25
            FDEPLW+  D
Sbjct  664  FDEPLWLTCD  673



>ref|XP_010679438.1| PREDICTED: uncharacterized protein LOC104894805 [Beta vulgaris 
subsp. vulgaris]
Length=668

 Score =   322 bits (825),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/259 (62%), Positives = 197/259 (76%), Gaps = 22/259 (8%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR+TF+ S+L  +  D  +   V+IK++TK+ TGNNAFP+CSPDGK +VFRSG
Sbjct  420  AKTTVQIARITFNASSLHPNHTDVDN---VKIKIMTKQDTGNNAFPACSPDGKLVVFRSG  476

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++ GE D   IRQLT+G WIDTMPSWSPDGKLIAFSSNRH+P N   F 
Sbjct  477  RSGHKNLYIMDAVEGE-DSNNIRQLTNGPWIDTMPSWSPDGKLIAFSSNRHDPSNMVTFG  535

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IY+V  DG+ L+R+HV+      +V  ER+NHVCFSP+ EW+LFTAN+GGVTAEPVS PN
Sbjct  536  IYLVAVDGSDLKRVHVS------DVAMERINHVCFSPNGEWLLFTANMGGVTAEPVSFPN  589

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSG----------  73
            QFQPYGDL++ +LDGTGL+RLTW+GYENGTPAWH +  +D+   +L   G          
Sbjct  590  QFQPYGDLFIAKLDGTGLRRLTWSGYENGTPAWHSRQLLDIPLGNLSLEGIEKADAHHQV  649

Query  72   --EKLRGKFDEPLWINSDF  22
              +KL+GKFDEPLWI  DF
Sbjct  650  DADKLKGKFDEPLWITCDF  668



>gb|EAZ04851.1| hypothetical protein OsI_27029 [Oryza sativa Indica Group]
Length=659

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/251 (65%), Positives = 190/251 (76%), Gaps = 10/251 (4%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV+IARL FD   LT   D    E+   +KVLT+   GN+AFP+ SP GK +VFRSGR
Sbjct  412  KATVRIARLEFDAGELTTGRD----EVAATLKVLTRPEAGNDAFPAVSPCGKWVVFRSGR  467

Query  579  SGHKNLYIIDSLNGELDGGG---IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  409
            SGHKNLYI+D+ +GE  G G   IR+LTDG WIDTMPSWSPDG LIAFSSNRH+P NA  
Sbjct  468  SGHKNLYIVDAAHGEDVGAGEGTIRRLTDGEWIDTMPSWSPDGSLIAFSSNRHDPTNAAV  527

Query  408  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSI  229
            FSIY+VRPDG+GLRR+HVAG  GS   +RER+NHVCFSPDS W+LFTAN GGV AEP+S 
Sbjct  528  FSIYLVRPDGSGLRRVHVAGPAGSAAADRERINHVCFSPDSRWLLFTANFGGVMAEPISA  587

Query  228  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLRG  58
            PNQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P +     L  LSL   +G++  G
Sbjct  588  PNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPASSPAAGLESLSLVPGAGDESLG  647

Query  57   KFDEPLWINSD  25
            +FDEPLW+  D
Sbjct  648  EFDEPLWLTCD  658



>ref|XP_006840287.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
 gb|ERN01962.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
Length=642

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 188/244 (77%), Gaps = 13/244 (5%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
             K TVQIAR++FD +NL     D  ++I  +IK+LTKE TGNNAFPSCSPDGK +VFRSG
Sbjct  409  AKMTVQIARISFDLTNL-----DSQEDITAKIKILTKEETGNNAFPSCSPDGKFLVFRSG  463

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D+ NGE   GGIRQLT+G WIDTMPSWSPDGK IAFSSNRH+P N + F 
Sbjct  464  RSGHKNLYIMDATNGE--DGGIRQLTEGPWIDTMPSWSPDGKFIAFSSNRHSPENTEVFG  521

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYV+ PDGTGLRR+HVA     E+++  R NHVCFSPDS+W+LFTAN G V+AEP+S+PN
Sbjct  522  IYVIHPDGTGLRRVHVA-----EDMDMVRTNHVCFSPDSKWLLFTANFGAVSAEPISLPN  576

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLGKSGEKLRGKFDE  46
            QFQPYGDLY+  L+GT L+RLT N YENGTPAWH      D+  L L   GE L+G F E
Sbjct  577  QFQPYGDLYVCGLEGTHLKRLTCNAYENGTPAWHSGDGGPDIGSLCLNDVGEDLKGDFGE  636

Query  45   PLWI  34
            P W+
Sbjct  637  PHWL  640



>ref|XP_008653395.1| PREDICTED: uncharacterized protein LOC103633477 [Zea mays]
 tpg|DAA63832.1| TPA: putative WD40-like beta propeller repeat family protein 
[Zea mays]
Length=667

 Score =   320 bits (820),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 197/247 (80%), Gaps = 5/247 (2%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV+IAR+ FDP++LTDDG  +  E+   ++ LT+   GN+AFP+ SP G+ +VFRSGR
Sbjct  423  KATVRIARVEFDPADLTDDGRGEG-EVRATVRPLTRPEAGNDAFPAVSPCGRWLVFRSGR  481

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            +GHKNLY++D+  GE   GG+R+LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FSI
Sbjct  482  TGHKNLYVVDTARGEE--GGVRRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFSI  539

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+VRPDG+GLRR++VAGAEGS E ++ER+NHVCFSPDS+W+LFTANLG V AEP+S PNQ
Sbjct  540  YLVRPDGSGLRRVYVAGAEGSAEADKERINHVCFSPDSQWLLFTANLGSVVAEPISGPNQ  599

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLG-KSGEKLRGKFDE  46
            FQPYGDLY+ RLDG+ L+RLT N YENGTP W P  A + L  LS+G  SGE   G+FDE
Sbjct  600  FQPYGDLYVCRLDGSDLRRLTCNAYENGTPVWGPASAGLGLESLSMGPPSGEDALGQFDE  659

Query  45   PLWINSD  25
            PLW+  D
Sbjct  660  PLWLTCD  666



>ref|XP_010456117.1| PREDICTED: uncharacterized protein LOC104737601 [Camelina sativa]
Length=426

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 174/208 (84%), Gaps = 4/208 (2%)
 Frame = -1

Query  756  ATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS  577
              VQIAR+ FDPS+LT D +    E+P ++K+LT + TGNNAFPSCSPDGK +VFRSGRS
Sbjct  212  VAVQIARIKFDPSDLTADKE----ELPCDVKILTLDNTGNNAFPSCSPDGKSVVFRSGRS  267

Query  576  GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIY  397
            GHKNLYI+D++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   F  Y
Sbjct  268  GHKNLYILDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAY  327

Query  396  VVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQF  217
            VVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W +FTANL G+TAEPV+IPNQF
Sbjct  328  VVRPDGSGLRRIQIAGLEGSEEAARERVNHVSFNKDGDWTVFTANLCGITAEPVAIPNQF  387

Query  216  QPYGDLYMMRLDGTGLQRLTWNGYENGT  133
            QPYGDLY++++DGTGL+RLTWNGYE+GT
Sbjct  388  QPYGDLYVVKVDGTGLRRLTWNGYEDGT  415



>dbj|BAJ89339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 190/246 (77%), Gaps = 10/246 (4%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV++AR+ FDPS LTDD      ++ V +K LT+   GN+AFP+ SP G+ +VFRSGR
Sbjct  417  KATVRVARIEFDPSELTDDRG----DVDVAVKELTRPEAGNDAFPAVSPCGRWVVFRSGR  472

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            SGHKNLYI+D+  GE     IR++TDG WIDTMPSWSPDG+LIAFSSNRH P NA  FSI
Sbjct  473  SGHKNLYIVDAARGEET---IRRVTDGEWIDTMPSWSPDGELIAFSSNRHEPANAAVFSI  529

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+VRPDGTGLRR+HVAG  GS E ++ER+NHVCFSPD +W+LFTANLGGV AEP+S PNQ
Sbjct  530  YLVRPDGTGLRRVHVAGPAGSAEADKERINHVCFSPDGQWLLFTANLGGVMAEPISGPNQ  589

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEP  43
            FQPYGDLY+ RLDG+G+ RLT N YENGTP W P   VD   LSLG  + +   G+FDEP
Sbjct  590  FQPYGDLYVCRLDGSGVLRLTCNAYENGTPTWGPALGVD--SLSLGAPAADDSLGQFDEP  647

Query  42   LWINSD  25
            LW+  +
Sbjct  648  LWLTCN  653



>ref|XP_002461097.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
 gb|EER97618.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
Length=669

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 194/247 (79%), Gaps = 5/247 (2%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV+IAR+ FDP++LTDD       +   ++ LT+   GN+AFP+ SP G+ +VFRSGR
Sbjct  425  KATVRIARVEFDPADLTDDDSRVEVGV-ATVRPLTRPEAGNDAFPAVSPCGRWLVFRSGR  483

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            +GHKNLY++D+  GE   GG+ +LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FSI
Sbjct  484  TGHKNLYVVDTARGE--DGGVLRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFSI  541

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+VRPDG+GLRR++VAG EGS E ++ER+NHVCFSPDS+W+LFTANLG V AEP+S PNQ
Sbjct  542  YLVRPDGSGLRRVYVAGPEGSAEADKERINHVCFSPDSQWLLFTANLGSVVAEPISGPNQ  601

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLG-KSGEKLRGKFDE  46
            FQPYGDLY+ RLDG+GL+RLT N YENGTPAW P  A + L  L++G  +GE   G+FDE
Sbjct  602  FQPYGDLYVCRLDGSGLRRLTCNAYENGTPAWGPASAGLGLESLAIGPPAGEDALGQFDE  661

Query  45   PLWINSD  25
            PLW+  D
Sbjct  662  PLWLTCD  668



>dbj|BAJ94262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   314 bits (805),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 189/246 (77%), Gaps = 10/246 (4%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV++AR+ FDPS LTDD      ++ V +K LT+   GN+AFP+ SP G+ +VFRSGR
Sbjct  417  KATVRVARIEFDPSGLTDDRG----DVDVAVKELTRPEAGNDAFPAVSPCGRWVVFRSGR  472

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            SGHKNLYI+D+  GE     IR++TDG WIDTMPSWSPDG+LIAFSSNRH P NA  FSI
Sbjct  473  SGHKNLYIVDAARGEET---IRRVTDGEWIDTMPSWSPDGELIAFSSNRHEPANAAVFSI  529

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+VRPDGTGLRR+HVAG  GS E ++ER+NHVCFSPD +W+LFTA LGGV AEP+S PNQ
Sbjct  530  YLVRPDGTGLRRVHVAGPAGSAEADKERINHVCFSPDGQWLLFTATLGGVMAEPISGPNQ  589

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEP  43
            FQPYGDLY+ RLDG+G+ RLT N YENGTP W P   VD   LSLG  + +   G+FDEP
Sbjct  590  FQPYGDLYVCRLDGSGVLRLTCNAYENGTPTWGPALGVD--SLSLGAPAADDSLGQFDEP  647

Query  42   LWINSD  25
            LW+  +
Sbjct  648  LWLTCN  653



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 195/254 (77%), Gaps = 20/254 (8%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V  TVQIAR+ FDP +LT+D +    E+P ++ +LT+E TGNNAFPSCSPDGK IVFRSG
Sbjct  462  VYKTVQIARIEFDPVHLTNDRE----EVPFKLTILTREDTGNNAFPSCSPDGKSIVFRSG  517

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            R G+KNLYI+D++ GE DGG IR+LT+G WIDTMP WSP G LIAFSSNRH+P N++ F 
Sbjct  518  REGYKNLYIVDAVKGEFDGG-IRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDPKNSEVFG  576

Query  402  IYVVRPDGTGLRRIHVA-GAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            IY+V P+G+GLRR+ VA G EG     +ERLNHVCFS D EW+LFTANLGGV+AEPV +P
Sbjct  577  IYLVGPNGSGLRRVEVAKGVEGM----KERLNHVCFSRDGEWLLFTANLGGVSAEPVGLP  632

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-------GKSGEK  67
            NQFQPYGDLY++RLDG+GL+RLT N YENGTP WH     DLA  +        G+  +K
Sbjct  633  NQFQPYGDLYVVRLDGSGLRRLTCNAYENGTPTWH---HGDLALCAPREDDGEGGQDWDK  689

Query  66   LRGKFDEPLWINSD  25
            L+G+F EPLWI  D
Sbjct  690  LKGEFQEPLWITCD  703



>ref|XP_004498256.1| PREDICTED: uncharacterized protein LOC101515113 [Cicer arietinum]
Length=652

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/247 (64%), Positives = 190/247 (77%), Gaps = 11/247 (4%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V  TVQIAR+ FDP +L     +D +EIP  I +LT+E TGNNAFPSCSPDGK +VFRSG
Sbjct  416  VFKTVQIARIEFDPVHL----REDCEEIPFTINILTREETGNNAFPSCSPDGKFVVFRSG  471

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSG+KNLYI+D+L+GE +GG +R+LT+G WIDTMP WSP G  IAFSSNRH+ GN++ F 
Sbjct  472  RSGYKNLYIMDALDGEFNGG-LRRLTEGEWIDTMPCWSPKGDWIAFSSNRHDAGNSEVFG  530

Query  402  IYVVRPDGTGLRRIHVA-GAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            IYVVRPDG+ LRR+ V  G +G     RERLNHVCFS D EW+LFTANLGGV AEPVS+P
Sbjct  531  IYVVRPDGSDLRRVEVGKGVDGE----RERLNHVCFSGDGEWLLFTANLGGVMAEPVSMP  586

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDE  46
            NQFQPYGDL+++RLDG+GL+RLT N YENGTP WH +    L R   G   + L+G F+E
Sbjct  587  NQFQPYGDLFVVRLDGSGLKRLTCNAYENGTPMWHAREGAALLRSGKGDE-DVLKGGFEE  645

Query  45   PLWINSD  25
            PLWI  +
Sbjct  646  PLWITCE  652



>ref|XP_004958463.1| PREDICTED: uncharacterized protein LOC101757241 [Setaria italica]
Length=666

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 193/250 (77%), Gaps = 8/250 (3%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV+IAR+ FDPS LTDD  + S      ++ LT+   GN+AFP+ SP G+ +VFRSGR
Sbjct  419  KATVRIARVEFDPSELTDDRKEVSA---ATVRALTRPEAGNDAFPAVSPCGRWLVFRSGR  475

Query  579  SGHKNLYIIDSLNGELDG---GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  409
            +GHKNLY+ID+  GE +      +R+LT+G WIDTMPSWSPDG LIAFSSNRH+P N   
Sbjct  476  TGHKNLYVIDTARGEEEEGGGAAVRRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAV  535

Query  408  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSI  229
            FSIY+VRPDG+ LRR++VAG EGS E ++ER+NHVCFSPDS W+LFTANLGGV AEPVS 
Sbjct  536  FSIYLVRPDGSRLRRVYVAGPEGSAEADKERINHVCFSPDSRWLLFTANLGGVMAEPVSG  595

Query  228  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLGK-SGEKLRGK  55
            PNQFQPYGDLY+ RLDG+GLQRLT N YENGTPAW P  A + +  +SLG  +GE   G+
Sbjct  596  PNQFQPYGDLYVCRLDGSGLQRLTCNAYENGTPAWGPSSAGLGVEAMSLGAPAGEDPMGQ  655

Query  54   FDEPLWINSD  25
            FDEPLW+  D
Sbjct  656  FDEPLWLTCD  665



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 191/250 (76%), Gaps = 14/250 (6%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V  TVQI R+ FDP + TDD +    E+P ++ +LT+E TGNNAFP+CSPDGK +VFRSG
Sbjct  447  VSKTVQIGRIEFDPVHFTDDRE----EVPFKLTILTREETGNNAFPACSPDGKSVVFRSG  502

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D + GE +GG IR+LT+GAWIDTMP WSP G LIAFSSNRH P N++ F 
Sbjct  503  RSGHKNLYIVDGVEGEFNGG-IRRLTEGAWIDTMPCWSPKGDLIAFSSNRHEPKNSEVFG  561

Query  402  IYVVRPDGTGLRRIHVA-GAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            IY+VRPDG+GLRR+ VA G EG     RERLNHV FS D EW++FTANLGGVTAEP+ +P
Sbjct  562  IYLVRPDGSGLRRVEVAMGVEGG----RERLNHVSFSGDGEWLVFTANLGGVTAEPIGLP  617

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGE---KLRGK  55
            NQFQPYGDLY++R+DG+GL+RLT N YENGTP WH   ++ L  +     GE   KL+ +
Sbjct  618  NQFQPYGDLYVVRVDGSGLRRLTCNAYENGTPTWH-NGDLVLCHVDGDGEGENWDKLKAE  676

Query  54   FDEPLWINSD  25
            F EPLWI  D
Sbjct  677  FAEPLWITCD  686



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 189/244 (77%), Gaps = 20/244 (8%)
 Frame = -1

Query  753  TVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSG  574
            TVQIAR+TF  ++L+DD D    EIPV+IK LTKE TGNNAFPSCSPDGK +VFRSGRSG
Sbjct  409  TVQIARVTFQRADLSDDRD----EIPVDIKFLTKENTGNNAFPSCSPDGKSVVFRSGRSG  464

Query  573  HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYV  394
            HKNL+++D+L GE  GG IRQLTDG WIDTMP WSPDGKLIAFSSNRH       F IY+
Sbjct  465  HKNLFVVDALEGEF-GGDIRQLTDGPWIDTMPCWSPDGKLIAFSSNRHTSKEG-AFGIYL  522

Query  393  VRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQ  214
            +  DG+GLRR+  AG++  EE  RERLNHVCFSPDSEW+LFT+N  GVTAEPVS+PN FQ
Sbjct  523  INSDGSGLRRVKFAGSD--EE--RERLNHVCFSPDSEWLLFTSNFAGVTAEPVSLPNHFQ  578

Query  213  PYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK----SGEKLRGKFDE  46
            PYGDLY  RLDG+GL+RLT+NGYENGTPAW      D   L + K      ++L G+F+E
Sbjct  579  PYGDLYTARLDGSGLRRLTFNGYENGTPAW------DREFLQVSKRHAADEDELEGQFEE  632

Query  45   PLWI  34
            PLW+
Sbjct  633  PLWL  636



>ref|XP_006840288.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
 gb|ERN01963.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
Length=652

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 190/252 (75%), Gaps = 16/252 (6%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V+ TVQIAR++FDP++L     D  DEI   +K+LTKE TGNNAFPSCSPDGK +VFRSG
Sbjct  409  VETTVQIARISFDPTHL-----DSKDEISTHVKILTKEGTGNNAFPSCSPDGKFLVFRSG  463

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSG+KNLYIID+++GE   G IR+LT+G WIDTMP WSPDGK IAFSSNR +P +   FS
Sbjct  464  RSGYKNLYIIDAIDGE--DGSIRRLTEGPWIDTMPHWSPDGKYIAFSSNRESPKSTQGFS  521

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            +Y+  PDGT L  +HV  A    E+ +ER+NHVCFSPDS+++LFTANLG V AE +S+PN
Sbjct  522  VYLTNPDGTDLHHVHVTAASAFNEMAKERINHVCFSPDSKFLLFTANLGAVNAEAISLPN  581

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH-----PKAEVDLARLSLGKSGEKLRG  58
            QFQPYGDLY+  LDG+GL+RLT N YE+GTPAW+     P+    L  +     GE+L+G
Sbjct  582  QFQPYGDLYICGLDGSGLRRLTCNAYEDGTPAWNSGWWGPEPGSSLEDV----VGEELKG  637

Query  57   KFDEPLWINSDF  22
            +F+EPLW+ S F
Sbjct  638  EFEEPLWLGSTF  649



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 184/250 (74%), Gaps = 12/250 (5%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V  TVQIAR+ F+P +L+ D +    EIP  +K+LTK  +GNNAFPSCSPDGK IVFRSG
Sbjct  408  VTKTVQIARIEFEPDHLSKDRE----EIPFTLKILTKYDSGNNAFPSCSPDGKFIVFRSG  463

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            R+G KNLYI+D++NGE   GG+R+LT+G WIDTMP WSP G LIAFSSNRH+  N++ F 
Sbjct  464  RTGFKNLYIVDAVNGEEVDGGLRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDAKNSEVFG  523

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVV  DG+G+RR+ +      E   RERLNHVCFS D EW+LFTANLGGV+AEPV +PN
Sbjct  524  IYVVNVDGSGVRRVEIGKGVDGE---RERLNHVCFSGDGEWLLFTANLGGVSAEPVGLPN  580

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLA----RLSLGKSGEKLRGK  55
            QFQPYGDL++++LDG+GL+RLT N YENGTP WH   E+ L             +KL+G 
Sbjct  581  QFQPYGDLFVVKLDGSGLRRLTCNAYENGTPTWH-HGELLLCNDGDEDGDNGDWDKLKGA  639

Query  54   FDEPLWINSD  25
            F EPLWI  D
Sbjct  640  FQEPLWITCD  649



>gb|AJD80981.1| ABA-activated 1 protein [Lupinus luteus]
Length=647

 Score =   293 bits (751),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 182/248 (73%), Gaps = 17/248 (7%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V  TVQI R+ FDP +LTDD +    EIP  + +LT+  TGNNAFPSCSPDGK IVFRSG
Sbjct  411  VSKTVQIGRIEFDPVHLTDDNE----EIPFTLTILTRNDTGNNAFPSCSPDGKSIVFRSG  466

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSG    Y +D++NGE +G  +R+LT+G WIDTMP WSP G +IAFSSN HNP N + F 
Sbjct  467  RSG----YTVDAVNGEFNGS-LRRLTEGNWIDTMPCWSPKGDVIAFSSNMHNPENGEGFG  521

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVV PDG GLRRI VA      E  RERLNHVCFS D EW+LFTANLGGV AEPVS+PN
Sbjct  522  IYVVGPDGNGLRRIEVAKGV---EAERERLNHVCFSGDGEWLLFTANLGGVQAEPVSLPN  578

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSG--EKLRGKFD  49
            QFQPYGDLY++RLDG+GL+RLT N YENGTP WH +   DL   S    G  +K++G+F 
Sbjct  579  QFQPYGDLYVVRLDGSGLRRLTCNSYENGTPTWHDR---DLVLCSGDGDGDRDKVKGEFQ  635

Query  48   EPLWINSD  25
            EPLWI  +
Sbjct  636  EPLWITCE  643



>ref|XP_002515210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47194.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 177/218 (81%), Gaps = 8/218 (4%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V  TVQIAR+TFDPS+L  D +    EIP ++K+LT E +GNNAFP+CSPDGK++VFRSG
Sbjct  352  VNRTVQIARVTFDPSDLKPDRN----EIPCDVKMLTGEDSGNNAFPACSPDGKYLVFRSG  407

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSGHKNLYI+D++ GE  G  IR LT+GA IDTMP WSP G LIAFSSNRH P +A+ FS
Sbjct  408  RSGHKNLYIMDAVEGEFKGD-IRPLTEGACIDTMPCWSPKGDLIAFSSNRHKPEHANPFS  466

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNR---ERLNHVCFSPDSEWVLFTANLGGVTAEPVS  232
            IYV++PDG+GLRRIH+ G+E   E  R   ER+NHV FS D EW+LFTANLGG++AEPV+
Sbjct  467  IYVIKPDGSGLRRIHLEGSERLSEEEREWMERINHVTFSSDGEWLLFTANLGGLSAEPVA  526

Query  231  IPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            +P Q QPYGD+Y+ RLDG+GL+RLTWNGYENGTP W+P
Sbjct  527  VPRQIQPYGDIYVARLDGSGLRRLTWNGYENGTPVWYP  564



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/253 (59%), Positives = 183/253 (72%), Gaps = 16/253 (6%)
 Frame = -1

Query  762  VKATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  583
            V  TVQIAR+ FD  +LT+D +    EIP  +K+LTK+ +GNNAFPSCSPDGK +VFRSG
Sbjct  410  VSKTVQIARIEFDSVHLTNDQE----EIPYTLKILTKDDSGNNAFPSCSPDGKFVVFRSG  465

Query  582  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  403
            RSG KNLYI+D++NGE DGG +R+LT+G WIDTMP WSP G LIAFSSNRH+ GN+  F 
Sbjct  466  RSGFKNLYIVDAVNGEFDGG-LRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDGGNSQAFG  524

Query  402  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN  223
            IYVVR DG+GLRR+ V      E   RE LNHV FS D EW+LFT NL G+TAEP SIPN
Sbjct  525  IYVVRVDGSGLRRVEVGKGVDGE---REMLNHVRFSGDGEWLLFTGNLVGLTAEPASIPN  581

Query  222  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH--------PKAEVDLARLSLGKSGEK  67
            Q+QPYGDL++++LDG+GL+RLT N YENGTPAWH           + D          +K
Sbjct  582  QYQPYGDLFVVKLDGSGLRRLTCNAYENGTPAWHYGDLLLSNDDDDDDDDDDGDACDWDK  641

Query  66   LRGKFDEPLWINS  28
            L+G F+E LWI +
Sbjct  642  LKGAFEESLWITT  654



>ref|XP_002985152.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
 gb|EFJ13646.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
Length=669

 Score =   251 bits (642),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 168/244 (69%), Gaps = 12/244 (5%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            +A V I  LTFD + L D     S  +   +KVL+K  T NNAFPSCSPDGK++VFRSGR
Sbjct  427  RAMVHIVSLTFDVTALEDHSSSSSSTLESSVKVLSKPGTNNNAFPSCSPDGKNLVFRSGR  486

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
            SGHKNLYI+D+  GE   GGIR LT+G W+DTMP WSPDG  IAFSS+R  P N + F+I
Sbjct  487  SGHKNLYIMDAELGE--DGGIRALTEGPWVDTMPCWSPDGNWIAFSSSRDGPSN-EFFAI  543

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+V PDG+ L R+        E   R R NHVCFSPDS+ +LFTA+ GG++AEPVS+ NQ
Sbjct  544  YLVHPDGSELHRVF------PESSTRGRCNHVCFSPDSQTLLFTADCGGISAEPVSLANQ  597

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPL  40
            FQPYG+L+  +LDG+ L+R T N YE+GTP W P   + L   S+ K G++L   F + L
Sbjct  598  FQPYGELFSCKLDGSELRRWTHNAYEDGTPCWGP---LRLDPSSISKQGQELHANFQDCL  654

Query  39   WINS  28
            W+++
Sbjct  655  WLSA  658



>ref|XP_002993240.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
 gb|EFJ05661.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
Length=717

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 149/215 (69%), Gaps = 13/215 (6%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
            V+ K+LTK  T NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+GA
Sbjct  512  VKWKILTKSGTKNNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAIHGEE--ASLRRLTEGA  569

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  316
            W DTM SWS DG+ IAFSS+RHNPG    F +Y VRPDG+ L R+  +   G       R
Sbjct  570  WTDTMASWSHDGEWIAFSSDRHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG-------R  621

Query  315  LNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  136
            +NH  FSPDS  ++FT +  GV+A+P+++P QFQPYG+++M R+DG+ L RLT N YE+G
Sbjct  622  VNHPFFSPDSRSLVFTTDYAGVSADPIAVPAQFQPYGEIFMARIDGSELVRLTHNAYEDG  681

Query  135  TPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  31
            TP+W P   V L   +L   G+K R  F +  W+ 
Sbjct  682  TPSWGP---VKLDSSALTGEGKKARCGFRDTRWLK  713



>ref|XP_002993781.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
 gb|EFJ05147.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
Length=722

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 149/215 (69%), Gaps = 13/215 (6%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
            V+ K+LTK  T NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+GA
Sbjct  512  VKWKILTKSGTKNNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAIHGEE--ASLRRLTEGA  569

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  316
            W DTM SWS DG+ IAFSS+RHNPG    F +Y VRPDG+ L R+  +   G       R
Sbjct  570  WTDTMASWSHDGEWIAFSSDRHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG-------R  621

Query  315  LNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  136
            +NH  FSPDS  ++FT +  GV+A+P+++P QFQPYG+++M R+DG+ L RLT N YE+G
Sbjct  622  VNHPFFSPDSRSLVFTTDYAGVSADPIAVPAQFQPYGEIFMARIDGSELVRLTHNAYEDG  681

Query  135  TPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  31
            TP+W P   V L   +L   G+K R  F +  W+ 
Sbjct  682  TPSWGP---VKLDSSALTGEGKKARCGFRDTRWLK  713



>gb|ABR17080.1| unknown [Picea sitchensis]
Length=714

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 153/218 (70%), Gaps = 15/218 (7%)
 Frame = -1

Query  684  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  505
            E  +  K LTKE  GNNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  500  ESEISYKTLTKE--GNNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGE--EGGLWQLT  555

Query  504  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  325
            +G W DTM +WSPDG+ IAF+S+R +PG+   F++Y + P+GTGL R+  +   G     
Sbjct  556  EGPWTDTMCNWSPDGEWIAFASDRDSPGSG-GFAMYFIHPNGTGLHRVLNSSTAG-----  609

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  145
              R+NH  FSPDS+ ++FT++  GV+AEP+S+P+QFQPYG+++M R+DG+ LQRLT N Y
Sbjct  610  --RVNHPWFSPDSKSLVFTSDYAGVSAEPISVPHQFQPYGEIFMARVDGSELQRLTHNAY  667

Query  144  ENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  31
            E+GTP+W     + +A   L   GE ++  FD+  W+ 
Sbjct  668  EDGTPSW---GRIFIAASDLTGEGESVKCDFDDDHWLQ  702



>ref|XP_003630471.1| Protein tolB [Medicago truncatula]
 gb|KEH35326.1| DPP6 amino-terminal domain protein [Medicago truncatula]
Length=684

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 149/204 (73%), Gaps = 13/204 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE +G  +++LT+G W DTM +WSPDG
Sbjct  478  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVHGEKNG--LKRLTEGPWSDTMCNWSPDG  535

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+RH+PG+   F IY++ PDGTGLR++  +G+ G       R NH  FSPD + 
Sbjct  536  EWIAFASDRHDPGSG-SFEIYLIHPDGTGLRKLIHSGSGG-------RTNHPYFSPDGKS  587

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +  
Sbjct  588  MVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKP  646

Query  99   ARLSLGKSGEKLRGKFDEPLWINS  28
              + + K G      F++  W+N+
Sbjct  647  VNVEMPKGGPYC--SFEDCHWLNN  668



>ref|XP_007137456.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
 gb|ESW09450.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
Length=683

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 135/175 (77%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE  G  +R+LT+G W DTM +WSPDG
Sbjct  484  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVDGERKG--LRRLTEGPWTDTMCNWSPDG  541

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            K IAF+S+RH PG+   F++Y++  DG+GLR++  +G+ G       R NH  FSPD + 
Sbjct  542  KWIAFASDRHAPGSG-SFALYLIEADGSGLRKVFESGSGG-------RTNHPYFSPDGKS  593

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            + FT++  G++AEP+S P+ +QPYG+++ +RLDG+G+QRLT N YE+GTPAW PK
Sbjct  594  LTFTSDYAGISAEPISNPHHYQPYGEIFSVRLDGSGIQRLTHNSYEDGTPAWSPK  648



>dbj|BAJ88545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 139/186 (75%), Gaps = 11/186 (6%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
            V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE   GGIR+LTDG 
Sbjct  482  VSIKKLTVGGE-NNAFPSPSPDGKWLVFRSGRSGHKNLYIMDAEEGE--AGGIRRLTDGP  538

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  316
            W DTM +WSPDG+ IAF+S+RHNPG    F+IY+V P+ TGLRR+ V  A+G       R
Sbjct  539  WTDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYMVHPNSTGLRRV-VHSADGG------R  590

Query  315  LNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  136
             NH  FSPDS+ ++FT++L  V+AEP+S P+ +QPYG+++ + +DG+GLQRLT N +E+G
Sbjct  591  TNHPWFSPDSKRMVFTSDLAAVSAEPISNPHHYQPYGEIFTINIDGSGLQRLTHNSFEDG  650

Query  135  TPAWHP  118
            TP+W P
Sbjct  651  TPSWTP  656



>ref|XP_003562684.2| PREDICTED: uncharacterized protein LOC100824160 [Brachypodium 
distachyon]
Length=745

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 140/186 (75%), Gaps = 11/186 (6%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
            V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   GGI +LT+G 
Sbjct  524  VSIKKLTLGGK-NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIHRLTNGP  580

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  316
            W DTM +WSPDG+ IAF+S+RHNPG    F+IY++ P+GTGLRR+ V  A+G       R
Sbjct  581  WSDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYLIHPNGTGLRRL-VHSADGG------R  632

Query  315  LNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  136
             NH  FSPDS+ ++FT++L  V+AEP+S P+ +QPYG+++ + +DG+GLQRLT N +E+G
Sbjct  633  TNHPWFSPDSKSIVFTSDLAAVSAEPISNPHHYQPYGEIFTINIDGSGLQRLTHNSFEDG  692

Query  135  TPAWHP  118
            TP+W P
Sbjct  693  TPSWTP  698



>ref|XP_003527947.1| PREDICTED: uncharacterized protein LOC100791865 [Glycine max]
Length=723

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 147/203 (72%), Gaps = 15/203 (7%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+G W DTM +WSPDG
Sbjct  516  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVDGE--KKELRRLTEGPWTDTMCNWSPDG  573

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+RH+PG+   F IY++ P+GTGLR++  +G+ G       R NH  FSPD + 
Sbjct  574  EWIAFASDRHDPGSG-SFEIYLIHPNGTGLRKLIQSGSGG-------RTNHPYFSPDGKS  625

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            + FT++  G++AEP+S P+ +QPYG+++ +RLDG+G++RLT N YE+GTPAW PK    +
Sbjct  626  LTFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGIKRLTHNSYEDGTPAWSPKY---M  682

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
              +++ K G      FD+  W+N
Sbjct  683  PPVNVPKGGPYC--SFDDCHWLN  703



>ref|XP_007019162.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
 gb|EOY16387.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
Length=710

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 132/174 (76%), Gaps = 10/174 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D++ GE   GG+R+LT+G W DTM +WSPDG
Sbjct  501  NNAFPSPSPDGKWIVFRSGRTGHKNLYIMDAIEGE--AGGLRRLTEGPWTDTMCNWSPDG  558

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
              IAF+S+R NPG+   F +Y++ P+GTGLRR+  +G+ G       R NH  FSPD  +
Sbjct  559  DWIAFASDRDNPGSG-SFELYLIHPNGTGLRRLVKSGSAG-------RANHPSFSPDGTY  610

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            V+FT++  G++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  611  VVFTSDFAGISAEPISNPHHYQPYGEIFTIKLDGSDLKRLTHNSYEDGTPTWAP  664



>ref|XP_008644344.1| PREDICTED: uncharacterized protein LOC103625729 [Zea mays]
 gb|AFW67030.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=689

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 151/219 (69%), Gaps = 21/219 (10%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
            V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   GGIR+LT+G 
Sbjct  474  VSIKKLTVGGE-NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIRRLTEGP  530

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  316
            W DTM +WSPDG+ IAF+S+RHNPG    F+IY+V P+GTGLRR+ V  A+G       R
Sbjct  531  WSDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYMVHPNGTGLRRV-VHSADGG------R  582

Query  315  LNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  136
             NH  FSPDS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DG+G++RLT N +E+G
Sbjct  583  TNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGSGIRRLTHNSFEDG  642

Query  135  TPAWHPKAEVDLARLSLGKSGEKLRGK----FDEPLWIN  31
            TP+W P        L     GE L+      F++  W+N
Sbjct  643  TPSWTPY------HLKAEDVGETLQASGTCAFEDCHWLN  675



>gb|KJB29176.1| hypothetical protein B456_005G088400 [Gossypium raimondii]
Length=713

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 142/203 (70%), Gaps = 14/203 (7%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D++ GE     I +LTDG W DTM +WSPDG
Sbjct  502  NNAFPSPSPDGKRIVFRSGRSGHKNLYIMDAIEGETSW--IERLTDGPWTDTMCNWSPDG  559

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
              IAFSS+RH+PG+   F +Y++ P+GTGLRR+  +G+ G       R+NH  F PD + 
Sbjct  560  DWIAFSSDRHDPGSG-SFELYMIHPNGTGLRRLLRSGSSG-------RVNHPSFRPDGKL  611

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT + GG++AEP+S P+ +QPYG+++ M+LDG+ L+RLT N YE+GTP W P   ++ 
Sbjct  612  LVFTTDYGGISAEPISNPHHYQPYGEIFTMKLDGSDLKRLTHNSYEDGTPTWAP-LYINP  670

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
              +   + GE     F++  W+N
Sbjct  671  VDVEWPRKGE---CAFEDCHWLN  690



>ref|XP_004981111.1| PREDICTED: uncharacterized protein LOC101776730 [Setaria italica]
Length=691

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 149/216 (69%), Gaps = 22/216 (10%)
 Frame = -1

Query  654  KETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  481
            K TTG  NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   GGI +LT+G W DTM
Sbjct  480  KLTTGSENNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIHRLTEGPWSDTM  537

Query  480  PSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  301
             +WSPDG+ IAFSS+RHNPG    F+IY++ P+GTGLRR+ V  A+G       R NH  
Sbjct  538  CNWSPDGEWIAFSSDRHNPGGG-SFAIYMIHPNGTGLRRV-VHSADGG------RTNHPW  589

Query  300  FSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  121
            FSPDS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DGTG++RLT N +E+GTP+W 
Sbjct  590  FSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGTGIRRLTHNSFEDGTPSWT  649

Query  120  PKAEVDLARLSLGKSGEKLRG----KFDEPLWINSD  25
            P        L     GE L+     KF +  W+  D
Sbjct  650  PY------YLEPEDVGETLQASGTCKFRDCHWLTVD  679



>ref|XP_006351203.1| PREDICTED: uncharacterized protein LOC102604753 [Solanum tuberosum]
Length=696

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 133/174 (76%), Gaps = 10/174 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+L GE   GG+R+LT+G W DTM +WSPDG
Sbjct  484  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDALEGE--AGGLRRLTEGPWTDTMCNWSPDG  541

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F +Y++ P+GTGL+++  +G  G       R NH  FSPD ++
Sbjct  542  EWIAFASDRENPGSG-SFEMYMIHPNGTGLKKVIQSGMGG-------RTNHPYFSPDGKY  593

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            ++FT++   V+AEP+S P+ +QPYGD+Y+++ DG+ ++RLT N YE+GTPAW P
Sbjct  594  IVFTSDYAAVSAEPISNPHHYQPYGDIYVIKSDGSDIRRLTHNSYEDGTPAWGP  647



>ref|XP_004502520.1| PREDICTED: uncharacterized protein LOC101497096 [Cicer arietinum]
Length=683

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 152/220 (69%), Gaps = 15/220 (7%)
 Frame = -1

Query  681  IPVEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQL  508
            I V+  ++ K T    NNAFPS SPDGK IVFRSGRSGHKNLY++D++ GE    G+R+L
Sbjct  466  IDVDRNIVKKLTIDGKNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDAVEGE--KKGLRRL  523

Query  507  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV  328
            T+G W DTM +WSPDG+ IAF+S+R +PG+   F +Y++ P+GTGL+++  +G+ G    
Sbjct  524  TEGPWTDTMCNWSPDGEWIAFASDRDDPGSG-SFELYLIHPNGTGLKKLIQSGSGG----  578

Query  327  NRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  148
               R NH  FSPD + ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N 
Sbjct  579  ---RTNHPYFSPDGKSIVFTSDYSGISAEPISNPHAYQPYGEIFTVRLDGSGLTRLTHNS  635

Query  147  YENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINS  28
            YE+GTPAW PK  +    +   K G      FD+  W+N+
Sbjct  636  YEDGTPAWSPKY-IKPVNVERPKGGPYC--SFDDCHWLNN  672



>gb|KFK44274.1| hypothetical protein AALP_AA1G237000 [Arabis alpina]
Length=703

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+  LT+GAW DTM +WSPDG
Sbjct  501  NNAFPWPSPDGKRIVFRSGRSGHKNLYLMDAEKGE--AGGLWSLTEGAWSDTMCTWSPDG  558

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R NH  FSPDS+ 
Sbjct  559  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLIQSGSGG-------RTNHPIFSPDSKT  610

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  611  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPR  665



>ref|XP_010270269.1| PREDICTED: uncharacterized protein LOC104606655 [Nelumbo nucifera]
Length=728

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 146/218 (67%), Gaps = 18/218 (8%)
 Frame = -1

Query  672  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  499
            E     K T G  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+R+LT+G
Sbjct  481  ETGTYKKLTLGGENNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGE--KGGLRRLTEG  538

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  319
             W DTM SWSPDG+ IAF+S+R NPG    F++Y++ P+GTGL ++  +G  G       
Sbjct  539  PWTDTMCSWSPDGEWIAFASDRDNPGGGG-FALYLIHPNGTGLMKVVHSGEGG-------  590

Query  318  RLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  139
            R NH  FSPD   ++FT++  GV+AEP+S P+ +QPYG++++ R DG+G++RLT N YE+
Sbjct  591  RTNHPSFSPDGRSIVFTSDYVGVSAEPISNPHHYQPYGEIFIARSDGSGIKRLTHNSYED  650

Query  138  GTPAWHPK--AEVDLARLSLGKSGEKLRGKFDEPLWIN  31
            GTPAW P      D+     G+ G      FD+  W+N
Sbjct  651  GTPAWGPTFMRPADVVESPFGEPG----CSFDDCHWLN  684



>emb|CDP10971.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 135/179 (75%), Gaps = 10/179 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            N+AFPS SPDGK + FRSGRSGHKNLY++D+L GE   GG+ +LT+G W DTM +WSPDG
Sbjct  515  NDAFPSASPDGKWVAFRSGRSGHKNLYVMDALEGE--AGGLYRLTEGPWSDTMCNWSPDG  572

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + I F+S+R NPG+   F +++V P+GTGL ++  +G+ G       R NH CFSPD ++
Sbjct  573  EWILFASDRENPGSG-TFELFMVHPNGTGLHKLVQSGSGG-------RANHPCFSPDGKY  624

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVD  103
            V+FT++  GV+AEP+S P+ +QPYG++++++ DG+G++RLT N YE+GTPAW PK   D
Sbjct  625  VVFTSDYAGVSAEPISNPHHYQPYGEIFVIKSDGSGIRRLTHNSYEDGTPAWGPKYMKD  683



>ref|XP_011069633.1| PREDICTED: uncharacterized protein LOC105155456 [Sesamum indicum]
Length=688

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 143/203 (70%), Gaps = 13/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D+LNGE   G + +LT+G W DTM +WSPDG
Sbjct  483  NNAFPSPSPDGKWIVFRSGRTGHKNLYIMDALNGE--AGWLYRLTEGQWTDTMCNWSPDG  540

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F ++ + P+GTGL+++  +G  G       R NH  FSPD  +
Sbjct  541  EWIAFASDRENPGSG-SFELFKIHPNGTGLQKVIHSGVGG-------RTNHPWFSPDGNY  592

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++ T++  GV+AEP++ P+ +QPYGD++++R DG+G++RLT N YE+GTPAW PK  +  
Sbjct  593  IVLTSDYAGVSAEPIANPHHYQPYGDIFVIRADGSGIRRLTHNSYEDGTPAWSPKF-LSP  651

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
            A +     G K    FD+  W+N
Sbjct  652  ANVEWPNGGSKC--SFDDCHWLN  672



>ref|XP_001780675.1| predicted protein [Physcomitrella patens]
 gb|EDQ54561.1| predicted protein [Physcomitrella patens]
Length=710

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 137/207 (66%), Gaps = 12/207 (6%)
 Frame = -1

Query  666  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            K LTKE TGNNAFP  SPDGK++VFRSGR+G KNLYI+D+  GE     +R+LT+G W D
Sbjct  479  KYLTKEGTGNNAFPCPSPDGKYVVFRSGRTGRKNLYIMDAAGGEEKY--LRRLTEGRWRD  536

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
            TMP+WSPD + IAFSSNR +P     FS+Y++RP+GT L  +   G  G          H
Sbjct  537  TMPAWSPDNEWIAFSSNRAHPTGERSFSLYLIRPNGTDLHMLLDTGVGGLAM-------H  589

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
              FSPDS+ + FT+N  GV+AEP+S P+ +QPYG ++++ +DGTGL RLT N YE+GTP 
Sbjct  590  AVFSPDSKRIAFTSNWAGVSAEPISFPHAYQPYGTIFVINIDGTGLTRLTHNAYEDGTPT  649

Query  126  WHPKAEVDLARLSLGKSGEKLRGKFDE  46
            W     + L + ++   G +    FD+
Sbjct  650  W---GRLPLPKPAISSDGRRSSCDFDD  673



>emb|CDP10970.1| unnamed protein product [Coffea canephora]
Length=715

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK +VFRSGRSGHKNLYI+D+L GE   GG+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSASPDGKWVVFRSGRSGHKNLYIMDALEGET--GGLSRLTEGPWSDTMCNWSPDG  569

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F +++V P+GTGL ++  +G+ G       R NH  FSPDS++
Sbjct  570  EWIAFASDRENPGSG-SFELFMVHPNGTGLHKLIQSGSGG-------RTNHPWFSPDSKY  621

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
            V+FT++  GV+AEP+S P+ +QPYGD+++++ DG+G++RLT N YE+GTP W
Sbjct  622  VVFTSDYAGVSAEPISNPHHYQPYGDIFVIKSDGSGIRRLTHNSYEDGTPTW  673



>gb|EYU32510.1| hypothetical protein MIMGU_mgv1a026619mg [Erythranthe guttata]
Length=716

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 146/203 (72%), Gaps = 13/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK +VFRSGR+GHKNLYI+D+LNGE DG  + QLT+G W DTMP+WSP+G
Sbjct  508  NNAFPSPSPDGKRVVFRSGRTGHKNLYIMDALNGEKDG--LYQLTEGPWSDTMPNWSPNG  565

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F ++ + P+GTGL+++  +G+ G       R+NH  FSPD + 
Sbjct  566  EWIAFASDRENPGSGG-FELFKIHPNGTGLQKVIQSGSGG-------RVNHPWFSPDGKH  617

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++ T++  GV+AEP+S P+ FQPYGD+++++ DG+ ++RLT N YE+GTP W PK+ +  
Sbjct  618  IVLTSDYAGVSAEPISNPHHFQPYGDIFVIKSDGSWIRRLTHNSYEDGTPTWIPKS-MKP  676

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
              +     G  L+  FD+  W+N
Sbjct  677  GNVEWPNGG--LKCSFDDCHWLN  697



>ref|XP_010477409.1| PREDICTED: uncharacterized protein LOC104756505 [Camelina sativa]
Length=711

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE  GGG+ +LT+GAW DTM +WSP+G
Sbjct  509  NNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE--GGGLWRLTEGAWTDTMCNWSPNG  566

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FSPDS+ 
Sbjct  567  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPVFSPDSKS  618

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  619  LVFTSDYAGISAEPISNPHSYQPYGDIFTVKLDGSNLKRLTHNSYEDGTPAWSPR  673



>ref|XP_004249849.1| PREDICTED: uncharacterized protein LOC101257324 [Solanum lycopersicum]
Length=675

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 132/174 (76%), Gaps = 10/174 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+L GE+  GG+R LT+G W DTM +WSPD 
Sbjct  468  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDALEGEV--GGLRPLTEGPWTDTMCNWSPDD  525

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F +Y++ P+GTGL+++  +G  G       R NH  FSPD ++
Sbjct  526  EWIAFASDRENPGSG-SFEMYMIHPNGTGLKKVIQSGIGG-------RTNHPYFSPDGKY  577

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            ++FT++   V+AEP+S P+ +QPYGD+Y+++ DG+ ++RLT N YE+GTPAW P
Sbjct  578  IVFTSDYAAVSAEPISNPHHYQPYGDIYVIKSDGSDIRRLTHNSYEDGTPAWGP  631



>ref|XP_010521282.1| PREDICTED: uncharacterized protein LOC104800217 isoform X2 [Tarenaya 
hassleriana]
Length=725

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 132/175 (75%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGRSGHKNLYI+D+  GE   GG+ +LTDG W DTM +WSPDG
Sbjct  522  NNAFPWPSPDGKRIVFRSGRSGHKNLYIMDTEKGE--SGGLFRLTDGPWTDTMCNWSPDG  579

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            +LIAF+S+R NPG+   F ++++ P+GTG+R++  +G+ G       R NH  FSPD + 
Sbjct  580  ELIAFASDRENPGSG-SFELFLIHPNGTGMRKLIQSGSGG-------RTNHPIFSPDGQT  631

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            + FT++ G ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N +E+GTPAW PK
Sbjct  632  IAFTSDYGAISAEPISNPHHYQPYGEIFTVKLDGSDLRRLTHNSFEDGTPAWAPK  686



>ref|XP_010521281.1| PREDICTED: uncharacterized protein LOC104800217 isoform X1 [Tarenaya 
hassleriana]
Length=724

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 132/175 (75%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGRSGHKNLYI+D+  GE   GG+ +LTDG W DTM +WSPDG
Sbjct  521  NNAFPWPSPDGKRIVFRSGRSGHKNLYIMDTEKGE--SGGLFRLTDGPWTDTMCNWSPDG  578

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            +LIAF+S+R NPG+   F ++++ P+GTG+R++  +G+ G       R NH  FSPD + 
Sbjct  579  ELIAFASDRENPGSG-SFELFLIHPNGTGMRKLIQSGSGG-------RTNHPIFSPDGQT  630

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            + FT++ G ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N +E+GTPAW PK
Sbjct  631  IAFTSDYGAISAEPISNPHHYQPYGEIFTVKLDGSDLRRLTHNSFEDGTPAWAPK  685



>ref|XP_010672499.1| PREDICTED: uncharacterized protein LOC104889058 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 145/203 (71%), Gaps = 13/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+  GE+  GGIR+LT+G W DTM +WSPDG
Sbjct  510  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAEEGEI--GGIRRLTEGPWSDTMCNWSPDG  567

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAFSS+R NPG+   F I+++ P+GTGL ++  +G  G       R NH  FSPD + 
Sbjct  568  EWIAFSSDRENPGSG-SFEIFMMHPNGTGLHKVIQSGIGG-------RANHPWFSPDGKS  619

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++ GGV+AEP+S P+ +QPYG++++ ++DG+ ++RLT N YE+GTP W P   + L
Sbjct  620  IVFTSDYGGVSAEPISNPHHYQPYGEIFIAKVDGSDIRRLTHNSYEDGTPTWGP---MFL  676

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
            + + + +   + +  F +  W+N
Sbjct  677  SPIDVAEPTSEPKCLFQDCHWLN  699



>ref|XP_009411896.1| PREDICTED: uncharacterized protein LOC103993528 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 148/216 (69%), Gaps = 22/216 (10%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            + K TTG  NNAFPS SPDGK +VFRSGRSGHKNLYI+D++ GE    GI +LT+G W D
Sbjct  501  IKKLTTGGANNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAVEGE--SAGIHRLTEGPWSD  558

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
            TM +WSPDG+ IAF+S+R NPG    F+IY+V P+GTGLRR+  +G+ G       R NH
Sbjct  559  TMCNWSPDGEWIAFASDRDNPGGG-SFAIYMVHPNGTGLRRVVHSGSGG-------RTNH  610

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
              FSPDS+ ++FT++ G V+AEP+S P+ +QPYG+++ + +DG+ ++RLT N +E+GTP 
Sbjct  611  PWFSPDSKSLVFTSDYGAVSAEPISNPHHYQPYGEIFTVGIDGSDIRRLTHNSFEDGTPT  670

Query  126  WHPKAEVDLARLSLGKSGEKLRG----KFDEPLWIN  31
            W P        L      E L+G    +FD+  W+N
Sbjct  671  WTPYF------LEPADVAESLQGSAWCEFDDCHWLN  700



>ref|XP_006434259.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
 gb|ESR47499.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
Length=721

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 135/175 (77%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R+NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FSPD + 
Sbjct  570  EWIAFASDRYNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>gb|EAZ29242.1| hypothetical protein OsJ_13305 [Oryza sativa Japonica Group]
Length=688

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 137/183 (75%), Gaps = 12/183 (7%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            + K T G  NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G W D
Sbjct  473  MKKLTVGGENNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEGPWSD  530

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
            TM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  G       R NH
Sbjct  531  TMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGGSG-------RTNH  582

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
              FSPDS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+GTP+
Sbjct  583  PWFSPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVDIDGSNIRRLTHNSFEDGTPS  642

Query  126  WHP  118
            W P
Sbjct  643  WTP  645



>ref|XP_006304666.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
 gb|EOA37564.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
Length=708

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG
Sbjct  506  NNAFPWPSPDGKLIVFRSGRTGHKNLYIMDAEKGER--GGLWRLTEGAWTDTMCNWSPDG  563

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F ++++ P+GTGL+++  +G  G       R NH  FSPDS+ 
Sbjct  564  EWIAFASDRENPGSG-SFELFLIHPNGTGLKKLIQSGTGG-------RTNHPVFSPDSKS  615

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++  G++AEP+S P+ FQPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  616  LVFTSDYAGISAEPISNPHHFQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWSPR  670



>ref|XP_002520326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42112.1| conserved hypothetical protein [Ricinus communis]
Length=708

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 145/203 (71%), Gaps = 13/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP+ SPDGK IVFRSGRSG+KNLYI+D++ GE   GG+ +LT+G W DTM SWS DG
Sbjct  498  NNAFPAVSPDGKWIVFRSGRSGYKNLYIMDAVEGE--KGGLYRLTEGPWGDTMCSWSIDG  555

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+A  F ++++ P+GTGL+R+  +G  G       R NH  FSPD + 
Sbjct  556  EWIAFASDRENPGSA-SFELFLIHPNGTGLKRLVKSGLGG-------RTNHPYFSPDGKS  607

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT + GG++AEP+S P+ FQPYG++Y ++LDG+ L+RLT N +E+GTPAW P A ++ 
Sbjct  608  IVFTTDYGGISAEPISNPHHFQPYGEIYTVKLDGSDLKRLTHNSFEDGTPAWGP-AYIEP  666

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
              L   K G +    FD+  W++
Sbjct  667  VDLEWPKYGPQC--SFDDCHWLS  687



>ref|XP_002466125.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
 gb|EER93123.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
Length=690

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 148/219 (68%), Gaps = 21/219 (10%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
            V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE    GIR+LT+G 
Sbjct  475  VSIKKLTVGGE-NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--ASGIRRLTEGP  531

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  316
            W DTM +WSPDG+ IAF+S+RHNPG    F IY+V P+GTGLRR+ V   +G       R
Sbjct  532  WSDTMCNWSPDGEWIAFASDRHNPGGG-SFGIYMVHPNGTGLRRV-VHSTDGG------R  583

Query  315  LNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  136
             NH  FSPDS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DG+G++RLT N +E+G
Sbjct  584  TNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGSGIRRLTHNSFEDG  643

Query  135  TPAWHPKAEVDLARLSLGKSGEKLRGK----FDEPLWIN  31
            TP+W P        L     GE L+      F++  W+N
Sbjct  644  TPSWTPH------YLKPEDVGETLQASGTCAFEDCHWLN  676



>ref|NP_001051846.1| Os03g0840200 [Oryza sativa Japonica Group]
 gb|AAT77013.1| putative F8K7.10 protein [Oryza sativa Japonica Group]
 gb|ABF99802.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13760.1| Os03g0840200 [Oryza sativa Japonica Group]
 dbj|BAG90604.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=688

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 137/183 (75%), Gaps = 12/183 (7%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            + K T G  NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G W D
Sbjct  473  MKKLTVGGENNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEGPWSD  530

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
            TM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  G       R NH
Sbjct  531  TMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGGSG-------RTNH  582

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
              FSPDS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+GTP+
Sbjct  583  PWFSPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVDIDGSNIRRLTHNSFEDGTPS  642

Query  126  WHP  118
            W P
Sbjct  643  WTP  645



>ref|XP_002890452.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66711.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG
Sbjct  504  NNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGAWTDTMCNWSPDG  561

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FSPDS+ 
Sbjct  562  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  613

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  614  LVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPR  668



>emb|CDY08186.1| BnaA06g15400D [Brassica napus]
Length=667

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 147/205 (72%), Gaps = 12/205 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG
Sbjct  465  NNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDG  522

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FSPDS+ 
Sbjct  523  EWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  574

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ 
Sbjct  575  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INP  633

Query  99   ARLSLGKSGEKLRGKFDEPLWINSD  25
            + + L K  +     F++  W+N +
Sbjct  634  SDVVLRKKNDS-SCAFEDCHWLNKN  657



>emb|CDY04662.1| BnaC05g17000D [Brassica napus]
Length=706

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 146/205 (71%), Gaps = 12/205 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG
Sbjct  503  NNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDG  560

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FSPDS+ 
Sbjct  561  EWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  612

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  +D 
Sbjct  613  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-IDP  671

Query  99   ARLSLGKSGEKLRGKFDEPLWINSD  25
              + L +  +     F++  W+N +
Sbjct  672  NDVVLRRKNDS-SCAFEDCHWLNKN  695



>ref|XP_011027475.1| PREDICTED: uncharacterized protein LOC105127763 [Populus euphratica]
Length=712

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 142/203 (70%), Gaps = 13/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  499  NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDG  556

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R+NH  FSPD   
Sbjct  557  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RVNHPYFSPDGNS  608

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            + FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +
Sbjct  609  IAFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---I  665

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
                +   G   +  F+E  W+N
Sbjct  666  KPKDVEWPGHGPQCSFEECHWLN  688



>emb|CDX84088.1| BnaC08g07650D [Brassica napus]
Length=668

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 147/205 (72%), Gaps = 12/205 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG
Sbjct  466  NNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDG  523

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FSPDS+ 
Sbjct  524  EWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  575

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ 
Sbjct  576  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INP  634

Query  99   ARLSLGKSGEKLRGKFDEPLWINSD  25
            + + L K  +     F++  W+N +
Sbjct  635  SDVVLRKKNDS-SCAFEDCHWLNKN  658



>ref|XP_011027472.1| PREDICTED: uncharacterized protein LOC105127760 [Populus euphratica]
Length=712

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 142/203 (70%), Gaps = 13/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  499  NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDG  556

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R+NH  FSPD   
Sbjct  557  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RVNHPYFSPDGNS  608

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            + FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +
Sbjct  609  IAFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---I  665

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
                +   G   +  F+E  W+N
Sbjct  666  KPKDVEWPGHGPQCSFEECHWLN  688



>ref|XP_009149686.1| PREDICTED: uncharacterized protein LOC103873010 [Brassica rapa]
Length=705

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 147/205 (72%), Gaps = 12/205 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG
Sbjct  503  NNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDG  560

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FSPDS+ 
Sbjct  561  EWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  612

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ 
Sbjct  613  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INP  671

Query  99   ARLSLGKSGEKLRGKFDEPLWINSD  25
            + + L K  +     F++  W+N +
Sbjct  672  SDVVLRKKNDS-SCAFEDCHWLNKN  695



>gb|KDO80522.1| hypothetical protein CISIN_1g004971mg [Citrus sinensis]
Length=721

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FSPD + 
Sbjct  570  EWIAFASDRDNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_006472827.1| PREDICTED: uncharacterized protein LOC102617553 [Citrus sinensis]
Length=721

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FSPD + 
Sbjct  570  EWIAFASDRDNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_006386357.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
 gb|ERP64154.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
Length=712

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 142/203 (70%), Gaps = 13/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  499  NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDG  556

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R NH  FSPD   
Sbjct  557  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RANHPYFSPDGNS  608

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +
Sbjct  609  IVFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---I  665

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
                +   G   +  F+E  W+N
Sbjct  666  KPEDVEWPGHGPQCSFEECHWLN  688



>ref|NP_564147.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
 gb|AAD41421.1|AC007727_10 ESTs gb|N96028, gb|F14286, gb|T20680, gb|F14443, gb|AA657300 
and gb|N65244 come from this gene [Arabidopsis thaliana]
 gb|AAK76710.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13226.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30138.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
Length=706

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 145/203 (71%), Gaps = 12/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG
Sbjct  504  NNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGAWTDTMCNWSPDG  561

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FSPDS+ 
Sbjct  562  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  613

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ ++RLT N YE+GTPAW P+  +  
Sbjct  614  LVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNVRRLTHNSYEDGTPAWAPRF-IHP  672

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
              + L +  +  R  F++  W+N
Sbjct  673  NNVELQRRNDS-RCSFEDCHWLN  694



>ref|XP_002285876.2| PREDICTED: uncharacterized protein LOC100267814 [Vitis vinifera]
Length=715

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 135/190 (71%), Gaps = 12/190 (6%)
 Frame = -1

Query  675  VEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  502
            V+     K TTG  NNAFPS SPDGK I FRSGRSG+KNLYI+D+++GE   GGI +LT+
Sbjct  489  VDQPSYKKLTTGGENNAFPSPSPDGKWIAFRSGRSGYKNLYIMDAVDGER--GGIHRLTE  546

Query  501  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G+ G      
Sbjct  547  GPWTDTMCNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSGSAG------  599

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  142
             R NH  FSPD + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL RLT N YE
Sbjct  600  -RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGLHRLTHNSYE  658

Query  141  NGTPAWHPKA  112
            +GTPAW PK 
Sbjct  659  DGTPAWAPKV  668



>ref|XP_009593179.1| PREDICTED: uncharacterized protein LOC104089880 [Nicotiana tomentosiformis]
Length=706

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 134/177 (76%), Gaps = 12/177 (7%)
 Frame = -1

Query  648  TTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPS  475
            TTG  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+ +LT+G+W DTM +
Sbjct  493  TTGGQNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGE--AGGLYRLTEGSWTDTMCN  550

Query  474  WSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            WSPDG  IAF+S+R NPG+   F +++V P+GTGLR++  +G  G       R NH  FS
Sbjct  551  WSPDGDWIAFASDRENPGSG-SFEMFMVHPNGTGLRKVIQSGMGG-------RTNHPYFS  602

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
            PD ++++FT++   V+AEP+S P+ +QPYGD+++++ DG+ ++RLT N YE+GTPAW
Sbjct  603  PDGKYIVFTSDYAAVSAEPISNPHHYQPYGDIFVIKSDGSEIRRLTHNSYEDGTPAW  659



>ref|XP_009796392.1| PREDICTED: uncharacterized protein LOC104242978 [Nicotiana sylvestris]
Length=706

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 135/179 (75%), Gaps = 12/179 (7%)
 Frame = -1

Query  648  TTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPS  475
            TTG  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+ +LT+G+W DTM +
Sbjct  489  TTGGQNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGET--GGLYRLTEGSWTDTMCN  546

Query  474  WSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            WSPDG  IAF+S+R NPG+   F +++V P+GTGLR++  +G  G       R NH  FS
Sbjct  547  WSPDGDWIAFASDRENPGSG-SFEMFMVHPNGTGLRKVIQSGTGG-------RTNHPYFS  598

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            PD ++++FT++   V+AEP++ P+ +QPYGD+++++ DG+ ++R+T N YE+GTPAW P
Sbjct  599  PDGKYIVFTSDYAAVSAEPIANPHHYQPYGDIFVIKSDGSEIRRMTHNSYEDGTPAWGP  657



>ref|XP_010269111.1| PREDICTED: uncharacterized protein LOC104605872 [Nelumbo nucifera]
Length=623

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 145/217 (67%), Gaps = 18/217 (8%)
 Frame = -1

Query  672  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  499
            E+    K T G  NNAFPS SPDGK +VFRSGRSGHKNLY++D+L GE    G+R+LT+G
Sbjct  399  EMGQYKKLTIGGQNNAFPSPSPDGKWVVFRSGRSGHKNLYVMDALEGER--AGVRRLTEG  456

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  319
             W DTM +WSPDG+ IAF+S+R NPG    F+IY + P+GTGL+++  +G  G       
Sbjct  457  PWTDTMCNWSPDGEWIAFASDRDNPGGG-SFAIYFIHPNGTGLKKVVHSGEGG-------  508

Query  318  RLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  139
            R NH  FSPD + ++FT++   V+AEP++ P+ +QPYGD+++ R DG+G++RLT N YE+
Sbjct  509  RTNHPWFSPDGKSLVFTSDYAAVSAEPIANPHHYQPYGDIFIARSDGSGIRRLTHNSYED  568

Query  138  GTPAWHP--KAEVDLARLSLGKSGEKLRGKFDEPLWI  34
            GTP+W P     +D+     G      R  FD+  W+
Sbjct  569  GTPSWGPMFMRPIDVVESPFGGP----RCSFDDCHWL  601



>emb|CAN73514.1| hypothetical protein VITISV_037210 [Vitis vinifera]
Length=715

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 134/190 (71%), Gaps = 12/190 (6%)
 Frame = -1

Query  675  VEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  502
            V+     K TTG  NNAFPS SPDGK I FRSGRSG+KNLYI+D++ GE   GGI +LT+
Sbjct  489  VDQPSYKKLTTGGENNAFPSPSPDGKWIAFRSGRSGYKNLYIMDAVXGER--GGIHRLTE  546

Query  501  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G+ G      
Sbjct  547  GPWTDTMCNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSGSAG------  599

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  142
             R NH  FSPD + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL RLT N YE
Sbjct  600  -RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGLHRLTHNSYE  658

Query  141  NGTPAWHPKA  112
            +GTPAW PK 
Sbjct  659  DGTPAWAPKV  668



>ref|XP_010911317.1| PREDICTED: uncharacterized protein LOC105037336 [Elaeis guineensis]
Length=698

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 137/184 (74%), Gaps = 12/184 (7%)
 Frame = -1

Query  663  VLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
            ++ K TTG  NNAFPS SPDGK +VFRSGRSGHKNLYI+D++ G  D   +R+LT+G W 
Sbjct  484  IVKKLTTGGENNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAVEG--DSAALRRLTEGPWS  541

Query  489  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  310
            DTM +WSPDG+ IAF+S+R NPG+   F+IY++ P+GTGLR++  +G  G       R N
Sbjct  542  DTMCNWSPDGEWIAFASDRDNPGSG-SFAIYMIHPNGTGLRKVVHSGDGG-------RTN  593

Query  309  HVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
            H  FSPDS+ + FT++  GV+AEP+S P+ +QPYG+++ +++DG+ ++RLT N +E+GTP
Sbjct  594  HPWFSPDSKSLAFTSDYAGVSAEPISNPHHYQPYGEIFTVKIDGSDIRRLTHNSFEDGTP  653

Query  129  AWHP  118
             W P
Sbjct  654  TWAP  657



>gb|EAY92514.1| hypothetical protein OsI_14253 [Oryza sativa Indica Group]
Length=682

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 137/187 (73%), Gaps = 12/187 (6%)
 Frame = -1

Query  672  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  499
            E   + K T G  NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G
Sbjct  463  ETISMKKLTVGGENNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEG  520

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  319
             W DTM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  G       
Sbjct  521  PWSDTMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGDGG-------  572

Query  318  RLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  139
            R NH  F PDS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+
Sbjct  573  RTNHPWFGPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVHIDGSNIRRLTHNSFED  632

Query  138  GTPAWHP  118
            GTP+W P
Sbjct  633  GTPSWTP  639



>ref|XP_006416277.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
 gb|ESQ34630.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
Length=713

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 132/175 (75%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGR+GHKNLY++D+  GE    G+ +LT+GAW DTM SWSPDG
Sbjct  508  NNAFPWPSPDGKLIVFRSGRTGHKNLYLMDAEKGET--SGLWRLTEGAWTDTMCSWSPDG  565

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G+ G       R NH  FSPDS+ 
Sbjct  566  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGSGG-------RTNHPIFSPDSKS  617

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTP W P+
Sbjct  618  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPVWAPR  672



>gb|KDP32822.1| hypothetical protein JCGZ_12114 [Jatropha curcas]
Length=699

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 142/203 (70%), Gaps = 13/203 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK +VFRSGR+GHKNLY +D+  GE   GGI +LT+G W DTM +WSPDG
Sbjct  493  NNAFPSVSPDGKWVVFRSGRAGHKNLYAMDAEEGE--KGGIHRLTEGPWSDTMCNWSPDG  550

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   F +Y++ P+GTGLR++  +G  G       R NH  FSPD + 
Sbjct  551  EWIAFASDREDPGSG-SFELYLIHPNGTGLRKLVQSGLGG-------RTNHPYFSPDGKS  602

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            V+FT +  G++AEP+S P+ +QPYG++Y ++LDG+ L+RLT N +E+GTPAW P   + +
Sbjct  603  VVFTTDYAGISAEPISNPHHYQPYGEIYTIKLDGSDLKRLTHNSFEDGTPAWGP---IYI  659

Query  99   ARLSLGKSGEKLRGKFDEPLWIN  31
                +    E+ + +F++  W+N
Sbjct  660  EPNDVEWPNERPQCQFEDCHWLN  682



>ref|XP_010498624.1| PREDICTED: uncharacterized protein LOC104776288 [Camelina sativa]
Length=710

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 131/175 (75%), Gaps = 10/175 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  508  NNAFPWPSPDGKQIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGVWTDTMCNWSPDG  565

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   F ++++ P+GTG+R++  +G  G       R NH  FSPDS+ 
Sbjct  566  EWIAFASDRESPGSG-SFELFLIHPNGTGIRKLIQSGTGG-------RTNHPVFSPDSKS  617

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            ++FT++  G++ EP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  618  LVFTSDYAGISGEPISNPHSYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWSPR  672



>ref|XP_010063935.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104450916 
[Eucalyptus grandis]
Length=729

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 139/185 (75%), Gaps = 13/185 (7%)
 Frame = -1

Query  669  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            +K LT  T+G NNAFP+ SPDGK IVFRSGRSGHKNLYI+D++ GE   GG+ +LTDG W
Sbjct  510  VKRLT--TSGKNNAFPAPSPDGKWIVFRSGRSGHKNLYIMDAVKGEE--GGLYRLTDGPW  565

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
             DTM +WSPDG+ IAF+S+R +PG+   FS+Y++ P+GTGLR++  +G+ G       R 
Sbjct  566  SDTMCNWSPDGEWIAFASDREDPGSG-SFSLYLIHPNGTGLRKLIQSGSLG-------RA  617

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
            NH  FSPD + ++FT++   V+AEP+S  + +QPYG+++ ++LDG+ L+RLT N YE+GT
Sbjct  618  NHPYFSPDGKSIVFTSDYAAVSAEPISNSHHYQPYGEIFTIKLDGSDLKRLTHNSYEDGT  677

Query  132  PAWHP  118
            PAW P
Sbjct  678  PAWGP  682



>ref|XP_008466749.1| PREDICTED: uncharacterized protein LOC103504088 [Cucumis melo]
Length=703

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 136/186 (73%), Gaps = 13/186 (7%)
 Frame = -1

Query  669  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            IK LT  T G NNAFPS SPDGK IVFRSG++G+KNLYI+D+++GE    G+R+LT+G W
Sbjct  485  IKKLT--TNGENNAFPSPSPDGKWIVFRSGQTGYKNLYIMDAVDGE--SKGLRRLTEGLW  540

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
             DTM SWSPDG  IAFSS+R NPG A  F ++++ P+GTGLR++  +G  G       R 
Sbjct  541  TDTMCSWSPDGDWIAFSSDRENPG-AGSFDLFLIHPNGTGLRKLFQSGLGG-------RA  592

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
            NH  + PD + ++FT +  G++AEPVS P+ +QPYG++Y ++LDG+ LQRLT N YE+GT
Sbjct  593  NHPNWRPDGKALVFTTDNAGISAEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHNSYEDGT  652

Query  132  PAWHPK  115
            P W P+
Sbjct  653  PTWSPR  658



>ref|XP_007223068.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
 gb|EMJ24267.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
Length=553

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 129/174 (74%), Gaps = 10/174 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSG SGHKNLYI+D+ +GE  G  + +LT+G W DTM +WSPDG
Sbjct  342  NNAFPSPSPDGKRIVFRSGLSGHKNLYIMDAEDGERSG--LHRLTEGMWTDTMCNWSPDG  399

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R NPG+   F +YV+ P+GTGLR++  +G+ G       R NH  FSPD + 
Sbjct  400  EWIAFASDRDNPGSG-SFELYVIHPNGTGLRKVIESGSGG-------RTNHPWFSPDGKS  451

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            ++FT++ G ++AEP+S P+ +QPYG+++ + LDG+ L+RLT N YE+GTP W P
Sbjct  452  LVFTSDYGAISAEPISNPHHYQPYGEIFTINLDGSDLRRLTQNSYEDGTPVWIP  505



>ref|XP_004290903.2| PREDICTED: uncharacterized protein LOC101292474 [Fragaria vesca 
subsp. vesca]
Length=716

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 135/186 (73%), Gaps = 11/186 (6%)
 Frame = -1

Query  672  EIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
            +I V    T G NNAFPS SPDGK IVFRSGRSGHKNLYI+D+  GE  G  +++LT+G 
Sbjct  493  QIAVKKLTTNGKNNAFPSPSPDGKRIVFRSGRSGHKNLYIMDAEEGERIG--LQRLTEGP  550

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  316
            W DTM +WSPDG  IAF+S+R NPG+   F +YV+ P+GTGLR++  +G+ G       R
Sbjct  551  WTDTMCNWSPDGDWIAFASDRENPGSG-SFELYVIHPNGTGLRKVIQSGSGG-------R  602

Query  315  LNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  136
             NH  FSPD + ++FT++ G ++AEP+S P+ +QPYG+++ +++DG+ L+RLT N +E+G
Sbjct  603  TNHPWFSPDGKSLVFTSDYGAISAEPISNPHHYQPYGEIFTVKVDGSDLRRLTQNSFEDG  662

Query  135  TPAWHP  118
            TP W P
Sbjct  663  TPVWVP  668



>ref|XP_009343980.1| PREDICTED: uncharacterized protein LOC103935890 [Pyrus x bretschneideri]
Length=689

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 133/188 (71%), Gaps = 12/188 (6%)
 Frame = -1

Query  675  VEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  502
            V+     K TT   NNAFPS SPDGK IVFRSGR+GHKNLYI+D   GE   GG+ +LT+
Sbjct  471  VDRATFKKLTTNGKNNAFPSPSPDGKQIVFRSGRTGHKNLYIMDVEVGE--SGGLYRLTE  528

Query  501  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            G W DTM +WSPDG  IAF+S+R +PG+   F +YV+RP+G GLR++  +G  G      
Sbjct  529  GPWTDTMCNWSPDGNWIAFASDREDPGSG-SFELYVIRPNGAGLRKVIQSGTGG------  581

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  142
             R NH  FSPDS+ ++FT++   ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE
Sbjct  582  -RTNHPWFSPDSKSLVFTSDYRAISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTQNSYE  640

Query  141  NGTPAWHP  118
            +GTP W P
Sbjct  641  DGTPVWVP  648



>gb|EAZ40813.1| hypothetical protein OsJ_25290 [Oryza sativa Japonica Group]
Length=594

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 134/248 (54%), Gaps = 69/248 (28%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV+IARL FD   LT   D    E+   +KVLT+   GN                   
Sbjct  412  KATVRIARLEFDAGELTTGRD----EVAATLKVLTRPEAGN-------------------  448

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSI  400
                                          D  P+ SP GK +              F I
Sbjct  449  ------------------------------DAFPAVSPCGKWV-------------VFRI  465

Query  399  YVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQ  220
            Y+VRPDG+GLRR+HVAG  GS   +RER+NHVCFSPDS W+LFTAN GGV AEP+S PNQ
Sbjct  466  YLVRPDGSGLRRVHVAGPAGSAAADRERINHVCFSPDSRWLLFTANFGGVMAEPISAPNQ  525

Query  219  FQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLRGKFD  49
            FQPYGDLY+ RLDG+GL RLT N YENGTPAW P +     L  LSLG  +G++  G+FD
Sbjct  526  FQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPASSPAAGLESLSLGPGAGDESLGEFD  585

Query  48   EPLWINSD  25
            EPLW+  D
Sbjct  586  EPLWLTCD  593



>ref|XP_008219596.1| PREDICTED: uncharacterized protein LOC103319783 [Prunus mume]
Length=697

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 129/174 (74%), Gaps = 10/174 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSG SGHKNLYI+D+ +GE    G+++LT+G W DTM +WSPDG
Sbjct  486  NNAFPSASPDGKRIVFRSGLSGHKNLYIMDAEDGER--SGLQRLTEGMWTDTMCNWSPDG  543

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            + IAF+S+R +PG+   F +YV+ P+GTGLR++  +G+ G       R NH  FSPD + 
Sbjct  544  EWIAFASDRDDPGSG-SFELYVIHPNGTGLRKVIQSGSGG-------RTNHPWFSPDGKS  595

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            ++FT++   ++AEP+S P+ +QPYG+++ + LDG+ L+RLT N YE+GTP W P
Sbjct  596  LVFTSDYRAISAEPISNPHHYQPYGEIFTINLDGSDLKRLTQNSYEDGTPVWIP  649



>ref|XP_010095431.1| hypothetical protein L484_013388 [Morus notabilis]
 gb|EXB60123.1| hypothetical protein L484_013388 [Morus notabilis]
Length=732

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 152/234 (65%), Gaps = 14/234 (6%)
 Frame = -1

Query  729  FDPSNLTddgdddsDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYII  553
            F P +   D    + E P +I V    T G NNAFPS SPDG  IVFRSG++G KNLYI+
Sbjct  487  FAPVSTEVDIIAVNVEDPEKIVVKKLTTNGKNNAFPSLSPDGNRIVFRSGQTGFKNLYIM  546

Query  552  DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTG  373
            D++ GE   GG+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +Y++ P+GTG
Sbjct  547  DAVKGE--EGGLHRLTEGPWTDTMCNWSPDGEWIAFASDRENPGSG-SFELYLIHPNGTG  603

Query  372  LRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  193
            LR +  +G+ G       R NH  FSPD + + FT++  G++AEP+S P+ +QPYG+++ 
Sbjct  604  LRTLIESGSGG-------RTNHPWFSPDGKKLAFTSDYAGISAEPISNPHHYQPYGEIFT  656

Query  192  MRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  31
            +  DG+ ++RLT N YE+GTP W PK    +  + +    ++ R +F++  W+N
Sbjct  657  VNFDGSDVRRLTHNSYEDGTPTWVPKF---IRPVDVEWPVDRPRCEFEDLHWLN  707



>ref|XP_004160721.1| PREDICTED: protein TolB-like [Cucumis sativus]
Length=703

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 134/186 (72%), Gaps = 13/186 (7%)
 Frame = -1

Query  669  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            IK LT  T G NNAFPS SPDGK IVFRSG++G+KNLYI+D++ GE    G+R+LT+G W
Sbjct  485  IKKLT--TNGENNAFPSPSPDGKWIVFRSGQTGYKNLYIMDAVEGE--SKGLRRLTEGQW  540

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
             DTM SWSP+G  IAFSS+R NPG  + F ++++ P+GTGLR++  +G  G       R 
Sbjct  541  TDTMCSWSPEGDWIAFSSDRENPGGGN-FDLFLIHPNGTGLRKLFQSGLGG-------RA  592

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
            NH  + PD + ++FT +  G++ EPVS P+ +QPYG++Y ++LDG+ LQRLT N YE+GT
Sbjct  593  NHPNWRPDGKALVFTTDNAGISGEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHNSYEDGT  652

Query  132  PAWHPK  115
            P W P+
Sbjct  653  PTWSPR  658



>ref|XP_004149439.1| PREDICTED: protein TolB-like [Cucumis sativus]
 gb|KGN47697.1| hypothetical protein Csa_6G382360 [Cucumis sativus]
Length=703

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 133/186 (72%), Gaps = 13/186 (7%)
 Frame = -1

Query  669  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            IK LT  T G NNAFPS SPDGK IVFRSG++G+KNLYI+D++ GE    G+R+LT+G W
Sbjct  485  IKKLT--TNGENNAFPSPSPDGKWIVFRSGQTGYKNLYIMDAVEGE--SKGLRRLTEGQW  540

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
             DTM SWSP+G  IAFSS+R NPG    F ++++ P+GTGLR++  +G  G       R 
Sbjct  541  TDTMCSWSPEGDWIAFSSDRENPGGG-SFDLFLIHPNGTGLRKLFQSGLGG-------RA  592

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
            NH  + PD + ++FT +  G++ EPVS P+ +QPYG++Y ++LDG+ LQRLT N YE+GT
Sbjct  593  NHPNWRPDGKALVFTTDNAGISGEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHNSYEDGT  652

Query  132  PAWHPK  115
            P W P+
Sbjct  653  PTWSPR  658



>ref|XP_008338671.1| PREDICTED: uncharacterized protein LOC103401727 [Malus domestica]
Length=689

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 126/174 (72%), Gaps = 10/174 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D   GE   GG+ +LT+G W DTM +WSPDG
Sbjct  485  NNAFPSPSPDGKQIVFRSGRTGHKNLYIMDVEVGE--SGGLYRLTEGPWTDTMCNWSPDG  542

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
              IAF+S+R +PG+   F +YV+RP+GTGLR++  +G  G       R NH  FSPDS+ 
Sbjct  543  NWIAFASDREDPGSG-SFELYVIRPNGTGLRKVIQSGTGG-------RTNHPWFSPDSKS  594

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            ++FT++   ++AEP+     +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  595  LVFTSDYRAISAEPIXNXXHYQPYGEIFTVKLDGSDLKRLTQNSYEDGTPVWVP  648



>ref|XP_006652005.1| PREDICTED: uncharacterized protein LOC102702184, partial [Oryza 
brachyantha]
Length=391

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 122/184 (66%), Gaps = 12/184 (7%)
 Frame = -1

Query  663  VLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
             + K T G  NNAFPS SPDGK +VFRSGRSGHKNLY++D+ +GE   GG+R+LT+G W 
Sbjct  175  AMKKLTVGGENNAFPSPSPDGKWVVFRSGRSGHKNLYVMDAEHGE--AGGVRRLTEGPWS  232

Query  489  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  310
            DTM +WSPDG+ IAF+S+RH+PG+         R               G       R N
Sbjct  233  DTMCNWSPDGEWIAFASDRHDPGSG--------RFAXXXXXXXGPGRRGGVHSGGGGRTN  284

Query  309  HVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
            H  FSPDS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++RLT N +E+GTP
Sbjct  285  HPWFSPDSKSIVFTSDYAAVSAEPVSNPHHYQPYGEIYTVSIDGSNIRRLTHNSFEDGTP  344

Query  129  AWHP  118
            AW P
Sbjct  345  AWTP  348



>ref|XP_010539663.1| PREDICTED: uncharacterized protein LOC104813673 [Tarenaya hassleriana]
Length=672

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 119/176 (68%), Gaps = 12/176 (7%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRS  SG+KNLYI+D+  GE   GG+ +LTDGAW DTM SWSPDG
Sbjct  474  NNAFPWPSPDGKRIVFRSSMSGNKNLYIMDAEKGET--GGLFRLTDGAWNDTMCSWSPDG  531

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL-NHVCFSPDSE  283
              IAF+SNR NPG  + F ++++ P+GTGLR++         E    R+ NH  FSPD +
Sbjct  532  DWIAFASNRENPGT-ESFGLFLIHPNGTGLRKL--------TETGLGRMSNHPVFSPDGK  582

Query  282  WVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
             V FT+N   ++AEP+S P+     G+++ ++LDG+ L R+T N Y +GTP W PK
Sbjct  583  TVAFTSNYAAISAEPISNPDIAISAGEIFTVKLDGSDLSRVTHNSYMDGTPIWAPK  638



>ref|XP_010477408.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756504 
[Camelina sativa]
Length=723

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 120/183 (66%), Gaps = 12/183 (7%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRS RSG KN+YIID+  GE   GG+ +LT+G W D++P+WSPDG
Sbjct  495  NNAFPWPSPDGKRIVFRSARSGAKNIYIIDAEKGE--SGGLFRLTNGNWNDSIPTWSPDG  552

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
              I FSSNR  PG     ++YVV PDGTGLR++       ++ +      H  FSPDS+ 
Sbjct  553  NWIVFSSNREFPGTF-LDNLYVVHPDGTGLRKL-------AQNLTGGLSMHSTFSPDSKR  604

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEV  106
            ++FT    G++AEP+ +P+ F   G+++ + LDG+ L RLT N  E+G P W P  KA V
Sbjct  605  IVFTTTYAGISAEPIGVPHFFIAGGEIFTVNLDGSDLTRLTHNSVEDGPPMWFPKIKATV  664

Query  105  DLA  97
            D+A
Sbjct  665  DVA  667



>ref|XP_010488216.1| PREDICTED: uncharacterized protein LOC104766097 [Camelina sativa]
Length=701

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 121/194 (62%), Gaps = 12/194 (6%)
 Frame = -1

Query  684  EIPVEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQ  511
            + P  +  + K TT   NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +
Sbjct  472  DAPNPLTAVKKLTTKGENNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFR  529

Query  510  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  331
            LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++       ++ 
Sbjct  530  LTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQN  581

Query  330  VNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  151
            +      H  FSPDS+ ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT N
Sbjct  582  LTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHN  641

Query  150  GYENGTPAWHPKAE  109
              E+G P W PK +
Sbjct  642  SLEDGPPMWFPKIK  655



>ref|NP_564146.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41420.1|AC007727_9 F8K7.9 [Arabidopsis thaliana]
 gb|AAK59584.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30137.1| uncharacterized protein AT1G21670 [Arabidopsis thaliana]
Length=703

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 120/188 (64%), Gaps = 13/188 (7%)
 Frame = -1

Query  669  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            +K LT  TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W
Sbjct  482  VKKLT--TTGENNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--SGGLFRLTNGNW  537

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
             DT+ +WSPDG  I F+SNR  PG     +IYVV PDGTGLR++       ++ +     
Sbjct  538  NDTIATWSPDGNWIVFASNREFPGTL-LMNIYVVHPDGTGLRKL-------AQNLTGLVS  589

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
             H  FSPDS+ ++FT    G++AE +  P+   P  +++ + LDG+GL RLT N  E+G 
Sbjct  590  MHPMFSPDSKRIVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSGLTRLTHNSVEDGP  649

Query  132  PAWHPKAE  109
            P W PK +
Sbjct  650  PMWFPKIK  657



>ref|XP_010466456.1| PREDICTED: uncharacterized protein LOC104746633 isoform X1 [Camelina 
sativa]
Length=701

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 114/177 (64%), Gaps = 10/177 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD 
Sbjct  489  NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDN  546

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
              I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FSPDS+ 
Sbjct  547  NWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKR  598

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
            ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  599  IVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_010510815.1| PREDICTED: uncharacterized protein LOC104787018 [Camelina sativa]
Length=700

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 10/178 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD 
Sbjct  488  NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDN  545

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
              I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FSPDS+ 
Sbjct  546  NWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKR  597

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV  106
            ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT N  E+G P W PK + 
Sbjct  598  IVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIKA  655



>ref|XP_010466457.1| PREDICTED: uncharacterized protein LOC104746633 isoform X2 [Camelina 
sativa]
Length=701

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 113/177 (64%), Gaps = 10/177 (6%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD 
Sbjct  489  NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDN  546

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
              I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FSPDS+ 
Sbjct  547  NWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKR  598

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
            ++FT+   G++AEP+  P    P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  599  IVFTSIYAGLSAEPIGTPRFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_002890451.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66710.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 120/188 (64%), Gaps = 13/188 (7%)
 Frame = -1

Query  669  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            +K LT  TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W
Sbjct  482  VKKLT--TTGENNAFPWPSPDGKRIVFRSSRSGTKNLYIMDAEKGE--SGGLFRLTNGNW  537

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
             DT+ +WSPDG  I F+SNR  PG     +IYVV PDGTGLR++       ++ +     
Sbjct  538  NDTIATWSPDGNWIVFASNREFPGTL-LMNIYVVHPDGTGLRKL-------AQNLTGGVS  589

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
             H  FSPDS+ ++FT    G++AE +  P+   P  +++ + LDG+G+ RLT N  E+G 
Sbjct  590  MHPMFSPDSKRIVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSGMTRLTHNSVEDGP  649

Query  132  PAWHPKAE  109
            P W PK +
Sbjct  650  PMWFPKIK  657



>ref|XP_005646452.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21908.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=732

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 115/187 (61%), Gaps = 18/187 (10%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
             ++  LT   TGNNAFPS S DG  IVFRSGRSG KNLYI+ +   E +  G+ +LT+G 
Sbjct  489  TDVLTLTANGTGNNAFPSFSSDGSEIVFRSGRSGFKNLYIMPT---EGEAAGLIRLTEGP  545

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGN---ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  325
            W DTMP W+P    I F+S+R    +   A  F I+++R DG+GL+++         + +
Sbjct  546  WDDTMPGWTPASGWIVFASSREYVESNRPAGAFDIFMIRTDGSGLQKVF--------DSH  597

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  145
                NH  FSP    V+FT      +AE +S P+QFQPYGDL+ +  DGT L+RLT + Y
Sbjct  598  GGLANHPHFSPSQTSVVFTR----YSAEEISTPHQFQPYGDLFAIDTDGTNLRRLTHDPY  653

Query  144  ENGTPAW  124
            ENGTPAW
Sbjct  654  ENGTPAW  660



>ref|XP_006416278.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
 gb|ESQ34631.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
Length=698

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -1

Query  648  TTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  472
            TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D + +W
Sbjct  488  TTGQNNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGET--GGLFRLTNGNWSDVIATW  545

Query  471  SPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSP  292
            SPDG  I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FSP
Sbjct  546  SPDGNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKV-------AQNLTGAVSMHPMFSP  597

Query  291  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  112
            DS+ ++FT     ++AE +  P+   P  +++ + LDG+   RLT N  E+G P W PK 
Sbjct  598  DSKRIVFTTTYAAISAESIGNPHFNVPSSEIFTVNLDGSDFTRLTHNSLEDGPPMWFPKI  657

Query  111  EV  106
            + 
Sbjct  658  KA  659



>emb|CBI18981.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = -1

Query  528  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  349
            GGGI +LT+G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G
Sbjct  372  GGGIHRLTEGPWTDTMCNWSPDGDWIVFASDRENPGGG-GFELYVIHPNGTGLRKVVHSG  430

Query  348  AEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  169
            + G       R NH  FSPD + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL
Sbjct  431  SAG-------RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGL  483

Query  168  QRLTWNGYENGTPAWHPKA  112
             RLT N YE+GTPAW PK 
Sbjct  484  HRLTHNSYEDGTPAWAPKV  502



>emb|CDY04661.1| BnaC05g16990D [Brassica napus]
Length=697

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 112/188 (60%), Gaps = 12/188 (6%)
 Frame = -1

Query  663  VLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
             + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W 
Sbjct  482  AVKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWN  539

Query  489  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  310
            DT+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      
Sbjct  540  DTIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSM  591

Query  309  HVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
            H  FSPDS+ ++FT    G++AEP+  P       +++ + LDG+   RLT N  E+G P
Sbjct  592  HPMFSPDSKRIVFTTTYAGISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPP  651

Query  129  AWHPKAEV  106
             W PK + 
Sbjct  652  LWFPKIKA  659



>gb|EAY93383.1| hypothetical protein OsI_15178 [Oryza sativa Indica Group]
Length=470

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 11/156 (7%)
 Frame = -1

Query  585  GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  406
            G  GHKNLYI+D+ +GE   GGIR+LT+G W DTM +WSP  + IAF+S+RH PG+   F
Sbjct  284  GCRGHKNLYIMDAKDGE--AGGIRRLTEGPWSDTMCNWSPHDEWIAFASDRHAPGSGS-F  340

Query  405  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP  226
            +I +V P+GTGLRR+  +G  G       R NH  FS D + ++FT++   V+AEPVS P
Sbjct  341  AI-MVHPNGTGLRRVVHSGDGG-------RTNHPWFSSDFKSLVFTSDYAAVSAEPVSNP  392

Query  225  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            + +QPYG++Y + +DG+ ++RLT N +E+GTP+W P
Sbjct  393  HHYQPYGEIYTVDIDGSNIRRLTHNSFEDGTPSWTP  428



>ref|XP_002520327.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42113.1| conserved hypothetical protein [Ricinus communis]
Length=540

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 120/192 (63%), Gaps = 18/192 (9%)
 Frame = -1

Query  678  PVEIKVLTKETTG--NNAFPSCSPDGKHI--VFRSGRSGHKNLYIIDSLNGELDGGGIRQ  511
            P      T+ TT   NNAFP    DG  +  VFR  R+    LYI+D++ GE   GG+ +
Sbjct  313  PAFASATTQLTTNGDNNAFPDRMGDGLCLGRVFRVVRT----LYIMDAVEGE--KGGLYR  366

Query  510  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  331
            + +G W DTM  WSPDG+ I F S+R  PG    F +Y + P+GTGLR++  +G+ G   
Sbjct  367  VIEGLWDDTMCDWSPDGEWIVFCSDREEPGTG-SFDLYFIHPNGTGLRKLLQSGSGG---  422

Query  330  VNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  151
                R+NH+  SP+ + ++FT +   ++AEP+S    FQPYG++Y++ LDG+GL+RLT N
Sbjct  423  ----RVNHLYISPNGKSIVFTTDYTAISAEPISNQQMFQPYGEIYIINLDGSGLKRLTHN  478

Query  150  GYENGTPAWHPK  115
             +E+GTPAW P+
Sbjct  479  SFEDGTPAWGPR  490



>emb|CDY08187.1| BnaA06g15390D [Brassica napus]
Length=704

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 111/186 (60%), Gaps = 12/186 (6%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D
Sbjct  490  VKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWND  547

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
            T+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      H
Sbjct  548  TIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMH  599

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
              FSPDS+ ++FT     ++AEP+  P       +++ + LDG+   RLT N  E+G P 
Sbjct  600  PMFSPDSKRIVFTTTYAAISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPL  659

Query  126  WHPKAE  109
            W PK +
Sbjct  660  WFPKIK  665



>ref|XP_009149685.1| PREDICTED: uncharacterized protein LOC103873008 [Brassica rapa]
Length=704

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 111/186 (60%), Gaps = 12/186 (6%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D
Sbjct  490  VKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWND  547

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
            T+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      H
Sbjct  548  TIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMH  599

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
              FSPDS+ ++FT     ++AEP+  P       +++ + LDG+   RLT N  E+G P 
Sbjct  600  PMFSPDSKRIVFTTTYAAISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPL  659

Query  126  WHPKAE  109
            W PK +
Sbjct  660  WFPKIK  665



>gb|KFK44273.1| hypothetical protein AALP_AA1G236600 [Arabis alpina]
Length=690

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 114/183 (62%), Gaps = 12/183 (7%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            NNAFP  SPDGK IVFRS RSG  NLYI+D+  GE   GG+ +LT+G   DT+ +WSPDG
Sbjct  486  NNAFPWPSPDGKRIVFRSARSGSFNLYIMDAKKGET--GGLFRLTNGHGNDTIATWSPDG  543

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
              I F+SNR  PG     ++YVV PDGTGL+++       +E++      H  FSPDS+ 
Sbjct  544  NWIVFASNREFPGTL-FLNLYVVHPDGTGLKKV-------TEKLTGGISMHPMFSPDSKR  595

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEV  106
            ++FT     ++AEP+  P+   P  +++ + LDG+ L R+T N  E+G P W P  KA  
Sbjct  596  IVFTTIHAAISAEPIGNPHFNVPSSEIFTVNLDGSDLTRITHNSVEDGPPMWFPKIKATS  655

Query  105  DLA  97
            D+A
Sbjct  656  DVA  658



>gb|KCW45417.1| hypothetical protein EUGRSUZ_L00885 [Eucalyptus grandis]
Length=531

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 90/126 (71%), Gaps = 10/126 (8%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            K TVQIAR+ FD S+          +I  ++KVLT+E T NNAFPSCSPDGK +VFRSGR
Sbjct  408  KTTVQIARIEFDLSS-------TDGDITCDVKVLTREDTRNNAFPSCSPDGKWLVFRSGR  460

Query  579  SGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNP--GNADCF  406
            +GHKNLYI+D +NGE D  GI QLTDG+WIDTMPSWSP+  LIAF  N HNP  G  D  
Sbjct  461  TGHKNLYIVDVVNGEFD-SGICQLTDGSWIDTMPSWSPNDNLIAFFLNWHNPHVGRYDAD  519

Query  405  SIYVVR  388
              Y++R
Sbjct  520  LEYILR  525



>gb|EMT16880.1| hypothetical protein F775_15390 [Aegilops tauschii]
Length=390

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 114/188 (61%), Gaps = 33/188 (18%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG-GGIRQLTDGAWIDTMPSWSPD  463
            + ++PS SPDGK I F     G   LY+++S     DG GG R++  G    T   W   
Sbjct  168  DGSYPSFSPDGKRIAF----VGLPGLYVVNS-----DGSGGRRKIFSGNAFPTSWDWKRK  218

Query  462  GKL---------------IAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV  328
            G +               IAF+S+RHNPG A  F+IY++ P+GTGLRR+ V  A+G    
Sbjct  219  GVIYTSIGPDFASESTEWIAFASDRHNPG-AGSFAIYMIHPNGTGLRRV-VHSADGG---  273

Query  327  NRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  148
               R NH  FSPDS+ ++FT++L  V+AEP+S P  +QPYG+++ + +DG+GLQRLT N 
Sbjct  274  ---RTNHPWFSPDSKRMVFTSDLAAVSAEPISNPRHYQPYGEIFTINIDGSGLQRLTHNS  330

Query  147  YENGTPAW  124
            +E+GTP+W
Sbjct  331  FEDGTPSW  338



>gb|KCW71232.1| hypothetical protein EUGRSUZ_F04330 [Eucalyptus grandis]
Length=640

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 94/127 (74%), Gaps = 13/127 (10%)
 Frame = -1

Query  669  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            +K LT  T+G NNAFP+ SPDGK IVFRSGRSGHKNLYI+D++ GE   GG+ +LTDG W
Sbjct  510  VKRLT--TSGKNNAFPAPSPDGKWIVFRSGRSGHKNLYIMDAVKGEE--GGLYRLTDGPW  565

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
             DTM +WSPDG+ IAF+S+R +PG+   FS+Y++ P+GTGLR++  +G+ G       R 
Sbjct  566  SDTMCNWSPDGEWIAFASDREDPGSG-SFSLYLIHPNGTGLRKLIQSGSLG-------RA  617

Query  312  NHVCFSP  292
            NH  FSP
Sbjct  618  NHPYFSP  624



>ref|XP_002467956.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
 gb|EER94954.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
Length=724

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 113/198 (57%), Gaps = 31/198 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFP  +PDG   VFRS R G    +KNLYI+ D+  GE+ GG + +LT+G+WIDT   
Sbjct  483  NNAFPFTNPDGTKFVFRSTRDGGDKNYKNLYIMEDAEFGEVGGGKVTRLTEGSWIDTHCQ  542

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            WSPDG L+ F+SNR  P +A           F++Y++      + R+  +G + S  V  
Sbjct  543  WSPDGNLVVFASNRDKPADAPERDHGLDPGYFAVYLMNVSDRSVVRVIRSGYDLSGHV--  600

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ-----  166
               NH  FSPD   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   ++     
Sbjct  601  ---NHPVFSPDGRSIAVTSDLAAVSADPMSLPTFLHSVRPYGDIFSVDIDPDDMEKNKDL  657

Query  165  ----RLTWNGYENGTPAW  124
                R+T + YEN TPAW
Sbjct  658  DKFVRVTHSRYENSTPAW  675



>gb|AEW08691.1| hypothetical protein CL1213Contig1_01, partial [Pinus lambertiana]
Length=97

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = -1

Query  756  ATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS  577
            ATV I  + F+P +L  +  +   E+  E+++LTK+ T NNAFPS SPDGK +VFRSGRS
Sbjct  1    ATVHIISIRFNPEDLGLEELE---EVKSEVRILTKDGTKNNAFPSSSPDGKQLVFRSGRS  57

Query  576  GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            GHKNLYI+D+  GE   GGIR LT+G WIDTMPSWSPDG+ I
Sbjct  58   GHKNLYIMDAEQGE--EGGIRALTEGPWIDTMPSWSPDGEWI  97



>gb|EMT08438.1| hypothetical protein F775_30261 [Aegilops tauschii]
Length=806

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 117/208 (56%), Gaps = 32/208 (15%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLT  505
            E ++LTK    NNAFPS + DG  +VFRS R+G    +KNLY++D+  GE DGG   ++T
Sbjct  557  ERRLLTK-GKFNNAFPSTNSDGTKLVFRSTRNGGHKKYKNLYMMDAEIGE-DGGEAERIT  614

Query  504  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVA  352
            +G WIDT   WSPD   I FSSNR  P +A           F++Y++      + R+  +
Sbjct  615  EGDWIDTHCQWSPDRDWIVFSSNRDKPADAPERDHGMDPGYFAVYLMNAIDRSVVRVIRS  674

Query  351  GAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD  181
            G + S  V     NH  FSPD   ++ TA+L  V+A+P+S+P   +  +PYGD++ + +D
Sbjct  675  GYDFSGHV-----NHPVFSPDGRSIVVTADLAAVSADPMSLPLLLHSQRPYGDIFTVDID  729

Query  180  GTGLQ---------RLTWNGYENGTPAW  124
               ++         R+T + YEN TP W
Sbjct  730  PDDMEKNQDVEEFARVTHSRYENATPDW  757



>ref|NP_001173830.1| Os04g0278101 [Oryza sativa Japonica Group]
 dbj|BAH92558.1| Os04g0278101 [Oryza sativa Japonica Group]
Length=378

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 114/216 (53%), Gaps = 60/216 (28%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            + K T G  NNAFPS  PDGK                   L+GE   GGIR+LT+G W D
Sbjct  202  MKKLTVGDENNAFPSPPPDGKW------------------LDGE--AGGIRRLTEGPWSD  241

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
            TM +WSPD + IAF+S+RH PG+   F+I +V P+GTG                      
Sbjct  242  TMCNWSPDDEWIAFASDRHAPGSG-SFAI-MVHPNGTG----------------------  277

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
                 DS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++RLT N +E+GTP+
Sbjct  278  ----SDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDIDGSNIRRLTHNSFEDGTPS  333

Query  126  WHPKAEVDLARLSLGKSGEKL----RGKFDEPLWIN  31
            W P        L     GE L    R  F +  W+N
Sbjct  334  WTPYF------LDPRDVGETLQASGRCAFQDCHWLN  363



>ref|XP_002446045.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
 gb|EES10373.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
Length=730

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 107/199 (54%), Gaps = 32/199 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS SPDG   VFRS R G    HKNLYI  D+  GE  GG + +LT+G W DT   
Sbjct  488  NNAFPSSSPDGSRFVFRSTRDGGDKKHKNLYIAEDAEVGEYSGGTVTRLTNGEWTDTHCQ  547

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  325
            WSP G  I FSS R  P +A           +++++V+  D T + R+  +G +    V 
Sbjct  548  WSPRGDWIVFSSTRDKPKDAPELDNGLDSGYYAVFMVKVSDPTVVIRVVQSGDDLGGHV-  606

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  178
                NH  FSPD   +  TA+L  V+A+P+S+P   +  +PYGD++++ +D         
Sbjct  607  ----NHPVFSPDGRSIAMTADLAAVSADPISLPLFIHSVRPYGDIFVVDIDPDDARKNKD  662

Query  177  -TGLQRLTWNGYENGTPAW  124
                 R+T + YE  TPAW
Sbjct  663  VKKFHRVTHSRYEYSTPAW  681



>ref|XP_004963491.1| PREDICTED: uncharacterized protein LOC101774581 [Setaria italica]
Length=740

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 109/209 (52%), Gaps = 32/209 (15%)
 Frame = -1

Query  666  KVLTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQL  508
            +V+ + T G  NNAFPS +P+G   VFRS R G    HKNLYI+ DS  GE   G + +L
Sbjct  507  QVVNRLTKGDFNNAFPSSNPEGTKFVFRSTRDGGDKHHKNLYIMEDSDMGEHGEGTVTRL  566

Query  507  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA--------DCFSIYVVRPDGTGLRRIHVA  352
            TDG W DT  SWSP G  I FSS+R  P  A          F+I++V  +   +    V 
Sbjct  567  TDGPWTDTHCSWSPRGDWIVFSSSRDKPAGAPEKDILDPGFFAIFLVNANNPDV----VV  622

Query  351  GAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD  181
                S +     + H  FSPD   ++ TA+L  V+AEP+S+P   +  +PYGD++ + L 
Sbjct  623  RVMKSSDTIAGHVTHPMFSPDMRSIVVTADLAAVSAEPISMPQFLHSVRPYGDVFSVNLR  682

Query  180  GT----------GLQRLTWNGYENGTPAW  124
             T             R+T + YE  TPAW
Sbjct  683  DTVDIAKNENIEEFHRITHSRYEYATPAW  711



>ref|XP_010675836.1| PREDICTED: uncharacterized protein LOC104891779 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 114/207 (55%), Gaps = 29/207 (14%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGG-IRQL  508
            ++K LT  +  NNAFP  +PDG  +VFRS R G    +KNLYII+ L+   DG G I +L
Sbjct  473  QVKRLTNGS--NNAFPCTNPDGTKLVFRSTRDGGENHYKNLYIIEDLDSMEDGEGEITRL  530

Query  507  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD-------CFSIYVVRPDGTGLRRIHVAG  349
            T+G W+DT   WSP+G+ I F+SNRH   +          F++Y+V+ D   +  + V G
Sbjct  531  TNGPWVDTHCEWSPNGEWIVFASNRHRTTDDSDHGLDTGYFAVYLVKADDPDV-WVKVIG  589

Query  348  AEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG  178
            +   +      +NH  FSPD   +   A+L  V+ +P+S+P   +  +PYGDL+++ +D 
Sbjct  590  SRSGDLAG--HVNHPFFSPDGRSLSVVADLAAVSCDPISMPLFIHSVRPYGDLFILDIDE  647

Query  177  TGL---------QRLTWNGYENGTPAW  124
              +         +R+T   YEN T  W
Sbjct  648  DDIYANEDVEDYRRITHTRYENSTAVW  674



>gb|AFG48602.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
 gb|AFG48603.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
 gb|AFG48605.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = -1

Query  756  ATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS  577
            ATV I  ++F P +L  +  ++      E+++LTK+ T NNAFPS SPDGK +VFRSGRS
Sbjct  1    ATVHIISISFKPEDLALEESEEVK---SEVRILTKDGTKNNAFPSSSPDGKQLVFRSGRS  57

Query  576  GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            GHKNLYI+D+  GE   GGI  LT+G WIDTMPSWSPDG+ I
Sbjct  58   GHKNLYIMDAEEGE--EGGIHALTEGPWIDTMPSWSPDGEWI  97



>gb|AEW08692.1| hypothetical protein CL1213Contig1_01, partial [Pinus radiata]
 gb|AFB33859.1| hypothetical protein CL1213Contig1_01, partial [Pinus mugo]
 gb|AFB33860.1| hypothetical protein CL1213Contig1_01, partial [Pinus mugo]
 gb|AFG48604.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = -1

Query  756  ATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS  577
            ATV I  ++F P +L  +  ++      E+++LTK+ T NNAFPS SPDGK +VFRSGRS
Sbjct  1    ATVHIISISFKPEDLALEESEEVK---SEVRILTKDGTKNNAFPSSSPDGKQLVFRSGRS  57

Query  576  GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            GHKNLYI+D+  GE   GGI  LT+G WIDTMPSWSPDG+ I
Sbjct  58   GHKNLYIMDAEKGE--EGGIHALTEGPWIDTMPSWSPDGEWI  97



>ref|XP_010102639.1| hypothetical protein L484_010931 [Morus notabilis]
 gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis]
Length=714

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 113/199 (57%), Gaps = 32/199 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS +PDG  +VFRS R G    +KNLYI+ D+ +GE   G I +LT+G WIDT   
Sbjct  473  NNAFPSTNPDGTKLVFRSTRDGGDERYKNLYIMEDAESGEYGDGIITRLTNGPWIDTHCQ  532

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  325
            WSP G  I FSS R  P +A           F++Y+V+  D + + R+  +G++ +  V 
Sbjct  533  WSPRGDWIVFSSTRDKPEDAPESDNDLDPGYFAVYLVKANDPSVVVRVLGSGSDVAGHV-  591

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  169
                NH  FSPD + ++ TA+L  V+ +P+S+P   +  +PYGD++ + +D   +     
Sbjct  592  ----NHPIFSPDGKSIVVTADLAAVSVDPISLPLFLHSVRPYGDIFTIDIDPDDIYMNED  647

Query  168  ----QRLTWNGYENGTPAW  124
                 R+T + YEN T +W
Sbjct  648  VEKCNRITHSRYENSTASW  666



>ref|XP_002519802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42598.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 110/199 (55%), Gaps = 32/199 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKQYKNLYIMEDAKVGEFGDGKITRLTNGPWTDTHCQ  542

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  325
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPDSDNGLDPGYFAVFLVKVNDPSVVIRVIKSGDDLAGHV-  601

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  169
                NH  FSPD   +  T++L  V+ +P+S+P   +  +PYGDL+++ +D + +     
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSVDPISLPLFLHSVRPYGDLFVVDIDPSDINKNKD  657

Query  168  ----QRLTWNGYENGTPAW  124
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>gb|AFG48601.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = -1

Query  756  ATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS  577
            ATV I  ++F P +L  +  ++      E+++LTK+ T NNAFPS SPDGK +VFRSGRS
Sbjct  1    ATVHIISISFKPEDLALEESEEVK---SEVRILTKDGTKNNAFPSSSPDGKQLVFRSGRS  57

Query  576  GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            GHKNLYI+D+  GE    GI  LT+G WIDTMPSWSPDG+ I
Sbjct  58   GHKNLYIMDAEKGE--ESGIHALTEGPWIDTMPSWSPDGEWI  97



>ref|XP_002519807.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42603.1| conserved hypothetical protein [Ricinus communis]
Length=711

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 109/199 (55%), Gaps = 32/199 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS +PDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G WIDT   
Sbjct  480  NNAFPSTNPDGTKLVFRSTRDGGDKKYKNLYIMEDARVGEYGDGKITRLTNGPWIDTHCQ  539

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  325
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G   +  V 
Sbjct  540  WSPRGNWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKANDSSVVVRVIKSGDNIAGHV-  598

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  169
                NH  FSPD   +  T++L  V+ +PVS+P   +  +PYGD++ + +D   +     
Sbjct  599  ----NHPFFSPDGMSIAVTSDLAAVSVDPVSLPHFLHSVRPYGDVFTLDIDPDDINKNKD  654

Query  168  ----QRLTWNGYENGTPAW  124
                 R+T + YEN TP+W
Sbjct  655  LKKFNRITHSRYENATPSW  673



>ref|XP_008662981.1| PREDICTED: uncharacterized protein LOC103641407 [Zea mays]
 gb|AFW57694.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=730

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 106/199 (53%), Gaps = 32/199 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS SPDG   VFRS R G    HKNLYI ++   GE   G + +LT+G W DT   
Sbjct  488  NNAFPSSSPDGNRFVFRSTRDGGDKKHKNLYIAENAEVGEYGDGTVTRLTNGEWTDTHCQ  547

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  325
            WSP G  I FSS R  P +A           F++++V+  D T + R+  +G +    V 
Sbjct  548  WSPSGDWIVFSSTRDKPKDAPELDNGLDPGYFAVFMVKASDPTVVIRVIRSGDDLGGHV-  606

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  178
                NH  FSPD   ++ T++L  V+A+P+S+P   +  +PYGD++++ +D         
Sbjct  607  ----NHPVFSPDGRSIVVTSDLAAVSADPISLPLFIHSVRPYGDIFVVDIDPEDASKNKD  662

Query  177  -TGLQRLTWNGYENGTPAW  124
                 R+T + YE  TP W
Sbjct  663  VKKFHRVTHSRYEYSTPTW  681



>gb|EAY89757.1| hypothetical protein OsI_11300 [Oryza sativa Indica Group]
Length=737

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 108/201 (54%), Gaps = 34/201 (17%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGG---IRQLTDGAWIDT  484
            NNAFPS +PDG   VFRS R G     KNLYI+ D+  GE + G    + ++T G W DT
Sbjct  493  NNAFPSTNPDGTKFVFRSTRDGGAKYSKNLYIMEDADAGEGEDGSQSTVTRMTAGEWTDT  552

Query  483  MPSWSPDGKLIAFSSNRHNPGNA---------DCFSIYVVRPDGTGLRRIHVAGAEGSEE  331
               WSP+GK I FSSNR  P +A           F++Y++      + R+  +G + +  
Sbjct  553  HCQWSPNGKWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVVRVIRSGYDVAGH  612

Query  330  VNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG------  178
            V     NH  FSPD   +  T++L  VTA+P+S+P   +  +PYGD++ + +D       
Sbjct  613  V-----NHPVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIFTVDIDPDDMARN  667

Query  177  ---TGLQRLTWNGYENGTPAW  124
                G  R+T + YEN TPAW
Sbjct  668  EDVEGFVRVTHSRYENSTPAW  688



>dbj|BAJ92843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=754

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 104/200 (52%), Gaps = 33/200 (17%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  478
            NNAFPS +P G   VFRS R G     HKNLYI+ D+  GE   G + +LTDG W DT  
Sbjct  509  NNAFPSSNPQGDKFVFRSTRDGGKEKFHKNLYIMEDAEVGEFSEGTVTRLTDGPWTDTHC  568

Query  477  SWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  325
            SWSP G  + FSS R  P         +A  F++Y+V+  D T + R+  + A  +  V 
Sbjct  569  SWSPRGDWVVFSSTREMPPSAPEMAFLDAGYFAVYLVKVSDPTAVVRVVQSSATLAGHV-  627

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  172
                NH  FSPD   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  628  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDIAKNK  683

Query  171  ----LQRLTWNGYENGTPAW  124
                  R+T + YE  TP W
Sbjct  684  DIQEFHRITHSRYEYSTPTW  703



>ref|NP_001049934.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|ABF95608.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11848.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|EAZ26709.1| hypothetical protein OsJ_10615 [Oryza sativa Japonica Group]
Length=730

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 108/201 (54%), Gaps = 34/201 (17%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGG---IRQLTDGAWIDT  484
            NNAFPS +PDG   VFRS R G     KNLYI+ D+  GE + G    + ++T G W DT
Sbjct  486  NNAFPSTNPDGTKFVFRSTRDGGAKYSKNLYIMEDADAGEGEDGSQSTVTRMTAGEWTDT  545

Query  483  MPSWSPDGKLIAFSSNRHNPGNA---------DCFSIYVVRPDGTGLRRIHVAGAEGSEE  331
               WSP+GK I FSSNR  P +A           F++Y++      + R+  +G + +  
Sbjct  546  HCQWSPNGKWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVVRVIRSGYDVAGH  605

Query  330  VNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG------  178
            V     NH  FSPD   +  T++L  VTA+P+S+P   +  +PYGD++ + +D       
Sbjct  606  V-----NHPVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIFTVDIDPDDMARN  660

Query  177  ---TGLQRLTWNGYENGTPAW  124
                G  R+T + YEN TPAW
Sbjct  661  EDVEGFVRVTHSRYENSTPAW  681



>ref|XP_010675829.1| PREDICTED: uncharacterized protein LOC104891772 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 111/202 (55%), Gaps = 22/202 (11%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIID-SLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            N+AFPS + DG  +V+RS + G KNLYI++ +L GE +G  + +LT+G W DT   WSP 
Sbjct  484  NSAFPSTNADGTRLVYRSTKDGPKNLYIMENALLGEFEGAKVTRLTEGNWTDTHCQWSPK  543

Query  462  GKLIAFSSNRHNPG--------NADCFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLN  310
               I F+SNR NP         +   F +Y+V+  D T + ++  +G     ++    +N
Sbjct  544  QDWIVFASNRSNPTAKTPQDLPDPGFFGVYLVKANDKTVVVKVMDSGYTYLGDLFPGHVN  603

Query  309  HVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------Q  166
            H  FSPD E ++  A+L  V+ +PVS+P   +  +PYGD++++ ++   +          
Sbjct  604  HPFFSPDGESLVVAADLAAVSCDPVSMPLFVHSVRPYGDIFILDINRDDIYKNENLKKFT  663

Query  165  RLTWNGYENGTPAWHPKAEVDL  100
            R+T + YEN T  W   +  DL
Sbjct  664  RVTHSKYENSTATWTMTSTKDL  685



>ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38223.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 109/199 (55%), Gaps = 32/199 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKKYKNLYIMEDAQVGEYGDGKITRLTNGPWTDTHCQ  542

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  325
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKVNDPSVVIRVIKSGDDLAGHV-  601

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  169
                NH  FSPD   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   +     
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSADPISLPLFLHSVRPYGDVFTVDIDPDDINKNKD  657

Query  168  ----QRLTWNGYENGTPAW  124
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>gb|EAY90391.1| hypothetical protein OsI_11968 [Oryza sativa Indica Group]
Length=744

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 105/203 (52%), Gaps = 36/203 (18%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  481
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE   G + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTGKVTRLTSGAWTDTH  554

Query  480  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  337
             SWSP      I FSS R  P  A           F++++VR  D T + R+       S
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRV-----VRS  609

Query  336  EEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  178
             +     +NH  FSPD   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  610  ADSVAGHVNHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  177  -----TGLQRLTWNGYENGTPAW  124
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|WP_041858684.1| hypothetical protein [Candidatus Solibacter usitatus]
Length=611

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 100/185 (54%), Gaps = 27/185 (15%)
 Frame = -1

Query  660  LTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI--RQLTDGAWID  487
            LT E  GNNAFPS SPDGK  V+R+       L I   +N E   G I  RQ       D
Sbjct  445  LTAEP-GNNAFPSFSPDGKRFVYRTFTEDGYGLRI---MNLETKTGKILTRQY------D  494

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
              P WSP G LI FS           + IY ++PDG+ L+R+       +         H
Sbjct  495  NFPLWSPRGDLITFSRQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------H  540

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
            + +SPD E+++FT++  G   E V+  +  QPYG++++MR DGTG+++LT N +E GTPA
Sbjct  541  MAWSPDGEYIVFTSSRMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTPA  599

Query  126  WHPKA  112
            W P A
Sbjct  600  WQPMA  604


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 84/168 (50%), Gaps = 19/168 (11%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  448
            P+ +PDG  IVF S R+G  +L+ ++      DG G++QLT     D   ++S D K +A
Sbjct  61   PAWAPDGGSIVFTSERNGSADLFRVNP-----DGSGLKQLTADPAYDDQATFSSDSKQLA  115

Query  447  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFT  268
            F S R   G A+ +++ +V    TG  R   +G  G             +SPD +W+ F+
Sbjct  116  FVSTRGG-GTANLWTMDLV----TGRARALTSGPGGD--------FRPSWSPDGKWIAFS  162

Query  267  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
            +              + Q   D+Y++R DG+GL+++T +G   G+P W
Sbjct  163  SGRDNPVPFASGRWERLQ-LSDIYVIRPDGSGLKKITKSGNFCGSPKW  209


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = -1

Query  654  KETTGNNAF---PSCSPDGKHIVFRSGRSG-HKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            K+ T + A+    + S D K + F S R G   NL+ +D + G       R LT G   D
Sbjct  93   KQLTADPAYDDQATFSSDSKQLAFVSTRGGGTANLWTMDLVTGR-----ARALTSGPGGD  147

Query  486  TMPSWSPDGKLIAFSSNRHNP--------GNADCFSIYVVRPDGTGLRRIHVAG  349
              PSWSPDGK IAFSS R NP               IYV+RPDG+GL++I  +G
Sbjct  148  FRPSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSG  201



>ref|XP_010097765.1| hypothetical protein L484_023906 [Morus notabilis]
 gb|EXB70720.1| hypothetical protein L484_023906 [Morus notabilis]
Length=744

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 105/197 (53%), Gaps = 29/197 (15%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  472
            NNAFPS SPDGK +VFRS R+G    +KNLYI D+  GE   G + +LT+G W DT   W
Sbjct  502  NNAFPSSSPDGKKLVFRSTRNGGDKKYKNLYITDAEAGEYGNGFLTRLTEGDWTDTHCQW  561

Query  471  SPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  319
            SP+   I FSS R  P +A           F++++V  +    +   V    GS      
Sbjct  562  SPNSDWIVFSSTRDKPKDAPPLDNGLDPGFFAVFLVNVN----KPSVVVRVVGSGNRLAG  617

Query  318  RLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ------  166
             LNH  FSPD   ++ T +L  V++EP+S+P   +  +PYGD++ + +D   ++      
Sbjct  618  HLNHPFFSPDGNSIVVTGDLAAVSSEPISLPLFLHSVRPYGDIFTVDIDPKNIEKNEDVE  677

Query  165  ---RLTWNGYENGTPAW  124
               R+T + YE  T +W
Sbjct  678  KFKRITHSRYEYSTASW  694



>gb|ABJ88479.1| WD40 domain protein beta Propeller [Candidatus Solibacter usitatus 
Ellin6076]
Length=638

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 97/179 (54%), Gaps = 26/179 (15%)
 Frame = -1

Query  642  GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI--RQLTDGAWIDTMPSWS  469
            GNNAFPS SPDGK  V+R+       L I   +N E   G I  RQ       D  P WS
Sbjct  477  GNNAFPSFSPDGKRFVYRTFTEDGYGLRI---MNLETKTGKILTRQY------DNFPLWS  527

Query  468  PDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPD  289
            P G LI FS           + IY ++PDG+ L+R+       +         H+ +SPD
Sbjct  528  PRGDLITFSRQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------HMAWSPD  573

Query  288  SEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  112
             E+++FT++  G   E V+  +  QPYG++++MR DGTG+++LT N +E GTPAW P A
Sbjct  574  GEYIVFTSSRMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTPAWQPMA  631


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 84/168 (50%), Gaps = 19/168 (11%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  448
            P+ +PDG  IVF S R+G  +L+ ++      DG G++QLT     D   ++S D K +A
Sbjct  88   PAWAPDGGSIVFTSERNGSADLFRVNP-----DGSGLKQLTADPAYDDQATFSSDSKQLA  142

Query  447  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFT  268
            F S R   G A+ +++ +V    TG  R   +G  G             +SPD +W+ F+
Sbjct  143  FVSTRGG-GTANLWTMDLV----TGRARALTSGPGGD--------FRPSWSPDGKWIAFS  189

Query  267  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
            +              + Q   D+Y++R DG+GL+++T +G   G+P W
Sbjct  190  SGRDNPVPFASGRWERLQ-LSDIYVIRPDGSGLKKITKSGNFCGSPKW  236


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = -1

Query  654  KETTGNNAF---PSCSPDGKHIVFRSGRSG-HKNLYIIDSLNGELDGGGIRQLTDGAWID  487
            K+ T + A+    + S D K + F S R G   NL+ +D + G       R LT G   D
Sbjct  120  KQLTADPAYDDQATFSSDSKQLAFVSTRGGGTANLWTMDLVTGR-----ARALTSGPGGD  174

Query  486  TMPSWSPDGKLIAFSSNRHNP--------GNADCFSIYVVRPDGTGLRRIHVAG  349
              PSWSPDGK IAFSS R NP               IYV+RPDG+GL++I  +G
Sbjct  175  FRPSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSG  228



>ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38217.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 108/199 (54%), Gaps = 32/199 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G + +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKKYKNLYIMEDAQVGEYGDGKVTRLTNGPWTDTHCQ  542

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  325
            WSP G  I FSS R  P +A           F++++V+  D + + R+   G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKVNDPSVVIRVIKGGDDLAGHV-  601

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  169
                NH  FSPD   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   +     
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSADPISLPLFLHSVRPYGDVFTVDIDPDDINKNKD  657

Query  168  ----QRLTWNGYENGTPAW  124
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>ref|XP_010676033.1| PREDICTED: uncharacterized protein LOC104891943 [Beta vulgaris 
subsp. vulgaris]
Length=751

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 116/217 (53%), Gaps = 36/217 (17%)
 Frame = -1

Query  666  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH------KNLYIIDSLN-GELDGGGIRQL  508
            K LTK+   NNAFPS + +G  +VFRS R  H      KNLYI+ S + GE   G IR+L
Sbjct  478  KKLTKQF--NNAFPSTNGEGTQLVFRSTRDHHENGGIFKNLYIMKSADEGEFGRGEIRRL  535

Query  507  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA-DC--------FSIYVVRPDGTG-LRRIH  358
            T G  IDT   WSP    I FSSNR  P +A  C        FS+Y+V+ D    L R+ 
Sbjct  536  TTGNCIDTHCKWSPRNDWIVFSSNRDMPEDARKCDEDLDSGYFSVYLVKADNPDVLVRVM  595

Query  357  VAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMR  187
             +G++ +  V     NH  FSPD + ++ T+++  V+A+P+S+P   +  +PYGD++ + 
Sbjct  596  YSGSDLAGHV-----NHPFFSPDGKSIVVTSDVAAVSADPMSLPLFLHSARPYGDIFTID  650

Query  186  LDGTGL---------QRLTWNGYENGTPAWHPKAEVD  103
            +D   +          R+T + YEN T  W   +  D
Sbjct  651  IDSDDINKNEDLKMFNRITHSRYENATGTWTKSSTRD  687



>gb|EAZ27259.1| hypothetical protein OsJ_11196 [Oryza sativa Japonica Group]
Length=744

 Score =   114 bits (285),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 104/203 (51%), Gaps = 36/203 (18%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  481
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE     + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTSKVTRLTSGAWTDTH  554

Query  480  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  337
             SWSP      I FSS R  P  A           F++++VR  D T + R+  +    +
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVA  614

Query  336  EEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  178
              V     NH  FSPD   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  615  GHV-----NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  177  -----TGLQRLTWNGYENGTPAW  124
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|NP_001050324.1| Os03g0403400 [Oryza sativa Japonica Group]
 gb|AAP03369.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96486.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12238.1| Os03g0403400 [Oryza sativa Japonica Group]
Length=744

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 104/203 (51%), Gaps = 36/203 (18%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  481
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE     + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTSKVTRLTSGAWTDTH  554

Query  480  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  337
             SWSP      I FSS R  P  A           F++++VR  D T + R+  +    +
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVA  614

Query  336  EEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  178
              V     NH  FSPD   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  615  GHV-----NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  177  -----TGLQRLTWNGYENGTPAW  124
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|XP_004960704.1| PREDICTED: uncharacterized protein LOC101777811 [Setaria italica]
Length=754

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 117/245 (48%), Gaps = 60/245 (24%)
 Frame = -1

Query  675  VEIKVLTK-ETTG-------------NNAFPSCSPDGKHIVFRSGR----------SGHK  568
            VEIK + K E TG             N+AFPS + DG   VFR  R            H 
Sbjct  473  VEIKAIVKNEETGEWNKPNRLTKGEFNHAFPSSNHDGSKFVFRCTRDRTHGQSVRKQNHT  532

Query  567  NLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRH-----NPGNADC-  409
            NLYI+ D+  GE   G + QLTDG W+DT  SWSP G  I FSS+R       PG  D  
Sbjct  533  NLYIMEDAEEGEWGEGTVTQLTDGPWVDTHCSWSPSGDWIVFSSSRDKDPDAQPGTLDAG  592

Query  408  -FSIYVVRP---DGTG------LRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANL  259
             FSIY+V     D T       +R +H      S +     +NH  FS D   ++FT++L
Sbjct  593  YFSIYIVNAAERDPTNKTMPPPVRVVH------SADTFIGHVNHPVFSHDMRSLIFTSDL  646

Query  258  GGVTAEPVSIP---NQFQPYGDLYMMRL----------DGTGLQRLTWNGYENGTPAWHP  118
              V+ EP+S+P   +  +PYGD++ + L          + T   RLT + YE  TPAW  
Sbjct  647  AAVSVEPISMPIFIHSVRPYGDIFSVDLRDDKDIAKNENITEFHRLTHSRYEYSTPAWTK  706

Query  117  KAEVD  103
             A VD
Sbjct  707  FATVD  711



>ref|XP_010676032.1| PREDICTED: uncharacterized protein LOC104891942 [Beta vulgaris 
subsp. vulgaris]
Length=662

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 99/190 (52%), Gaps = 27/190 (14%)
 Frame = -1

Query  612  DGKHIVFRSGRSGH--KNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  442
            DG  +V+RS R G+  KNLYI+ D+  GE  GG I +LT+G W DT   WSP+G  I F+
Sbjct  426  DGTKLVYRSSRDGNNCKNLYIMQDASKGEFMGGEITRLTEGEWTDTHCQWSPNGDWIVFA  485

Query  441  SNRHNPG--------NADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE----RLNHVCF  298
            SNR NP         +   F IY+V+ D        +     S    RE     +NH  F
Sbjct  486  SNRANPTAPKKDDLPDPGYFGIYMVKADNKNAWLKVIDSGFDSTRPGRELFPGHVNHPFF  545

Query  297  SPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLTW  154
            SPD + ++  A+L  V+ EP+S+P   +  +PYGD++ + LD          T  +RLT 
Sbjct  546  SPDGKSIVIAADLAAVSCEPISLPLFAHSVRPYGDIFTVDLDSENFENNANLTKFKRLTH  605

Query  153  NGYENGTPAW  124
            + YEN T  W
Sbjct  606  SRYENSTAVW  615



>gb|EMT14934.1| hypothetical protein F775_30553 [Aegilops tauschii]
Length=723

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 103/200 (52%), Gaps = 33/200 (17%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  478
            NNAFPS +  G   VFRS R G     HKNLYI+ D+  GE   G + +LT+G W DT  
Sbjct  478  NNAFPSSNAQGDKFVFRSTRDGGKEKFHKNLYIMEDAEEGEFGQGTVTRLTNGPWTDTHC  537

Query  477  SWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  325
            SWSP G  + FSS R  P         +A  F++Y+V+  D T + R+  + A  +  V 
Sbjct  538  SWSPKGDWVVFSSTREMPASAPEMAFLDAGYFAVYLVKVSDPTVVVRVVQSSATLAGHV-  596

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  172
                NH  FSPD   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  597  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDITKNK  652

Query  171  ----LQRLTWNGYENGTPAW  124
                  R+T + YE  TP W
Sbjct  653  DIQEFHRITHSRYEYSTPTW  672



>ref|XP_002437598.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
 gb|EER88965.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
Length=769

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 106/218 (49%), Gaps = 39/218 (18%)
 Frame = -1

Query  666  KVLTKETTG--NNAFPSCSPDGKHIVFRSGRSG---------HKNLYII-DSLNGELDGG  523
            + L K T G  NNAFPS +P G  IVFRS +            KNLYI+ D++ GE    
Sbjct  501  RQLRKLTAGGFNNAFPSSNPAGTKIVFRSTKDAPPPPPGGFRQKNLYIMEDAMEGE--SA  558

Query  522  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG-TG  373
            G+ +LTDG W DT   WSP G  I FSS+RH P  A           F +Y+V P     
Sbjct  559  GVTRLTDGDWTDTHCQWSPSGDWIVFSSSRHKPDGAPKTDNFLDPGYFGVYLVNPASPKA  618

Query  372  LRRIHVAGAEGSEEVNRERLNHV---CFSPDSEWVLFTANLGGVTAEPVSIP---NQFQP  211
            + R+  +        N   L HV    FSPD   ++ TA+L  V+ EP+S+P   +  +P
Sbjct  619  VVRVMTSALPPPVPTNVAGLGHVNHPMFSPDGRSIVVTADLAAVSVEPISMPMFLHSVRP  678

Query  210  YGDLYMMRLDGTGL---------QRLTWNGYENGTPAW  124
            YGD++   +D   +          R+T + YE  TP W
Sbjct  679  YGDIFSFDIDPVDMDKNKDIQKFHRVTHSRYEYATPVW  716



>gb|EMS49561.1| hypothetical protein TRIUR3_11240 [Triticum urartu]
Length=568

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 103/200 (52%), Gaps = 33/200 (17%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  478
            NNAFPS +  G   VFRS R G     HKNLYI+ D+  GE   G + +LT+G W DT  
Sbjct  323  NNAFPSSNAQGDKFVFRSTRDGGKEKFHKNLYIMEDAEEGEFGQGTVTRLTNGPWTDTHC  382

Query  477  SWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  325
            SWSP G  + FSS R  P         +A  F++Y+V+  + T + R+  + A  +  V 
Sbjct  383  SWSPKGDWVVFSSTREMPASAPEMAFLDAGYFAVYLVKVSNPTVVVRVVQSSATLAGHV-  441

Query  324  RERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  172
                NH  FSPD   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  442  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDITKNK  497

Query  171  ----LQRLTWNGYENGTPAW  124
                  R+T + YE  TP W
Sbjct  498  DIQEFHRITHSRYEYSTPTW  517



>ref|XP_010675837.1| PREDICTED: uncharacterized protein LOC104891780 [Beta vulgaris 
subsp. vulgaris]
Length=722

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 111/205 (54%), Gaps = 30/205 (15%)
 Frame = -1

Query  660  LTKETTG-NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGG-IRQLTDG  499
            L + T G NNAFP  +PDG  +VFRS R G    +KNLYII+ L    +G G I +LT+G
Sbjct  473  LKRLTNGFNNAFPCTNPDGTKLVFRSTRDGGEKKYKNLYIIEDLQSMENGEGEITRLTNG  532

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPG-------NADCFSIYVVRPDGTGLRRIHVAGAEG  340
             W+DT   WSP G+ I F+SNR+          +   F++Y+V+ D   +  + V G+  
Sbjct  533  PWVDTHCDWSPSGEWIVFASNRNRTTEGMDHGLDTGYFAVYLVKADDPDV-WVKVIGSRS  591

Query  339  SEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQF----QPYGDLYMMRLDGTG  172
             +      +NH  FSPD   +   ++L  V+ +P+S+P QF    +PYG+L+++ +D   
Sbjct  592  GDLAG--HVNHPFFSPDGRSLSVVSDLAAVSCDPISLP-QFIHSARPYGELFILDIDHDD  648

Query  171  L---------QRLTWNGYENGTPAW  124
            +         +R+T   YEN T  W
Sbjct  649  IYANEDVEDYRRITHTRYENSTAVW  673



>dbj|BAK07068.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=733

 Score =   110 bits (276),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 103/199 (52%), Gaps = 32/199 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS +PDG   VFRS R G    HKNLYI+ D+  GE   G +R+LT+G W DT  S
Sbjct  510  NNAFPSSNPDGTKFVFRSTRDGGAELHKNLYIMEDAEVGEFSEGTVRRLTNGPWTDTHCS  569

Query  474  WSPDGKLIAFSSNRHNPGNA--------DCFSIYVVRP-DGTGLRRIHVAGAEGSEEVNR  322
            WSP    I FSS+R     A          F++++V   D T + R+     + S+ V  
Sbjct  570  WSPKNDWIVFSSSRDKAAGAPKRDILDPGSFAVFMVMASDPTVVVRV----MKSSDSVA-  624

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG-------  172
              + H  FSPD   ++  A+L  V+ EP+S+P   +  +PYGD++ + L  T        
Sbjct  625  GHVTHPMFSPDMRSIVVAADLAAVSTEPISMPQFLHSVRPYGDIFSVDLRDTDDMSKNKD  684

Query  171  ---LQRLTWNGYENGTPAW  124
                 R+T + YE  TP W
Sbjct  685  IKEFHRITHSRYEYATPEW  703



>ref|XP_010675830.1| PREDICTED: uncharacterized protein LOC104891773 [Beta vulgaris 
subsp. vulgaris]
Length=886

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 108/202 (53%), Gaps = 22/202 (11%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPSWSPD  463
            N+AFPS +PDG  +V+RS + G KNLYI+++   GE +   + +LT G W DT   WSP 
Sbjct  658  NSAFPSSNPDGTRLVYRSTKHGPKNLYIMENAELGEFEEAKVTRLTKGNWTDTHCQWSPT  717

Query  462  GKLIAFSSNRHNPG--------NADCFSIYVVRPDGTGLR-RIHVAGAEGSEEVNRERLN  310
               I FSSNR  P         +A  F +Y+V  +   +  ++  +G      +    +N
Sbjct  718  QDWIVFSSNRSYPTAKTFEDLPDAGYFGVYLVNANNEDVVIKVIDSGYTYLGGLFPGHVN  777

Query  309  HVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------Q  166
            H  FSPD + ++ TA+L  V+ +PVS+P   +  +PYGD++++ +DG  +          
Sbjct  778  HPFFSPDGKSLVVTADLAAVSCDPVSMPLFLHSVRPYGDIFVVDIDGDDIYKNENLKKFT  837

Query  165  RLTWNGYENGTPAWHPKAEVDL  100
            R+T + YEN T  W   +  DL
Sbjct  838  RVTHSRYENSTGTWTEASTKDL  859



>gb|EMT29283.1| hypothetical protein F775_17496 [Aegilops tauschii]
Length=869

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 97/179 (54%), Gaps = 25/179 (14%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYI-IDSLNGELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS SPDG   VFRS R G    +KNL+I +++ NG+   G   +LT G W DT   
Sbjct  524  NNAFPSSSPDGSKFVFRSTRDGGVKKYKNLHIMLEAENGQSGIGWETRLTKGPWTDTHCQ  583

Query  474  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG--TGLRRIHVAGAEGSEEV  328
            WSP G  + FSS R  P +AD          FS+Y+V+P      +R +   G  G    
Sbjct  584  WSPTGDWVVFSSTRGKPRDADELDNGLDPGYFSVYLVKPSDPMVVIRVMDSMGDLGGH--  641

Query  327  NRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQRL  160
                +NH  FSPD   +  TA+L  V+ +P+S+P   +  +PYGD++M+ LD   L+ +
Sbjct  642  ----INHPVFSPDGRSIAVTADLAAVSVDPISLPMFMHAVRPYGDIFMIDLDTDNLKNI  696



>gb|EMT19136.1| hypothetical protein F775_12749 [Aegilops tauschii]
Length=669

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 104/213 (49%), Gaps = 44/213 (21%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRS-------GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  481
            N AFPS +P+G  +VFRS       G+   KNL+IID+  GE    G+ QLT+G W DT 
Sbjct  417  NCAFPSTNPEGTKLVFRSSRDRVQGGKREDKNLFIIDAEKGEY--AGVDQLTNGPWTDTH  474

Query  480  PSWSPDGKL--IAFSSNRHNPGNADC---------FSIYVVRPDGTG-----LRRIHVAG  349
             SWSP      I FSS+R  PG A           FS+Y+V           +R IH A 
Sbjct  475  CSWSPREGCDWIVFSSSRGKPGGAPASDHGLDSGYFSVYLVNAKDMAEGVVPVRVIHSAP  534

Query  348  AEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL--  184
                       +NH  FSPD   ++FTA+L  V+ +P+S+P   +  +PYGD++ + L  
Sbjct  535  TIAGH------VNHPVFSPDMMSIVFTADLAAVSVDPISMPHFMHSVRPYGDIFSVELLD  588

Query  183  --------DGTGLQRLTWNGYENGTPAWHPKAE  109
                    D     R+T + YE  TP W P  +
Sbjct  589  REDMAKNKDIHKYHRITHSRYEYSTPTWSPHTD  621



>ref|XP_010105408.1| hypothetical protein L484_008562 [Morus notabilis]
 gb|EXC04631.1| hypothetical protein L484_008562 [Morus notabilis]
Length=424

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 111/207 (54%), Gaps = 30/207 (14%)
 Frame = -1

Query  645  TGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTM  481
              NNAFPS +P G  +VFRS R+G    +KNLYI+++   GE   G I +LT+GAW DT 
Sbjct  181  VSNNAFPSTNPAGTKLVFRSTRNGGDKKYKNLYIMENAELGEYGDGIITRLTNGAWTDTH  240

Query  480  PSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEV  328
              WSP G  I FSS R  P +A           F++++V+ +   +    V    GS+  
Sbjct  241  CQWSPRGDWIVFSSTRDKPDDAPESDNGLDPGYFAVFLVKANDPSV----VVRVLGSDSD  296

Query  327  NRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---------  184
                +NH  FSPD + ++ TA+L  V+ +P+S+P   +  +PYGD++++ +         
Sbjct  297  LAGHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVRPYGDIFIIDIDPDDINKNK  356

Query  183  DGTGLQRLTWNGYENGTPAWHPKAEVD  103
            D     R+T + YEN T +W P +  D
Sbjct  357  DVEKFNRITHSRYENSTASWTPFSTQD  383



>ref|XP_004980674.1| PREDICTED: uncharacterized protein LOC101756594 [Setaria italica]
Length=1083

 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 110/212 (52%), Gaps = 32/212 (15%)
 Frame = -1

Query  663   VLTKETTGN--NAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLT  505
             V  + T G+  NA+PS +P+G  +VF+S R      +KNLYI+ D+  GE   G + +LT
Sbjct  853   VFIQLTKGDFFNAYPSTNPEGTKVVFQSTRDHGDYEYKNLYIMEDAQIGEFGEGSVTRLT  912

Query  504   DGAWIDTMPSWSPDGKLIAFSSNRHNPGNA---------DCFSIYVVR-PDGTGLRRIHV  355
             +G WIDT   WSP G  I FSS R  P  A           F+IY+V   D T + R+  
Sbjct  913   NGPWIDTQCQWSPRGNWIVFSSTRDKPAAAPENYNELDPGHFAIYLVNAADPTVVVRVVT  972

Query  354   AGAEGSEEVNRE-RLNHVCFSPDSEWVLFTANLGGVTAEPVSIP-----NQFQPYGDLYM  193
             +G  G    +    +NH  FSPD   + FT+++  V+AEP+S+P        +PYGD++ 
Sbjct  973   SGDPGPGASSIAGHVNHPVFSPDGRSIAFTSDIAAVSAEPISMPMASVMASVRPYGDIFS  1032

Query  192   MRLDGTGL---------QRLTWNGYENGTPAW  124
             + +D   +          R+T + YE  T AW
Sbjct  1033  VDIDPDDICRNKDIDRVHRVTHSRYEYSTNAW  1064



>ref|XP_010235117.1| PREDICTED: uncharacterized protein LOC100846313 [Brachypodium 
distachyon]
Length=751

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 106/219 (48%), Gaps = 43/219 (20%)
 Frame = -1

Query  666  KVLTKETTGNNAFPSCSPDGKHIVFRSGRS------GHKNLYII-DSLNGEL-DGGGIRQ  511
            ++LTK    NNAFPS SPDG   VFRS R        HKNLYI+ D   GE  +GG + +
Sbjct  488  RLLTKGKF-NNAFPSSSPDGTRFVFRSTRDHAKSERKHKNLYIMEDQEVGEYGEGGKVTR  546

Query  510  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIH  358
            LTDG W DT   WSP G  I FSS R  P  A           F++++V+     +    
Sbjct  547  LTDGEWTDTHCQWSPSGDWIVFSSTRDKPPTAAPLDHGLDPGYFAVFMVKASDPAV----  602

Query  357  VAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMR  187
            V    GS +     +NH  FSP+   +  T++L  V+A+P+S+P   +  +PYGD++ + 
Sbjct  603  VIRVVGSGDDLSGHVNHPVFSPNGRSIAVTSDLAAVSADPISLPLFLHSVRPYGDIFAVD  662

Query  186  LDGT------------------GLQRLTWNGYENGTPAW  124
            +D                       R+T + YE  TP W
Sbjct  663  IDDILRLGDDAEKLKKIKDLRRKFHRITHSRYEYSTPEW  701



>ref|XP_010087211.1| hypothetical protein L484_006140 [Morus notabilis]
 gb|EXB28518.1| hypothetical protein L484_006140 [Morus notabilis]
Length=726

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 111/197 (56%), Gaps = 30/197 (15%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGR--SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWS  469
            N+AFPS + +G  +V+RS R    +KNLYI+ D+  GE   G I +LT+G+W DT   WS
Sbjct  487  NSAFPSTNREGTKLVYRSTRGDKRYKNLYIMEDAQVGEYGHGKITRLTNGSWTDTHCQWS  546

Query  468  PDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRE  319
            P G  I FSS R  P +A           F+IY+V+  D + + R+  +G++ +  V   
Sbjct  547  PTGDWIVFSSTRDKPEDAPKSDNGLDPGYFAIYLVKVNDPSVVVRVTGSGSDLTGHV---  603

Query  318  RLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-------  169
              NH  FSPD + ++ T++L GV+ +P+S+P   +  +PYGD++ + +D   +       
Sbjct  604  --NHPFFSPDRKSIVVTSDLAGVSVDPISLPLFLHSVRPYGDIFTIDIDPDDINKNWDVK  661

Query  168  --QRLTWNGYENGTPAW  124
               R+T + YEN T +W
Sbjct  662  EFNRITHSRYENATGSW  678



>ref|XP_003575792.1| PREDICTED: uncharacterized protein LOC100821131 [Brachypodium 
distachyon]
Length=730

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 111/215 (52%), Gaps = 43/215 (20%)
 Frame = -1

Query  666  KVLTKETTG-NNAFPSCSPDGKHIVFRSG--RSG----HKNLYII-DSLNGELDGGGIRQ  511
            K LT +T   NNAFPS + +G  +VFRS   RSG     KNLYI+ D+  G+   G + Q
Sbjct  492  KQLTDDTKKYNNAFPSSNKEGDKLVFRSSCDRSGGDNKFKNLYIMEDATEGDSSAGKVTQ  551

Query  510  LTDGAWIDTMPSWSPDGKLIAFSSNRHN--PG------NADCFSIYVV--RPDGTGLRRI  361
            LT G W DT   WSP    I FSS+R    PG      +A CFSI++V  +     +R +
Sbjct  552  LTKGDWTDTHCCWSPTDDWIVFSSSRDRAPPGTDPAILDAGCFSIFMVNYKDPSVVVRVM  611

Query  360  HVAGAEGSEEVNRERLNHVC---FSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDL  199
            H          +     HVC   FSPD + ++ T+++  V+A+P S+P   +  +PYGD+
Sbjct  612  H---------SDMSLAGHVCHPVFSPDRKSIVVTSDVAAVSADPASLPIFIHSVRPYGDI  662

Query  198  YMMRL----------DGTGLQRLTWNGYENGTPAW  124
            + ++L          D     R+T + YEN TP W
Sbjct  663  FTIKLRDPDCLEKNGDIVEFDRITHSRYENSTPTW  697



>gb|EMS54560.1| hypothetical protein TRIUR3_19354 [Triticum urartu]
Length=136

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = -1

Query  396  VVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQF  217
            +V P+GTGLRR+ V  A+G       R NH  FSPDS+ ++FT++L  V+AEP+S P+ +
Sbjct  1    MVHPNGTGLRRV-VHSADGG------RTNHPWFSPDSKSMVFTSDLAAVSAEPISNPHHY  53

Query  216  QPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            QPYG+++ + +DG+GLQRLT N +E+GTP+W P 
Sbjct  54   QPYGEIFTINIDGSGLQRLTHNSFEDGTPSWTPH  87



>ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838501 [Brachypodium 
distachyon]
Length=752

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 102/214 (48%), Gaps = 47/214 (22%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGG----GIRQLTDGAW  493
            NNAFPS SPDG   VFRS R        HKNLYI+ D   GE         + +LTDG W
Sbjct  494  NNAFPSSSPDGTRFVFRSTRDHAKSEKKHKNLYIMEDQEFGEYGYDTVVPKVTRLTDGEW  553

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAE  343
             DT   WSP G  I FSS R  P  A           F++++V+  D T + R+  +G +
Sbjct  554  TDTHCQWSPSGDWIVFSSTRDKPATAAPTDHGLDPGYFAVFMVKASDPTVVIRVVGSGDD  613

Query  342  GSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--  178
             S  V     NH  FSPD   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D   
Sbjct  614  LSGHV-----NHPVFSPDGRTIAVTADLAAVSADPISLPLFLHSVRPYGDIFAVDIDDIL  668

Query  177  ----------------TGLQRLTWNGYENGTPAW  124
                                R+T + YE  TP W
Sbjct  669  RLGDDVEKLKKIKDLKKKFHRITHSRYEYSTPEW  702



>gb|EJL34752.1| periplasmic component of the Tol biopolymer transport system 
[Caulobacter sp. AP07]
Length=602

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 98/185 (53%), Gaps = 23/185 (12%)
 Frame = -1

Query  669  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKN-LYIIDSLNGELDGGGIRQLTDGAW  493
            +K+LTK  TGN  FP  S DG+HIV+R  ++G  N L ++D     LD G    L  G  
Sbjct  432  LKLLTK-GTGNFGFPDWSGDGRHIVYR--QAGAANALDVVD-----LDSGESHVLLAGPA  483

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
                P+WSP   +IAF+++         + IY +R DG+GL+R+  +    +        
Sbjct  484  HYNFPAWSPTADVIAFTADIDG-----DYEIYSIRADGSGLKRLTRSPGNDA--------  530

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
             H  +SPD +W+ F +  GG   E +  P   QPYG++Y+MR DG+    LT   +E GT
Sbjct  531  -HNAWSPDGKWIAFASARGGFKDEALLHPANPQPYGEIYVMRADGSEAHALTDEPFEKGT  589

Query  132  PAWHP  118
            PAW P
Sbjct  590  PAWAP  594


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 84/173 (49%), Gaps = 27/173 (16%)
 Frame = -1

Query  624  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  445
            S S DG+ ++F S R+G  ++Y        LDG G+ +L      D   + SPDG+ +AF
Sbjct  69   SFSSDGQWVLFTSRRAGTSDIY-----RAHLDGSGLERLVASPAYDDQAALSPDGRSLAF  123

Query  444  SSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSPDSEWVLFT  268
             S+R   G AD   I+++      LR + H    +              +SPD  W+ F+
Sbjct  124  VSSRG--GQAD---IWILDLASKALRNLTHDPAGD----------FRPSWSPDGRWLAFS  168

Query  267  ANLGGVTAEPVSIPN---QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            ++     +E   IP      +   ++Y++++DGT L+R+T +G   G+P W P
Sbjct  169  SDR---VSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDGQFAGSPTWSP  218


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 91/214 (43%), Gaps = 36/214 (17%)
 Frame = -1

Query  624  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  445
            + SPDG+ + F S R G  +++I+D     L    +R LT     D  PSWSPDG+ +AF
Sbjct  113  ALSPDGRSLAFVSSRGGQADIWILD-----LASKALRNLTHDPAGDFRPSWSPDGRWLAF  167

Query  444  SSNR--HNPGNAD-------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSP  292
            SS+R   +P   +          IY+V+ DGT LRR+   G         +      +SP
Sbjct  168  SSDRVSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDG---------QFAGSPTWSP  218

Query  291  D-SEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            D S+   + A L  V    ++   + +    +  + L     Q LT    E  +P W   
Sbjct  219  DGSKLAFYAATLPEV--RNITAARRLRGVTQIEAVDLGTGASQVLTSGAGEKWSPHWLAP  276

Query  114  AEVDL--------ARLSLGKSGEKLRGKFDEPLW  37
              +             + G SG   RG+F+ P W
Sbjct  277  DRIGYVSGGPEGGVEATAGPSGA--RGEFNSPSW  308



>gb|AFB33555.1| hypothetical protein 2_7121_02, partial [Pinus mugo]
Length=152

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = -1

Query  738  RLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLY  559
            R T D   + +   +   E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHKNLY
Sbjct  61   RTTVDIVAIYNADKEGISESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHKNLY  118

Query  558  IIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            I+D+  GE   GG+ QLT+G W DTM SWSPDG+ I
Sbjct  119  IMDAEEGEE--GGLWQLTEGPWTDTMCSWSPDGEWI  152



>ref|XP_010097467.1| hypothetical protein L484_024672 [Morus notabilis]
 gb|EXB68658.1| hypothetical protein L484_024672 [Morus notabilis]
Length=743

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 114/212 (54%), Gaps = 40/212 (19%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDG  499
            L   TTG  NNAF S + +G  +V+RS R+G    +KNLYI+D+ +GE   G + +LT+G
Sbjct  487  LKTLTTGDFNNAFASTNIEGTQLVYRSTRNGGSEKYKNLYIMDAQSGE--DGCLTRLTEG  544

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------------CFSIYVVRPDG-TGLRR  364
             W DT   WSP+G  I FSS+R NP  AD               F++Y+V     + + R
Sbjct  545  KWTDTHCQWSPNGDWIVFSSSRENPYGADQYKKENFDNGLDPGYFAVYLVNTSNPSAVVR  604

Query  363  IHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYM  193
            +  +G + +  V     NH  FSPD + ++ T++L  V+ +P+S+P   +  +PYGD+++
Sbjct  605  VAGSGYDLAGHV-----NHPFFSPDGKSIVVTSDLAAVSVDPISLPLFVHSVRPYGDIFI  659

Query  192  MRLDGTGL---------QRLTWNGYENGTPAW  124
              +D   +         +R T + +E  T +W
Sbjct  660  FDIDTKDIHKNKDLKTFKRATHSRFEYSTVSW  691



>ref|XP_010102640.1| hypothetical protein L484_010932 [Morus notabilis]
 gb|EXB93790.1| hypothetical protein L484_010932 [Morus notabilis]
Length=717

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 108/198 (55%), Gaps = 30/198 (15%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPS  475
            NNAFPS +P G  +VFRS R+G    +KNLYI+++   GE   G I +LT+GAW DT   
Sbjct  476  NNAFPSTNPAGTKLVFRSTRNGGDKKYKNLYIMENAELGEYGDGIITRLTNGAWTDTHCQ  535

Query  474  WSPDGKLIAFSSNRHNPGNA---------DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            WSP G  I FSS R  P +A           F++++V+ +   +    V    GS+    
Sbjct  536  WSPRGDWIVFSSTRDKPDDAPESDNGLDPGYFAVFLVKANDPSV----VVRVLGSDSDLA  591

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---------DG  178
              +NH  FSPD + ++ TA+L  V+ +P+S+P   +  +PYGD++++ +         D 
Sbjct  592  GHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVRPYGDIFIIDIDPDDINKNKDV  651

Query  177  TGLQRLTWNGYENGTPAW  124
                R+T + YEN T +W
Sbjct  652  EKFNRITHSRYENSTASW  669



>gb|AFG49274.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
Length=152

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  747  QIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK  568
            +  R T D   + +   +   E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHK
Sbjct  58   ETERTTVDIVAIYNADKEGISESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHK  115

Query  567  NLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            NLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  116  NLYIMDAEEGEE--GGLWQLTEGPWTDTMCTWSPDGEWI  152



>gb|AEW08359.1| hypothetical protein 2_7121_02, partial [Pinus radiata]
 gb|AFG49263.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49264.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49265.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49266.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49267.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49268.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49269.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49270.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49271.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49272.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49273.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49275.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49276.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49277.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49278.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49279.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49280.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
Length=152

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  747  QIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK  568
            +  R T D   + +   +   E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHK
Sbjct  58   ETERTTVDIVAIYNADKEGISESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHK  115

Query  567  NLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            NLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  116  NLYIMDAEEGEE--GGLWQLTEGPWTDTMCTWSPDGEWI  152



>ref|XP_010097483.1| hypothetical protein L484_024689 [Morus notabilis]
 gb|EXB68674.1| hypothetical protein L484_024689 [Morus notabilis]
Length=740

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 112/211 (53%), Gaps = 39/211 (18%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDG  499
            L   TTG  NNAF S + +G  +V+RS R+G    +KNLYI+D+ +GE   G + +LT+G
Sbjct  486  LKTLTTGDFNNAFASTNIEGTQLVYRSTRNGGSEKYKNLYIMDAQSGE--DGCLTRLTEG  543

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------------CFSIYVVRPDG-TGLRR  364
             W DT   WSP+G  I FSS+R NP  AD               F++Y+V     + + R
Sbjct  544  KWTDTHCQWSPNGDWIVFSSSRENPYGADQYKKENFDNGLDPGYFAVYLVNTSNPSAVVR  603

Query  363  IHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYM  193
            +  +G + +  V     NH  FSPD + ++ T++L  V+ +P S+P   +  +PYGD+++
Sbjct  604  VAGSGYDLAGHV-----NHPFFSPDGKSIVVTSDLAAVSVDPTSLPLFVHSVRPYGDVFI  658

Query  192  MRLDGTGL--------QRLTWNGYENGTPAW  124
               D   +        +R T + +E  T +W
Sbjct  659  FDFDCNDMNQEDLKTFKRATHSRFEYSTVSW  689



>gb|EMT06488.1| hypothetical protein F775_06751 [Aegilops tauschii]
Length=739

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 105/207 (51%), Gaps = 44/207 (21%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRS--------GHKNLYII-DSLNGELDGGGIRQLTDGAWID  487
            NNAFPS + DG  +VFRS R+         +KNLYI+ D+  GE   G + QLTDG W D
Sbjct  515  NNAFPSSNKDGTKLVFRSTRNRMGKPEDVKYKNLYIMEDADEGEWGSGTVTQLTDGPWTD  574

Query  486  TMPSWSPDGKLIAFSSNRHN-PG-------NADCFSIYVVRPDGTG--LRRIHVAGAEGS  337
            +  +WSP    I FSS+R   PG       +A  FSI++V        +R +H A +   
Sbjct  575  SHCTWSPTDDWIVFSSSRDRAPGAPDRDILDAGFFSIFLVLATDPSVLVRVMHSADSLA-  633

Query  336  EEVNRERLNHVC---FSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---  184
                     HVC   FSP  + ++ T+++ GV+A+PVS+P   +  +PYGD++ + L   
Sbjct  634  --------GHVCHPVFSPFKDSIVVTSDIAGVSADPVSLPIFIHSVRPYGDIFTINLRDK  685

Query  183  -------DGTGLQRLTWNGYENGTPAW  124
                   D     R+T   YE  TP W
Sbjct  686  NDIMKNKDIMEFDRITHTRYEYSTPTW  712



>gb|AFB33549.1| hypothetical protein 2_7121_02, partial [Abies alba]
Length=150

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
            +  K LTKE  GNNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G 
Sbjct  80   ISYKTLTKE--GNNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLTEGP  135

Query  495  WIDTMPSWSPDGKLI  451
            W DTM +WSPDG+ I
Sbjct  136  WTDTMCNWSPDGEWI  150



>gb|AEW08360.1| hypothetical protein 2_7121_02, partial [Pinus lambertiana]
 gb|AFB33551.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
 gb|AFB33552.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
Length=152

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  747  QIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK  568
            +  R T D   + +   +   E  +  K+LTK+   NNAFPS SPDGK +VFRSGR+GHK
Sbjct  58   ETERTTVDIVAIYNADKEGISESEISYKILTKKD--NNAFPSPSPDGKFVVFRSGRTGHK  115

Query  567  NLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            NLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  116  NLYIMDAEEGEE--GGLWQLTEGPWTDTMCNWSPDGEWI  152



>ref|XP_006658881.1| PREDICTED: uncharacterized protein LOC102705738, partial [Oryza 
brachyantha]
Length=502

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 68/94 (72%), Gaps = 8/94 (9%)
 Frame = -1

Query  759  KATVQIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGR  580
            KATV+IARL FD   L  D D    E+   +KVLT+  +GN+AFP+ SP GK IVFRSGR
Sbjct  414  KATVRIARLEFDAGELAPDRD----EVAATLKVLTRPESGNDAFPAVSPCGKWIVFRSGR  469

Query  579  SGHKNLYIIDSLNGELDGGG---IRQLTDGAWID  487
            SGHKNLYI+D+ +GE DG G   IR+LTDG WID
Sbjct  470  SGHKNLYIVDAAHGE-DGAGEGTIRRLTDGEWID  502



>gb|AFB33553.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
 gb|AFB33554.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
Length=152

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  747  QIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK  568
            +  R T D   + +   +   E  +  K+LTK+   NNAFPS SPDGK +VFRSGR+GHK
Sbjct  58   ETERTTVDIVAIYNADKEGISESEISYKILTKKD--NNAFPSPSPDGKFVVFRSGRNGHK  115

Query  567  NLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            NLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  116  NLYIMDAEEGEE--GGLWQLTEGPWTDTMCNWSPDGEWI  152



>emb|CDM86908.1| unnamed protein product [Triticum aestivum]
Length=731

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 101/199 (51%), Gaps = 38/199 (19%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGR--------SGHKNLYII-DSLNGELDGGGIRQLTDGAWID  487
            N+AFPS +P G   VFRS R        + + NLYI+ D+  GE   G + QLTDG W D
Sbjct  494  NDAFPSSNPAGTKFVFRSTRNRSGRPEDAKYNNLYIMEDAEEGEWGEGTVTQLTDGPWTD  553

Query  486  TMPSWSPDGKLIAFSSNRHNP--GNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            +  SWSP G  I FSS+R      +A CFSI++V      +  + V    G         
Sbjct  554  SHCSWSPRGDWIVFSSSRDRDILDSAGCFSIFLVLATDRKV-LVRVMSLPG---------  603

Query  312  NHVC---FSPDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG-------  172
             HVC   FSPD + ++ T+++  V+A+PVS+P      +PYGD++ ++L  T        
Sbjct  604  -HVCHPIFSPDMDNLVVTSDVAVVSADPVSLPIFIASGRPYGDMFSIKLRDTTDINKNKD  662

Query  171  ---LQRLTWNGYENGTPAW  124
                 R+T   YE   P+W
Sbjct  663  IMEFHRITHTRYEYSKPSW  681



>ref|WP_035092853.1| hypothetical protein [Caulobacter henricii]
Length=625

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 89/174 (51%), Gaps = 21/174 (12%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            ++ FPS S DGK IVFR      K L +I+     LD   IR LT G   D +P WSPDG
Sbjct  471  HSGFPSYSADGKEIVFRVWGEAEKGLRVIN-----LDTRQIRVLTTG--YDNLPFWSPDG  523

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            K I F+       +A  F IY +RPDG+ L+R+           NR    H  +S D + 
Sbjct  524  KRIVFTRKV----DAVNFDIYTIRPDGSDLQRL---------TTNRGNDGHAVWSADGK-  569

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            +LF+  + G   E     N FQPYG + +M  DGTG + +T + +E+  P + P
Sbjct  570  ILFSTGMYGFREEAALYDNTFQPYGQIMVMSADGTGKRLVTDSLWEDSMPLYLP  623


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 21/105 (20%)
 Frame = -1

Query  621  CSPDGKHIVFRSGRSGHK-NLYIIDSLNGELD----GGGIR---QLTDGAWIDTMPSWSP  466
             SPDG  + F S R G++ N+++ D   G L     G G++    L DG +    P+WSP
Sbjct  122  LSPDGARLAFVSTRDGYRTNIWLKDLKTGRLTNLTGGEGVQGDPSLPDGFF---RPAWSP  178

Query  465  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  361
            DGK +AFSS+R      H+ G    +    SIYV+  DG G RR+
Sbjct  179  DGKWLAFSSDRNTDWRGHHDGKGWEHTQELSIYVIGVDGKGFRRV  223


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 85/202 (42%), Gaps = 35/202 (17%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            E K+L +     +A  S S DGK +VF S R+G       D     LDG  I+ L  GA 
Sbjct  61   ERKLLGRSVFDYHA--SFSADGKSVVFTSERNGDGQ---SDLFRCSLDGTNIQPLIVGAA  115

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG--SEEVNRE  319
            +D     SPDG  +AF S R      D +   +   D    R  ++ G EG   +    +
Sbjct  116  VDDAGELSPDGARLAFVSTR------DGYRTNIWLKDLKTGRLTNLTGGEGVQGDPSLPD  169

Query  318  RLNHVCFSPDSEWVLFTANL-----------GGVTAEPVSIPNQFQPYGDLYMMRLDGTG  172
                  +SPD +W+ F+++            G    + +SI          Y++ +DG G
Sbjct  170  GFFRPAWSPDGKWLAFSSDRNTDWRGHHDGKGWEHTQELSI----------YVIGVDGKG  219

Query  171  LQRLTWN-GYENGTPAWHPKAE  109
             +R+    G+  G+P W P  +
Sbjct  220  FRRVASKPGFCLGSPKWSPDGK  241



>gb|AFB33550.1| hypothetical protein 2_7121_02, partial [Larix decidua]
Length=152

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  747  QIARLTFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK  568
            +  + T D   + +   +   E  +  K LTK    NNAFPS SPDGK +VFRSGR+GHK
Sbjct  58   ETEKTTVDIVAIYNADSEGISESEISYKTLTK--VDNNAFPSPSPDGKFVVFRSGRTGHK  115

Query  567  NLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            NLYI+D+  GE   GG+ QLT+G W DTM +WSPDG+ I
Sbjct  116  NLYIMDAEEGEE--GGLWQLTEGPWTDTMCNWSPDGEWI  152



>ref|WP_006298539.1| hypothetical protein [Hylemonella gracilis]
 gb|EGI76207.1| hypothetical protein HGR_12282 [Hylemonella gracilis ATCC 19624]
Length=638

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 93/185 (50%), Gaps = 12/185 (6%)
 Frame = -1

Query  669  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
            ++ LT ++  N  FPS S DGK +VFR      K+  +       L+   IR++T G   
Sbjct  461  LEQLTDDSIFNAGFPSYSADGKEVVFRIANEDPKSASLGGLAVLNLETRQIRRITAG--Y  518

Query  489  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ L+R+    A           
Sbjct  519  DNMPIWSPDGSRILFNRGVRNPNSIWSNFDLYTVRPDGSDLQRLTSHPASD---------  569

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
             H  ++PD + +L+ + + G   E       FQPYG L++M  DG   +++T + +E+ T
Sbjct  570  GHPVWTPDGKQILYNSGMAGYRDEACHYDQTFQPYGQLFVMDADGRNKRQITDSIWEDST  629

Query  132  PAWHP  118
            P + P
Sbjct  630  PQYVP  634


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 74/157 (47%), Gaps = 32/157 (20%)
 Frame = -1

Query  618  SPDGKHIVFRSGRSGH-KNLYIIDSLNGELDGGGIRQLT--DGAWIDTM---------PS  475
            SPDG  + F S R G   N++++D     L    +R LT   G   D +         PS
Sbjct  118  SPDGSKVAFVSTRDGFLANIWVLD-----LQTRKLRNLTGIKGVQADDLQNSPSGFFRPS  172

Query  474  WSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI-----HVAGAEG  340
            WSPDG+ +AFSS+R      H+ G    +    SIYV+R DGTGLRR+     H  G+  
Sbjct  173  WSPDGQWLAFSSDRNTEWKGHHDGAGWEHTQELSIYVIRVDGTGLRRVASRKDHCLGSPR  232

Query  339  SEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSI  229
                 +  + +   +  + WVL    L  + ++ VS+
Sbjct  233  WSGDGKRIVFYETLAEYTYWVLRPDLLLKIDSQIVSV  269


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 83/183 (45%), Gaps = 35/183 (19%)
 Frame = -1

Query  624  SCSPDGKHIVFRSGRSG--HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            S S DG+ IVF S R G  + NLY         DG  + +LTD   +D    +SPDG  +
Sbjct  70   SFSSDGQWIVFTSERDGLGNSNLY-----RARADGTQVERLTDSPAVDDAAVFSPDGSKV  124

Query  450  AFSSNRHNPGNADCFSIYVVRPDGTGLRRIH-VAGAEGSEEVNRER-LNHVCFSPDSEWV  277
            AF S R    +    +I+V+      LR +  + G +  +  N         +SPD +W+
Sbjct  125  AFVSTR----DGFLANIWVLDLQTRKLRNLTGIKGVQADDLQNSPSGFFRPSWSPDGQWL  180

Query  276  LFTAN-----------LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL-TWNGYENGT  133
             F+++            G    + +SI          Y++R+DGTGL+R+ +   +  G+
Sbjct  181  AFSSDRNTEWKGHHDGAGWEHTQELSI----------YVIRVDGTGLRRVASRKDHCLGS  230

Query  132  PAW  124
            P W
Sbjct  231  PRW  233



>ref|WP_020604165.1| hypothetical protein [Spirosoma spitsbergense]
Length=612

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 96/176 (55%), Gaps = 20/176 (11%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            N+ FPS SPDG+ IV+R        L I++ LN +L    ++ LT     D +P WSPDG
Sbjct  454  NSGFPSWSPDGQRIVYRVWGEKDSGLRILN-LNDKL----VQVLTTE--YDNLPFWSPDG  506

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
             LI+F+  +H+  N   F I+ +RPDGT LR++    A  +         H  ++ DS+ 
Sbjct  507  SLISFT-RKHDDNN---FDIFTIRPDGTNLRQLTTTPANDA---------HAYWTADSKH  553

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  112
            +++++ + G   E     N FQPYG ++ M  DG+  ++LT + +E+  P   PKA
Sbjct  554  LMWSSGIYGFKDEAALYDNTFQPYGAIFSMNADGSDKRQLTDSAWEDSMPVVVPKA  609


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 88/196 (45%), Gaps = 24/196 (12%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            E K+L   T+G +   S S +G+ IVF S R+G   L   D      DG  + +LTD   
Sbjct  57   ERKLLA--TSGLDYHASYSGNGQWIVFTSERNG---LGQADIYRVHPDGTALERLTDSPA  111

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            +D   + SPDG  + F S R         +I+++      + ++    A   +       
Sbjct  112  LDDQAALSPDGSKVTFVSTRE----MHTANIWLLDIKSKKVTKLTALPAIQGDSTKPNGF  167

Query  312  NHVCFSPDSEWVLFTAN-----LG---GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  157
                +SPD +W+ F ++     LG   G   E V      Q  G +Y++  DGTGL++L+
Sbjct  168  FRPSWSPDGKWIAFASDRNTQWLGHGNGAGWEHV------QELG-IYVVHPDGTGLRKLS  220

Query  156  WNGYENGTPAWHPKAE  109
              G  +G+P W P  +
Sbjct  221  QAGICSGSPKWSPDGK  236



>ref|WP_035205184.1| hypothetical protein [Acidovorax sp. CF316]
Length=622

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 91/185 (49%), Gaps = 12/185 (6%)
 Frame = -1

Query  669  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
            ++ LT ++  N  FPS S DGK +VFR       +  +       L+   IR +T G   
Sbjct  445  LEQLTDDSVFNAGFPSYSADGKEVVFRIANQDPSSASLGGLAVLNLETRQIRHITRG--Y  502

Query  489  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ LRR+    A           
Sbjct  503  DNMPIWSPDGSRILFNRGVRNPDSIWSNFDLYTVRPDGSDLRRLTDHPASD---------  553

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
             H  ++ D + +L+ +   G   E       FQPYG +++M  DG+G +++T + +E+ T
Sbjct  554  GHPVWTADGKQILYNSGQAGYRDEACHYDQTFQPYGQVFVMNADGSGKRQITDSIWEDST  613

Query  132  PAWHP  118
            P + P
Sbjct  614  PQYAP  618


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 81/169 (48%), Gaps = 21/169 (12%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH-KNLYIID----SLNGELDGGGIRQ  511
             +++ LT  +   +A  + SPD   + F S R G   N++++D    +L       GI+ 
Sbjct  86   TQVERLTDGSIVEDA-AALSPDASKVAFVSTRDGMLANIWMLDLKIRTLKNLTGVKGIQG  144

Query  510  LTDGAWIDTMPSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  361
              D       PSWSPDG+ +AFSS+R      H+ G    +    SIYV+R DGTG R+I
Sbjct  145  RADSPNGFFRPSWSPDGQWLAFSSDRDTEWKGHHNGAGWEHTQELSIYVIRADGTGFRKI  204

Query  360  HVAG--AEGSEEVNRERLNHVCFSPDSE---WVLFTANLGGVTAEPVSI  229
                   +GS + + +    V +   +E   WVL    L  + ++ VS+
Sbjct  205  SSRKDYCQGSPKWSADGKRIVFYETQAEYTYWVLRPDLLLKIDSQIVSV  253


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 90/198 (45%), Gaps = 37/198 (19%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS--GHKNLYIIDSLNGELDGGGIRQLTDG  499
            E K++   T   NA  S S DG+ IVF S R   G+ NLY         DG  + +LTDG
Sbjct  42   ERKLIDSGTLDYNA--SFSADGQWIVFTSERDGLGNSNLY-----RARTDGTQVERLTDG  94

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH-VAGAEGSEEVNR  322
            + ++   + SPD   +AF S R    +    +I+++      L+ +  V G +G  + + 
Sbjct  95   SIVEDAAALSPDASKVAFVSTR----DGMLANIWMLDLKIRTLKNLTGVKGIQGRAD-SP  149

Query  321  ERLNHVCFSPDSEWVLFTAN-----------LGGVTAEPVSIPNQFQPYGDLYMMRLDGT  175
                   +SPD +W+ F+++            G    + +SI          Y++R DGT
Sbjct  150  NGFFRPSWSPDGQWLAFSSDRDTEWKGHHNGAGWEHTQELSI----------YVIRADGT  199

Query  174  GLQRL-TWNGYENGTPAW  124
            G +++ +   Y  G+P W
Sbjct  200  GFRKISSRKDYCQGSPKW  217



>gb|EJE50504.1| periplasmic component of the Tol biopolymer transport system 
[Acidovorax sp. CF316]
Length=637

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 91/185 (49%), Gaps = 12/185 (6%)
 Frame = -1

Query  669  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
            ++ LT ++  N  FPS S DGK +VFR       +  +       L+   IR +T G   
Sbjct  460  LEQLTDDSVFNAGFPSYSADGKEVVFRIANQDPSSASLGGLAVLNLETRQIRHITRG--Y  517

Query  489  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ LRR+    A           
Sbjct  518  DNMPIWSPDGSRILFNRGVRNPDSIWSNFDLYTVRPDGSDLRRLTDHPASD---------  568

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  133
             H  ++ D + +L+ +   G   E       FQPYG +++M  DG+G +++T + +E+ T
Sbjct  569  GHPVWTADGKQILYNSGQAGYRDEACHYDQTFQPYGQVFVMNADGSGKRQITDSIWEDST  628

Query  132  PAWHP  118
            P + P
Sbjct  629  PQYAP  633


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 81/169 (48%), Gaps = 21/169 (12%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH-KNLYIID----SLNGELDGGGIRQ  511
             +++ LT  +   +A  + SPD   + F S R G   N++++D    +L       GI+ 
Sbjct  101  TQVERLTDGSIVEDA-AALSPDASKVAFVSTRDGMLANIWMLDLKIRTLKNLTGVKGIQG  159

Query  510  LTDGAWIDTMPSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  361
              D       PSWSPDG+ +AFSS+R      H+ G    +    SIYV+R DGTG R+I
Sbjct  160  RADSPNGFFRPSWSPDGQWLAFSSDRDTEWKGHHNGAGWEHTQELSIYVIRADGTGFRKI  219

Query  360  HVAG--AEGSEEVNRERLNHVCFSPDSE---WVLFTANLGGVTAEPVSI  229
                   +GS + + +    V +   +E   WVL    L  + ++ VS+
Sbjct  220  SSRKDYCQGSPKWSADGKRIVFYETQAEYTYWVLRPDLLLKIDSQIVSV  268


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 90/198 (45%), Gaps = 37/198 (19%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS--GHKNLYIIDSLNGELDGGGIRQLTDG  499
            E K++   T   NA  S S DG+ IVF S R   G+ NLY         DG  + +LTDG
Sbjct  57   ERKLIDSGTLDYNA--SFSADGQWIVFTSERDGLGNSNLY-----RARTDGTQVERLTDG  109

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH-VAGAEGSEEVNR  322
            + ++   + SPD   +AF S R    +    +I+++      L+ +  V G +G  + + 
Sbjct  110  SIVEDAAALSPDASKVAFVSTR----DGMLANIWMLDLKIRTLKNLTGVKGIQGRAD-SP  164

Query  321  ERLNHVCFSPDSEWVLFTAN-----------LGGVTAEPVSIPNQFQPYGDLYMMRLDGT  175
                   +SPD +W+ F+++            G    + +SI          Y++R DGT
Sbjct  165  NGFFRPSWSPDGQWLAFSSDRDTEWKGHHNGAGWEHTQELSI----------YVIRADGT  214

Query  174  GLQRL-TWNGYENGTPAW  124
            G +++ +   Y  G+P W
Sbjct  215  GFRKISSRKDYCQGSPKW  232



>ref|NP_001066679.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|ABA97669.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29698.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|EAY82937.1| hypothetical protein OsI_38155 [Oryza sativa Indica Group]
 gb|EAZ20324.1| hypothetical protein OsJ_35933 [Oryza sativa Japonica Group]
Length=777

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 100/219 (46%), Gaps = 58/219 (26%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRS-------GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  481
            N AFPS + +G  +VFRS R+        HKNLYIID+  GE    G+  LTDG W DT 
Sbjct  517  NCAFPSTNAEGTKLVFRSSRNRVAGGERQHKNLYIIDAEKGE--AAGVVPLTDGPWTDTH  574

Query  480  PSWSPDGKL--IAFSSNRH------------------NPGNADCFSIYVVRPDGTG----  373
             SWSP      I FSS                     +PG    F++Y+V          
Sbjct  575  CSWSPREGCDWIVFSSTGRPEKDIVKGKDEPEKDHGLDPG---YFAVYLVNAKDIKKGEV  631

Query  372  ---LRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIP---NQFQP  211
               +R IH A            +NH  FSPD + ++F A+L  V+A+P+S+P   +  +P
Sbjct  632  PVPVRVIHSAPTIAGH------INHPVFSPDMKSIVFAADLAAVSADPISMPHFTHSVRP  685

Query  210  YGDLYMMRLDGTG----------LQRLTWNGYENGTPAW  124
            YGD++ + L  T             R+T + YE  TP W
Sbjct  686  YGDIFSVNLRDTTDMAKNRDIQEFHRITHSRYEYSTPTW  724



>gb|KFY81759.1| hypothetical protein V500_11119 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=665

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 89/175 (51%), Gaps = 22/175 (13%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            N+ FPS SPDG  +V+R  G  G   L I++     L       LTD  W D  P WSPD
Sbjct  500  NSGFPSFSPDGTQLVYRDFGPDGGLGLRILN-----LTDKTTTNLTDD-W-DNNPGWSPD  552

Query  462  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            G+LI F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  553  GELIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA---------HAAWS  603

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
             D   +++T+ + G   E V+  N FQPYG + +M  DG+    LT + +E+  P
Sbjct  604  ADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWEDSMP  657



>gb|KFZ03462.1| hypothetical protein V502_10931 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=666

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 93/184 (51%), Gaps = 24/184 (13%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
            LT  T G  N+ FPS SPDG  +V+R  G  G   L I++     L       LTD  W 
Sbjct  491  LTFGTAGEVNSGFPSFSPDGTQLVYRDFGPDGGLGLRILN-----LTDKTTTNLTDD-W-  543

Query  489  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            D  P WSPDG+LI F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGELIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA-----  598

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  142
                H  +S D   +++T+ + G   E V+  N FQPYG + +M  DG+    LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWE  653

Query  141  NGTP  130
            +  P
Sbjct  654  DSMP  657



>gb|KFY12538.1| hypothetical protein V491_06750 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=665

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 93/184 (51%), Gaps = 24/184 (13%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
            LT  T G  N+ FPS SPDG  +V+R  G  G   L I++     L       LT   W 
Sbjct  491  LTFGTAGEVNSGFPSFSPDGTQLVYREFGPDGPLGLRIMN-----LADKTTTNLT-ADW-  543

Query  489  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            D  PSWSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPSWSPDGKRIVFTRRNHINWDDIGATDSFDIYTIAPDGTGLAQLTTSGANDA-----  598

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  142
                H  +S D   +++T+ + G   E V+  N FQPYG + +M  DG+  + LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFREESVNYDNTFQPYGQIVIMDADGSNKRMLTDSMWE  653

Query  141  NGTP  130
            +  P
Sbjct  654  DSMP  657



>ref|WP_029915040.1| hypothetical protein [Caulobacter sp. UNC358MFTsu5.1]
Length=618

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 89/174 (51%), Gaps = 21/174 (12%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            ++ FPS S DGK IVFR     +  L +I+     LD   +R LT G  +D +P WSPDG
Sbjct  464  HSGFPSYSADGKEIVFRVWGENNMGLRVIN-----LDTREVRTLTTG--LDNLPFWSPDG  516

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            K I F+       +A  F ++ +RPDG+ L+R+           NR    H  ++ D   
Sbjct  517  KRIVFTRKV----DAVNFDVFTIRPDGSDLQRL---------TTNRGNDGHAVWTADGR-  562

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            +L++  + G   E     N FQPYG + +M  DGTG + LT + +E+  P + P
Sbjct  563  ILWSTGMYGFREEAALYDNTFQPYGQIMVMNADGTGKRLLTDSLWEDSMPLYLP  616


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 21/105 (20%)
 Frame = -1

Query  621  CSPDGKHIVFRSGRSGHK-NLYIID-------SLNGELDGGGIRQLTDGAWIDTMPSWSP  466
             SPDG  + F S R G++ N++I D       +L G  D  G   L DG +    P+WSP
Sbjct  115  LSPDGTRLAFVSTREGYRTNIWIKDLKSGRLTNLTGAADVQGDPSLPDGFF---RPAWSP  171

Query  465  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  361
            DGK IAFSS+R      H+ G    +    SIYV+  DG G RR+
Sbjct  172  DGKQIAFSSDRNTDWRGHHDGKGWEHTQELSIYVIGVDGKGFRRV  216



>ref|WP_035035180.1| hypothetical protein, partial [Caulobacter sp. AP07]
Length=544

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 92/177 (52%), Gaps = 23/177 (13%)
 Frame = -1

Query  669  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKN-LYIIDSLNGELDGGGIRQLTDGAW  493
            +K+LTK  TGN  FP  S DG+HIV+R  ++G  N L ++D     LD G    L  G  
Sbjct  390  LKLLTK-GTGNFGFPDWSGDGRHIVYR--QAGAANALDVVD-----LDSGESHVLLAGPA  441

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
                P+WSP   +IAF+++         + IY +R DG+GL+R+  +    +        
Sbjct  442  HYNFPAWSPTADVIAFTADIDG-----DYEIYSIRADGSGLKRLTRSPGNDA--------  488

Query  312  NHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  142
             H  +SPD +W+ F +  GG   E +  P   QPYG++Y+MR DG+    LT   +E
Sbjct  489  -HNAWSPDGKWIAFASARGGFKDEALLHPANPQPYGEIYVMRADGSEAHALTDEPFE  544


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 84/173 (49%), Gaps = 27/173 (16%)
 Frame = -1

Query  624  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  445
            S S DG+ ++F S R+G  ++Y        LDG G+ +L      D   + SPDG+ +AF
Sbjct  27   SFSSDGQWVLFTSRRAGTSDIY-----RAHLDGSGLERLVASPAYDDQAALSPDGRSLAF  81

Query  444  SSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSPDSEWVLFT  268
             S+R   G AD   I+++      LR + H    +              +SPD  W+ F+
Sbjct  82   VSSRG--GQAD---IWILDLASKALRNLTHDPAGD----------FRPSWSPDGRWLAFS  126

Query  267  ANLGGVTAEPVSIPN---QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            ++     +E   IP      +   ++Y++++DGT L+R+T +G   G+P W P
Sbjct  127  SDR---VSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDGQFAGSPTWSP  176


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 91/214 (43%), Gaps = 36/214 (17%)
 Frame = -1

Query  624  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  445
            + SPDG+ + F S R G  +++I+D     L    +R LT     D  PSWSPDG+ +AF
Sbjct  71   ALSPDGRSLAFVSSRGGQADIWILD-----LASKALRNLTHDPAGDFRPSWSPDGRWLAF  125

Query  444  SSNR--HNPGNAD-------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSP  292
            SS+R   +P   +          IY+V+ DGT LRR+   G         +      +SP
Sbjct  126  SSDRVSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDG---------QFAGSPTWSP  176

Query  291  D-SEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            D S+   + A L  V    ++   + +    +  + L     Q LT    E  +P W   
Sbjct  177  DGSKLAFYAATLPEV--RNITAARRLRGVTQIEAVDLGTGASQVLTSGAGEKWSPHWLAP  234

Query  114  AEVDL--------ARLSLGKSGEKLRGKFDEPLW  37
              +             + G SG   RG+F+ P W
Sbjct  235  DRIGYVSGGPEGGVEATAGPSGA--RGEFNSPSW  266



>ref|WP_020383615.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=342

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 95/201 (47%), Gaps = 44/201 (22%)
 Frame = -1

Query  642  GNNAFPSCSPDGKHIVFRSGRSGH--------KNLYIIDSLNGELDGGGIRQLTDGAWID  487
            G + FPS SPDGKHIVF S R GH          +Y++D+     DGG  ++LT+    D
Sbjct  167  GEDRFPSWSPDGKHIVFSSRRDGHFRGNFGITHEIYVMDT-----DGGNQQRLTENRTND  221

Query  486  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  307
              PSWSPDGK IAFSS+R   G+ + F IYV+  DG   +++           NR     
Sbjct  222  WHPSWSPDGKRIAFSSDRK--GDFENFEIYVMDADGGNQQKL---------TENRVYDWR  270

Query  306  VCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  127
              +SPD++ + F +   G                ++Y+M  DG   Q LT N   +  PA
Sbjct  271  PSWSPDAKRITFASERDGNY--------------EIYVMDADGGNPQNLTNNPNYDALPA  316

Query  126  WHPKAEVDLARLSLGKSGEKL  64
            W   A       S+  +G+K 
Sbjct  317  WFGSA------FSVSPAGKKF  331


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 90/182 (49%), Gaps = 34/182 (19%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRS----GHKNL--YIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  466
            PS SPDGK IVF S R     GH NL  Y++D+     DGG  + LT+    D  PSWSP
Sbjct  122  PSWSPDGKRIVFTSRRKKDADGHFNLEIYVMDA-----DGGNQQNLTNNPGEDRFPSWSP  176

Query  465  DGKLIAFSSNR--HNPGN-ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            DGK I FSS R  H  GN      IYV+  DG   +R+           NR    H  +S
Sbjct  177  DGKHIVFSSRRDGHFRGNFGITHEIYVMDTDGGNQQRL---------TENRTNDWHPSWS  227

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  115
            PD + + F+++  G           F+ + ++Y+M  DG   Q+LT N   +  P+W P 
Sbjct  228  PDGKRIAFSSDRKG----------DFENF-EIYVMDADGGNQQKLTENRVYDWRPSWSPD  276

Query  114  AE  109
            A+
Sbjct  277  AK  278


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 85/192 (44%), Gaps = 35/192 (18%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGH----------KNLYIIDSLNGELDGGGIRQLTDGAWIDTMP  478
            PS SP GK I F S R GH            +Y++D+     DGG  + LT+    D  P
Sbjct  68   PSWSPHGKRIAFVSDRDGHFRADMPDIPSYGIYVMDA-----DGGNQQNLTNDLSDDRSP  122

Query  477  SWSPDGKLIAFSSNRHNPGNADC-FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  301
            SWSPDGK I F+S R    +      IYV+  DG   + +     E       +R     
Sbjct  123  SWSPDGKRIVFTSRRKKDADGHFNLEIYVMDADGGNQQNLTNNPGE-------DRF--PS  173

Query  300  FSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  121
            +SPD + ++F++   G       I ++      +Y+M  DG   QRLT    EN T  WH
Sbjct  174  WSPDGKHIVFSSRRDGHFRGNFGITHE------IYVMDTDGGNQQRLT----ENRTNDWH  223

Query  120  PKAEVDLARLSL  85
            P    D  R++ 
Sbjct  224  PSWSPDGKRIAF  235


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 80/176 (45%), Gaps = 27/176 (15%)
 Frame = -1

Query  621  CSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  442
            C      I F S R G   +Y++D     ++GG  + LT+    D  PSWSP GK IAF 
Sbjct  26   CVDAQAQIAFVSRRDGDPEIYVMD-----INGGNPQNLTNHPDRDWDPSWSPHGKRIAFV  80

Query  441  SNRHNPGNAD-----CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWV  277
            S+R     AD      + IYV+  DG   + +       + +++ +R     +SPD + +
Sbjct  81   SDRDGHFRADMPDIPSYGIYVMDADGGNQQNL-------TNDLSDDR--SPSWSPDGKRI  131

Query  276  LFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
            +FT+          ++        ++Y+M  DG   Q LT N  E+  P+W P  +
Sbjct  132  VFTSRRKKDADGHFNL--------EIYVMDADGGNQQNLTNNPGEDRFPSWSPDGK  179



>ref|WP_034400879.1| translocation protein TolB [Candidatus Pelagibacter ubique]
Length=441

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 113/240 (47%), Gaps = 46/240 (19%)
 Frame = -1

Query  729  FDPSNLTddgdddsDEIP----VEIKVLTKETTGN----NAFPSCSPDGKHIVFRSGRSG  574
            F+P++           +P    ++I+  T+E  GN       P  SPDGK IV    + G
Sbjct  210  FNPTSQMVTYMSYFRNMPRVYLLDIETGTQEVVGNFPGMTFAPRFSPDGKKIVMSFAKDG  269

Query  573  HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYV  394
            + ++Y +D     LD   + ++TD + IDT PS+SPDGK IAF+S+R     +    IYV
Sbjct  270  NSDIYTMD-----LDTRVVERITDHSSIDTSPSFSPDGKFIAFNSDR-----SGLQQIYV  319

Query  393  VRPDGTGLRRIHVA-GAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQF  217
            +R DG+G++RI    G  G+            +SP  + + FT    G          +F
Sbjct  320  MRSDGSGVKRITFGNGIYGTP----------VWSPRGDLIAFTKMRKG----------RF  359

Query  216  QPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLW  37
                 + +MR DGTG + LT N Y+   P+W P   V L      K+G K  G F   LW
Sbjct  360  Y----IGVMRTDGTGERLLTENYYQEA-PSWSPNGRV-LVFYRETKAGSKGEG-FSAKLW  412



>ref|WP_043399319.1| tolB protein precursor protein, partial [Cystobacter violaceus]
Length=349

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 102/210 (49%), Gaps = 39/210 (19%)
 Frame = -1

Query  675  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  496
             E+  LT+   GN   PS SPDG  + F S R+G   +Y++ +     DG  +R+LT   
Sbjct  149  AEVTRLTQAPEGNFE-PSVSPDGTQVAFVSSRTGDPEIYVMKA-----DGTDVRRLTSFH  202

Query  495  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV----  328
              D  P WSPDGK I+F S+R          ++VV+PDGTGLR +  +   G E      
Sbjct  203  KEDMAPKWSPDGKWISFLSDREG-----RVRVFVVKPDGTGLRAVSGSQQTGEEREPVWS  257

Query  327  -NRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPN--------QFQPYG----------  205
             + ++L  V  + D +  ++ A++GG   EPV++ +        ++ P G          
Sbjct  258  PDGKKLAFVGRAKDQKSRIWVADMGG--GEPVALTDGKSTDDQPEWSPDGKYLAFASERT  315

Query  204  ---DLYMMRLDGTGLQRLTWNGYENGTPAW  124
               +L++MR +G+G  +LT     +  P W
Sbjct  316  GDVELFLMRANGSGQTQLTSTKGADWLPRW  345



>gb|KFY42678.1| hypothetical protein V495_04387 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY59861.1| hypothetical protein V497_04044 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=665

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 93/186 (50%), Gaps = 24/186 (13%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
            LT  T G  N+ FPS SP G  +V+R  G  G   L I++     +       LTDG W 
Sbjct  491  LTFGTAGEVNSGFPSFSPVGDQLVYRDFGPDGGLGLRILN-----ITDKTTTNLTDG-W-  543

Query  489  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  598

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  142
                H  +S D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E
Sbjct  599  ----HAAWSADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWE  653

Query  141  NGTPAW  124
            +  P +
Sbjct  654  DSMPVY  659



>gb|KFY02373.1| hypothetical protein O988_02191 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=665

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 93/186 (50%), Gaps = 24/186 (13%)
 Frame = -1

Query  660  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  490
            LT  T G  N+ FPS SP G  +V+R  G  G   L I++  +          LTDG W 
Sbjct  491  LTFGTAGEVNSGFPSFSPFGDQLVYRDFGPDGGLGLRILNITDKT-----TINLTDG-W-  543

Query  489  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  322
            D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  598

Query  321  ERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  142
                H  +S D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E
Sbjct  599  ----HAAWSADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWE  653

Query  141  NGTPAW  124
            +  P +
Sbjct  654  DSMPVY  659



>gb|KFX90155.1| hypothetical protein V490_06619 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=665

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 89/177 (50%), Gaps = 22/177 (12%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            N+ FPS SP G  +V+R  G  G   L I++     +       LTDG W D  P WSPD
Sbjct  500  NSGFPSFSPVGDQLVYRDFGPDGGLGLRILN-----ITDKTTTNLTDG-W-DNNPGWSPD  552

Query  462  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  ++
Sbjct  553  GKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWT  603

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
             D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E+  P +
Sbjct  604  ADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWEDSMPVY  659



>gb|KFY15902.1| hypothetical protein V492_01680 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=652

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 88/175 (50%), Gaps = 22/175 (13%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            N+ FPS SPDG  +V+R  G  G   L I++  +          LT+  W D  P WSPD
Sbjct  487  NSGFPSFSPDGTQLVYRDFGPDGGLGLRILNIADNT-----TTTLTED-W-DNNPGWSPD  539

Query  462  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  540  GKSIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLMQLTTSGANDA---------HAAWS  590

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
             D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P
Sbjct  591  ADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWEDSMP  644



>gb|ETI58852.1| hypothetical protein C100_22665 [Sphingobium sp. C100]
Length=611

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 21/170 (12%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            ++ FPS S DGK IVFR      K L +++     LD    R LT G  +D +P WSPDG
Sbjct  456  HSGFPSYSADGKEIVFRVWSESEKGLRVLN-----LDTRKTRVLTTG--LDNLPGWSPDG  508

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            K I F+  R + GN   F IY ++PDG+GL R     +            H  +SPD   
Sbjct  509  KRIVFTRKRED-GN---FDIYTIKPDGSGLFRCTDHPSSD---------GHAVWSPDGR-  554

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
            ++++ +  G   E       FQ YG +Y+M  DG+  + LT + +E+  P
Sbjct  555  IMWSGSQHGFRDEAALYDQTFQQYGQIYVMNADGSDKRLLTDSKWEDSMP  604


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 27/121 (22%)
 Frame = -1

Query  663  VLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLT------  505
            ++T ++  + A    SPDG+ + F S R G++ N+++ D   G       RQLT      
Sbjct  93   IITTDSLDDAAM--LSPDGRTLAFVSTRDGYRANIWLQDLFTGR-----TRQLTGVGDVH  145

Query  504  -DGAWIDTM--PSWSPDGKLIAFSSNR------HNPGNA----DCFSIYVVRPDGTGLRR  364
             +  + D    P+WSPDGK +AFSS+R      H+ G+        SIY++RPDGTG R+
Sbjct  146  GEDLYPDCYFRPAWSPDGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRK  205

Query  363  I  361
            +
Sbjct  206  V  206


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 81/177 (46%), Gaps = 35/177 (20%)
 Frame = -1

Query  627  PSCSPDGKHIV-----FRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            PS +PDGK ++     F+  R  +K L+  D            +  D   +D  P  S D
Sbjct  312  PSWTPDGKSVIYEKVSFKPIRPLYKPLFSWD------------KDYDYRHVDVFPLLSRD  359

Query  462  GKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER----LNHVCFS  295
            G  I F+  +   GN+   S++++RPDG+  R+I  +   G +E   +         C+S
Sbjct  360  G-WIVFTEKQL--GNS---SVWIMRPDGSEKRKIFESSGRGLDERKVQMGLAGAFQPCWS  413

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
            PD EW+ F   LG    E  ++         L+ +R DGTG ++LT     +G P++
Sbjct  414  PDGEWIAF--GLGYWFNERSTMTAA------LWRVRRDGTGAEQLTDGSLHSGFPSY  462



>ref|WP_041305462.1| hypothetical protein, partial [Herpetosiphon aurantiacus]
Length=173

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 72/122 (59%), Gaps = 17/122 (14%)
 Frame = -1

Query  642  GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            G++  PS SPDG+ + F+S RSG+  LY+I+      DG  +RQLT+    D  PSWSPD
Sbjct  42   GDDQSPSWSPDGQQLAFQSNRSGNDELYLINR-----DGSNLRQLTNDPARDWQPSWSPD  96

Query  462  GKLIAFSSNR--HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPD  289
            G LIAF+S+R    P   +   +YV++PDG GL+ +       +E   R R  H  +SPD
Sbjct  97   GSLIAFTSDRGAQTPDGWND-QLYVIQPDGQGLKYL-------TEGFGRAR--HPAWSPD  146

Query  288  SE  283
            S+
Sbjct  147  SQ  148


 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 83/173 (48%), Gaps = 27/173 (16%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  448
            P+ SPDG  + F    S   N+YI        DG  + Q+T+    D  PSWSPDG+ +A
Sbjct  3    PTWSPDGNELAFVVQDSDGFNMYI-----SSADGSNLFQVTNQPGDDQSPSWSPDGQQLA  57

Query  447  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFT  268
            F SNR   GN +   +Y++  DG+ LR++    A         R     +SPD   + FT
Sbjct  58   FQSNRS--GNDE---LYLINRDGSNLRQLTNDPA---------RDWQPSWSPDGSLIAFT  103

Query  267  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
            ++ G  T  P    +Q      LY+++ DG GL+ LT        PAW P ++
Sbjct  104  SDRGAQT--PDGWNDQ------LYVIQPDGQGLKYLTEGFGRARHPAWSPDSQ  148



>ref|WP_031310342.1| hypothetical protein [Sphingobium sp. C100]
Length=621

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 21/170 (12%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            ++ FPS S DGK IVFR      K L +++     LD    R LT G  +D +P WSPDG
Sbjct  466  HSGFPSYSADGKEIVFRVWSESEKGLRVLN-----LDTRKTRVLTTG--LDNLPGWSPDG  518

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEW  280
            K I F+  R + GN   F IY ++PDG+GL R     +            H  +SPD   
Sbjct  519  KRIVFTRKRED-GN---FDIYTIKPDGSGLFRCTDHPSSD---------GHAVWSPDGR-  564

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
            ++++ +  G   E       FQ YG +Y+M  DG+  + LT + +E+  P
Sbjct  565  IMWSGSQHGFRDEAALYDQTFQQYGQIYVMNADGSDKRLLTDSKWEDSMP  614


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 27/121 (22%)
 Frame = -1

Query  663  VLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLT------  505
            ++T ++  + A    SPDG+ + F S R G++ N+++ D   G       RQLT      
Sbjct  103  IITTDSLDDAAM--LSPDGRTLAFVSTRDGYRANIWLQDLFTGR-----TRQLTGVGDVH  155

Query  504  -DGAWIDTM--PSWSPDGKLIAFSSNR------HNPGNA----DCFSIYVVRPDGTGLRR  364
             +  + D    P+WSPDGK +AFSS+R      H+ G+        SIY++RPDGTG R+
Sbjct  156  GEDLYPDCYFRPAWSPDGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRK  215

Query  363  I  361
            +
Sbjct  216  V  216



>ref|XP_001545913.1| hypothetical protein BC1G_15641 [Botrytis cinerea B05.10]
 gb|EMR86797.1| putative tat pathway signal sequence domain-containing protein 
[Botrytis cinerea BcDW1]
 emb|CCD52696.2| similar to prolyl oligopeptidase [Botrytis cinerea T4]
Length=674

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 85/176 (48%), Gaps = 18/176 (10%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            N  FPS SPDG  IV+R    G   LY I      L  G +  LTD  W D  P WSPDG
Sbjct  507  NAGFPSYSPDGTKIVYR--ECGPAPLYCIGLRILNLADGTVTNLTD-TW-DNTPGWSPDG  562

Query  459  KLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSP  292
            + I F+   H    +  + D + +Y + P+GTGL ++  +GA  +         H  +S 
Sbjct  563  ERIVFTRRNHLNFDDLSSTDSYDVYTIFPNGTGLTQVTTSGANDA---------HAVWSA  613

Query  291  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
            D   +L+++ + G   E     N FQPYG +  M  DG+    LT + +E+  P +
Sbjct  614  DGR-ILYSSGMYGFREESPLYDNAFQPYGQIISMNFDGSNKTMLTDSMWEDSMPLY  668



>gb|KFZ05841.1| hypothetical protein V501_07970 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=665

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 88/177 (50%), Gaps = 22/177 (12%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            N+ FPS SPDG  +V+R  G  G   L I++     L       LT+  W D  P WSPD
Sbjct  500  NSGFPSFSPDGTQLVYRDFGPEGGLGLRILN-----LADRTTTNLTED-W-DNNPGWSPD  552

Query  462  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            G+ I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  553  GERIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  603

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
             D   +++T+ + G   E V+  N FQPYG +  M  DG+    +T + +E+  P +
Sbjct  604  ADGR-IMYTSGMYGFREECVNYDNTFQPYGQIVAMNADGSNKTLVTDSMWEDSMPVY  659



>gb|ABX03625.1| WD40 domain protein beta Propeller [Herpetosiphon aurantiacus 
DSM 785]
Length=316

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 72/122 (59%), Gaps = 17/122 (14%)
 Frame = -1

Query  642  GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            G++  PS SPDG+ + F+S RSG+  LY+I+      DG  +RQLT+    D  PSWSPD
Sbjct  125  GDDQSPSWSPDGQQLAFQSNRSGNDELYLINR-----DGSNLRQLTNDPARDWQPSWSPD  179

Query  462  GKLIAFSSNR--HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPD  289
            G LIAF+S+R    P   +   +YV++PDG GL+ +       +E   R R  H  +SPD
Sbjct  180  GSLIAFTSDRGAQTPDGWND-QLYVIQPDGQGLKYL-------TEGFGRAR--HPAWSPD  229

Query  288  SE  283
            S+
Sbjct  230  SQ  231


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 82/173 (47%), Gaps = 27/173 (16%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  448
            P+ SPDG  + F    S   N+YI        DG  + Q+T+    D  PSWSPDG+ +A
Sbjct  86   PTWSPDGNELAFVVQDSDGFNMYI-----SSADGSNLFQVTNQPGDDQSPSWSPDGQQLA  140

Query  447  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFT  268
            F SNR   GN +   +Y++  DG+ LR++    A         R     +SPD   + FT
Sbjct  141  FQSNRS--GNDE---LYLINRDGSNLRQLTNDPA---------RDWQPSWSPDGSLIAFT  186

Query  267  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
            ++ G  T +  +          LY+++ DG GL+ LT        PAW P ++
Sbjct  187  SDRGAQTPDGWN--------DQLYVIQPDGQGLKYLTEGFGRARHPAWSPDSQ  231



>gb|KFY39698.1| hypothetical protein V494_03875 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=652

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 88/175 (50%), Gaps = 22/175 (13%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            N+ FPS SP+G  +V+R  G  G   L I++  +          LT+  W D  P WSPD
Sbjct  487  NSGFPSFSPNGTQLVYRDFGPDGGLGLRILNIADNT-----TTTLTED-W-DNNPGWSPD  539

Query  462  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  540  GKSIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  590

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
             D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P
Sbjct  591  ADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWEDSMP  644



>gb|KFY74302.1| hypothetical protein V499_05663 [Pseudogymnoascus pannorum VKM 
F-103]
Length=667

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 88/177 (50%), Gaps = 22/177 (12%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            N+ FP  SPDG  +V+R  G  G   L I++     L       LT+  W D  P WSPD
Sbjct  502  NSGFPGFSPDGTQLVYRDFGPGGGLGLRILN-----LADKTTTNLTED-W-DNNPGWSPD  554

Query  462  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  295
            G+ I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  555  GERIVFTRRNHIKWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  605

Query  294  PDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
             D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P +
Sbjct  606  ADGR-IMYTSGMYGFREECVNYDNTFQPYGQIVVMNADGSNKTLVTDSMWEDSMPVY  661



>ref|WP_020383554.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=341

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 90/187 (48%), Gaps = 30/187 (16%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGH-------KNLYIIDSLNGELDGGGIRQLTDGAWIDTM  481
            N+ FPS SPDGK IVF S R GH         +Y++D+     DGG  + LT+    D  
Sbjct  64   NDWFPSWSPDGKRIVFFSNRDGHVIRGGSAYEIYVMDA-----DGGNPQNLTNDLNDDRS  118

Query  480  PSWSPDGKLIAFSSNRHNPGNADCF---SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  310
            PSWSPDGK I F S+R    N D      IYV+  DG+  + +       + ++N +R  
Sbjct  119  PSWSPDGKRIVFVSDRDGFKNDDGVITDEIYVMDADGSNPQNL-------TNDLNDDR--  169

Query  309  HVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
               +SPD + + F +   G       I ++      +Y+M  DG   QRLT N   +  P
Sbjct  170  SPSWSPDGKRIAFVSQREGHFKGAAGITDE------IYVMDADGGNQQRLTENHKNDWFP  223

Query  129  AWHPKAE  109
            +W P  +
Sbjct  224  SWSPDGK  230


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 80/176 (45%), Gaps = 38/176 (22%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGH--------KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  472
            PS SPDGK I F S R GH          +Y++D+     DGG  ++LT+    D  PSW
Sbjct  171  PSWSPDGKRIAFVSQREGHFKGAAGITDEIYVMDA-----DGGNQQRLTENHKNDWFPSW  225

Query  471  SPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSP  292
            SPDGK IAF+S R   G+   F IYV+  DG   +R+           NR       +SP
Sbjct  226  SPDGKRIAFASERK--GDLVNFEIYVMDADGGNQQRL---------TENRVYDWSPSWSP  274

Query  291  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  124
              + + F +   G                ++Y+M  DG   Q LT N + +  PAW
Sbjct  275  GGKRIAFMSERNG--------------NAEIYVMDADGGNPQNLTNNRHRDVNPAW  316


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 85/181 (47%), Gaps = 36/181 (20%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGHKN--------LYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  472
            PS SPDGK IVF S R G KN        +Y++D+     DG   + LT+    D  PSW
Sbjct  119  PSWSPDGKRIVFVSDRDGFKNDDGVITDEIYVMDA-----DGSNPQNLTNDLNDDRSPSW  173

Query  471  SPDGKLIAFSSNR--HNPGNADCFS-IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  301
            SPDGK IAF S R  H  G A     IYV+  DG   +R+           N +      
Sbjct  174  SPDGKRIAFVSQREGHFKGAAGITDEIYVMDADGGNQQRL---------TENHKNDWFPS  224

Query  300  FSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  121
            +SPD + + F +   G   + V+         ++Y+M  DG   QRLT N   + +P+W 
Sbjct  225  WSPDGKRIAFASERKG---DLVNF--------EIYVMDADGGNQQRLTENRVYDWSPSWS  273

Query  120  P  118
            P
Sbjct  274  P  274


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 85/173 (49%), Gaps = 22/173 (13%)
 Frame = -1

Query  621  CSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  442
            C      I F S R G+  +Y++D+     DGG  R+LT+    D  PSWSPDGK I F 
Sbjct  26   CVDAQAQITFVSKRDGNAEIYVMDA-----DGGNQRRLTNHPDNDWFPSWSPDGKRIVFF  80

Query  441  SNR--HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFT  268
            SNR  H       + IYV+  DG   + +       + ++N +R     +SPD + ++F 
Sbjct  81   SNRDGHVIRGGSAYEIYVMDADGGNPQNL-------TNDLNDDR--SPSWSPDGKRIVFV  131

Query  267  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
            ++  G   +   I ++      +Y+M  DG+  Q LT +  ++ +P+W P  +
Sbjct  132  SDRDGFKNDDGVITDE------IYVMDADGSNPQNLTNDLNDDRSPSWSPDGK  178


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 55/94 (59%), Gaps = 13/94 (14%)
 Frame = -1

Query  651  ETTGNNAFPSCSPDGKHIVFRSGRSG---HKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  481
            E   N+ FPS SPDGK I F S R G   +  +Y++D+     DGG  ++LT+    D  
Sbjct  215  ENHKNDWFPSWSPDGKRIAFASERKGDLVNFEIYVMDA-----DGGNQQRLTENRVYDWS  269

Query  480  PSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDG  379
            PSWSP GK IAF S R+  GNA+   IYV+  DG
Sbjct  270  PSWSPGGKRIAFMSERN--GNAE---IYVMDADG  298



>gb|AFK45973.1| unknown [Medicago truncatula]
Length=97

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -1

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  100
            ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +  
Sbjct  1    MVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKP  59

Query  99   ARLSLGKSGEKLRGKFDEPLWINS  28
              + + K G      F++  W+N+
Sbjct  60   VNVEMPKGGPYC--SFEDCHWLNN  81



>gb|EKD68537.1| Periplasmic component of the Tol biopolymer transport system, 
partial [uncultured bacterium]
Length=653

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 65/118 (55%), Gaps = 19/118 (16%)
 Frame = -1

Query  618  SPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  439
            SPDG  IVF S R G+  +YI++S     DG G+  LT+ A  DT P++SPDGK I FSS
Sbjct  518  SPDGSKIVFVSDRDGNNEIYIMNS-----DGSGLANLTNNAKNDTDPNFSPDGKKIVFSS  572

Query  438  NRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTA  265
            +R  PG      IY +  DGTGL RI   G    E          C+SPD   ++F+A
Sbjct  573  DRDGPGQ-----IYTMNADGTGLARITSGGLNCFEP---------CYSPDGRKIVFSA  616


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 66/149 (44%), Gaps = 33/149 (22%)
 Frame = -1

Query  564  LYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRP  385
            +Y+ D       GG +  LT+    D    +SPDG  I F S+R   GN +   IY++  
Sbjct  492  IYVFDKT-----GGSLVNLTNNPAADVTSKFSPDGSKIVFVSDRD--GNNE---IYIMNS  541

Query  384  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYG  205
            DG+GL  +    A+   + N        FSPD + ++F+++  G               G
Sbjct  542  DGSGLANL-TNNAKNDTDPN--------FSPDGKKIVFSSDRDGP--------------G  578

Query  204  DLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
             +Y M  DGTGL R+T  G     P + P
Sbjct  579  QIYTMNADGTGLARITSGGLNCFEPCYSP  607


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            N+  P+ SPDGK IVF S R G   +Y +++     DG G+ ++T G      P +SPDG
Sbjct  555  NDTDPNFSPDGKKIVFSSDRDGPGQIYTMNA-----DGTGLARITSGGLNCFEPCYSPDG  609

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI  361
            + I FS+   +  +   F+   V PDGT  + I
Sbjct  610  RKIVFSAYTSSLSDGGVFT---VNPDGTDPKVI  639



>ref|XP_007835900.1| hypothetical protein PFICI_09128 [Pestalotiopsis fici W106-1]
 gb|ETS79275.1| hypothetical protein PFICI_09128 [Pestalotiopsis fici W106-1]
Length=678

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 95/186 (51%), Gaps = 25/186 (13%)
 Frame = -1

Query  645  TGNNAFPSCSPDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  472
            T N  FPS SPDG  +VFR   G +G   L+++D     ++ G   Q+T+G W D  P W
Sbjct  507  TFNAGFPSFSPDGTKLVFRLWDGENGPLGLHVMD-----METGNTTQITNG-W-DNTPGW  559

Query  471  SPDGKLIAFSSNR---HNPGNA---DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  310
            SPDG+LI F+       + GN    D + I  ++PDGT L+ +  + A  +         
Sbjct  560  SPDGELIVFARQTNWTQDYGNRWYDDRYDIATIKPDGTDLKILTESHANDA---------  610

Query  309  HVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
            H  ++PD   +++ + + G   E     N FQPYG + +M  DG+    LT + +E+  P
Sbjct  611  HAVWAPDGR-IMYNSGMHGFRDESPLYDNTFQPYGQIIIMNADGSNKTALTDSMWEDSMP  669

Query  129  AWHPKA  112
             + P++
Sbjct  670  QYIPRS  675



>gb|KEZ20905.1| Periplasmic component of the Tol biopolymer transport system 
precursor [Sphingobium yanoikuyae]
Length=616

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 86/171 (50%), Gaps = 23/171 (13%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            ++ FPS S DGK IVFR      K L I++     LD G IR LT    +D +P WSPDG
Sbjct  460  HSGFPSYSADGKEIVFRVWGDDEKGLRILN-----LDTGKIRVLTTE--LDNLPGWSPDG  512

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSPDSE  283
            K I F+       N   F I  + PDG+ L+++ H   ++G          H  +SPD  
Sbjct  513  KRIVFTRKV----NGTTFQICTIAPDGSDLQQLTHGLESDG----------HAVWSPDGR  558

Query  282  WVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
             ++++ +  G   E     N FQ YG +Y+M  DG+  + LT + +E+  P
Sbjct  559  -IMWSGSAHGFRDEAALYDNTFQQYGQIYVMNADGSDKKMLTDSKWEDSMP  608


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 92/200 (46%), Gaps = 31/200 (16%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            E K+L       N   + SP G  I+F S R+G     +  +L    DG GIRQL  G+ 
Sbjct  48   EHKLLADSAYDYNV--TLSPKGDRIIFTSERNGDGQSDLFIALP---DGSGIRQLAQGSS  102

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            +D     SPDG+++AF S R    N    +I+V+      ++++   G    +  + +  
Sbjct  103  MDDAGVLSPDGRMLAFVSTR----NGYRANIWVMDVKSGAMKQLTGIGDVRGKADSPDCY  158

Query  312  NHVCFSPDSEWVLFTAN-----------LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  166
                +SPD +W+ F+++            G    + +SI          YM+R DGTG +
Sbjct  159  FRPAWSPDGKWIAFSSDRDTSWRGHDDGRGWEHTQELSI----------YMIRADGTGFR  208

Query  165  RL-TWNGYENGTPAWHPKAE  109
            ++ +  G+  G+PAW P  +
Sbjct  209  QVASRKGWCLGSPAWSPDGK  228



>ref|WP_037517431.1| hypothetical protein [Sphingobium yanoikuyae]
Length=622

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 86/171 (50%), Gaps = 23/171 (13%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            ++ FPS S DGK IVFR      K L I++     LD G IR LT    +D +P WSPDG
Sbjct  466  HSGFPSYSADGKEIVFRVWGDDEKGLRILN-----LDTGKIRVLTTE--LDNLPGWSPDG  518

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSPDSE  283
            K I F+       N   F I  + PDG+ L+++ H   ++G          H  +SPD  
Sbjct  519  KRIVFTRKV----NGTTFQICTIAPDGSDLQQLTHGLESDG----------HAVWSPDGR  564

Query  282  WVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
             ++++ +  G   E     N FQ YG +Y+M  DG+  + LT + +E+  P
Sbjct  565  -IMWSGSAHGFRDEAALYDNTFQQYGQIYVMNADGSDKKMLTDSKWEDSMP  614


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 92/200 (46%), Gaps = 31/200 (16%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            E K+L       N   + SP G  I+F S R+G     +  +L    DG GIRQL  G+ 
Sbjct  54   EHKLLADSAYDYNV--TLSPKGDRIIFTSERNGDGQSDLFIALP---DGSGIRQLAQGSS  108

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            +D     SPDG+++AF S R    N    +I+V+      ++++   G    +  + +  
Sbjct  109  MDDAGVLSPDGRMLAFVSTR----NGYRANIWVMDVKSGAMKQLTGIGDVRGKADSPDCY  164

Query  312  NHVCFSPDSEWVLFTAN-----------LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  166
                +SPD +W+ F+++            G    + +SI          YM+R DGTG +
Sbjct  165  FRPAWSPDGKWIAFSSDRDTSWRGHDDGRGWEHTQELSI----------YMIRADGTGFR  214

Query  165  RL-TWNGYENGTPAWHPKAE  109
            ++ +  G+  G+PAW P  +
Sbjct  215  QVASRKGWCLGSPAWSPDGK  234



>ref|WP_033378529.1| MULTISPECIES: hypothetical protein, partial [Marinimicrobia]
Length=304

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 98/208 (47%), Gaps = 37/208 (18%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            +I  LT +  G    P  SPDGK I F    +G+ ++Y+ D+      G  +R+LT    
Sbjct  107  QISRLT-QIVGPATSPVFSPDGKKIAFSLTTNGNTDIYVSDT-----HGNNLRRLTQNPG  160

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG------------  349
            IDT P+WSP+GK +AF+S+R     +    IY++  DG  +RR+                
Sbjct  161  IDTSPAWSPNGKSLAFTSDR-----SGSPQIYLMDADGANIRRLTYNNDYNASPAWSPRG  215

Query  348  ---AEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYG--------D  202
               A  S+E N  ++     +PD E V    +     A+PV  PN              +
Sbjct  216  DVIAYESQESNGFQI--YLITPDGEEVQCITDRTASYADPVWAPNGLHLACASNRTGKWE  273

Query  201  LYMMRLDGTGLQRLTWNGYENGTPAWHP  118
            +Y M LDG+ L+RLT++G  N  PAW P
Sbjct  274  IYSMYLDGSRLKRLTFSG-NNTQPAWSP  300


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 80/178 (45%), Gaps = 38/178 (21%)
 Frame = -1

Query  627  PSCSPDGKHIVFRS---GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGK  457
            P  SPDGK ++F S    +     L I +  + +     I +LT      T P +SPDGK
Sbjct  74   PDWSPDGKQLIFSSLIPAQHLASQLVIFNFASNQ-----ISRLTQIVGPATSPVFSPDGK  128

Query  456  LIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSPDSEW  280
             IAFS   +  GN D   IYV    G  LRR+    G + S            +SP+ + 
Sbjct  129  KIAFSLTTN--GNTD---IYVSDTHGNNLRRLTQNPGIDTSP----------AWSPNGKS  173

Query  279  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV  106
            + FT++  G                 +Y+M  DG  ++RLT+N   N +PAW P+ +V
Sbjct  174  LAFTSDRSGSP--------------QIYLMDADGANIRRLTYNNDYNASPAWSPRGDV  217



>emb|CAI78611.1| tolB protein [uncultured delta proteobacterium]
Length=437

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 86/174 (49%), Gaps = 32/174 (18%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  448
            P+ SPDGK I F S R G+ N+Y ++S     +G  +R+LT     +T P WSP G  I 
Sbjct  296  PTWSPDGKKIAFVSDRGGNPNIYTMNS-----NGQNVRRLTFEGTYNTSPDWSPKGDNIV  350

Query  447  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFT  268
            F+  R N G    F IY +RPDG+GL +I    A+  E           +SPD  +++++
Sbjct  351  FTG-RDNLG---YFQIYTIRPDGSGLCQITFNSADNEEP---------SWSPDGRFIVYS  397

Query  267  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV  106
            + + G +               +Y+M  +GTG ++L     E   P W P+ ++
Sbjct  398  STIEGKSG--------------IYIMLFNGTGRRKLINLNGEQTYPVWSPRLDM  437


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 91/193 (47%), Gaps = 37/193 (19%)
 Frame = -1

Query  642  GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  463
            G N   S S   + I     + G+ ++Y++++     +G  I +LT    ID  P+WSPD
Sbjct  247  GINLSASWSDKHQMIATSLSKDGYPDIYLMNT-----NGNIISRLTRSNSIDISPTWSPD  301

Query  462  GKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSE  283
            GK IAF S+R   GN +   IY +  +G  +RR+   G   +            +SP  +
Sbjct  302  GKKIAFVSDRG--GNPN---IYTMNSNGQNVRRLTFEGTYNTSP---------DWSPKGD  347

Query  282  WVLFTA--NLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
             ++FT   NLG               Y  +Y +R DG+GL ++T+N  +N  P+W P   
Sbjct  348  NIVFTGRDNLG---------------YFQIYTIRPDGSGLCQITFNSADNEEPSWSPDGR  392

Query  108  VDLARLSL-GKSG  73
              +   ++ GKSG
Sbjct  393  FIVYSSTIEGKSG  405



>gb|EJK81239.1| periplasmic component of the Tol biopolymer transport system 
[Sphingobium sp. AP49]
Length=644

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 86/171 (50%), Gaps = 23/171 (13%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            ++ FPS S DGK IVFR      K L +++     LD G IR LT    +D +P WSPDG
Sbjct  488  HSGFPSYSADGKEIVFRVWGDDEKGLRVLN-----LDTGKIRVLTTE--LDNLPGWSPDG  540

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSPDSE  283
            K I F+       N   F I  + PDG+ L+++ H   ++G          H  +SPD  
Sbjct  541  KRIVFTRKV----NGTTFQICTIAPDGSDLQQLTHGLESDG----------HAVWSPDGR  586

Query  282  WVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
             ++++ +  G   E     N FQ YG +Y+M  DG+  + LT + +E+  P
Sbjct  587  -IMWSGSAHGFRDEAALYDNTFQQYGQIYVMNADGSDKKMLTDSKWEDSMP  636


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 91/200 (46%), Gaps = 31/200 (16%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            E K+L       N   + SP G  I+F S R+G     +  +L    DG GIRQL  G+ 
Sbjct  76   ERKLLADAAYDYNV--TLSPKGDRIIFTSERNGDGQSDLFIALP---DGSGIRQLAQGSS  130

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            +D     SPDG+ +AF S R    N    +I+V+      ++++   G    +  + +  
Sbjct  131  MDDAGVLSPDGRTLAFVSTR----NGYRANIWVMDVKSGAMKQLTGIGDVRGKADSPDCY  186

Query  312  NHVCFSPDSEWVLFTAN-----------LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  166
                +SPD +W+ F+++            G    + +SI          Y++R DGTG +
Sbjct  187  FRPAWSPDGKWIAFSSDRDTSWRGHDDGRGWEHTQELSI----------YVIRADGTGFR  236

Query  165  RL-TWNGYENGTPAWHPKAE  109
            ++ +  G+  G+PAW P  +
Sbjct  237  QVASRKGWCLGSPAWSPDGK  256



>ref|WP_037486764.1| hypothetical protein [Sphingobium sp. AP49]
Length=622

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 86/171 (50%), Gaps = 23/171 (13%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  460
            ++ FPS S DGK IVFR      K L +++     LD G IR LT    +D +P WSPDG
Sbjct  466  HSGFPSYSADGKEIVFRVWGDDEKGLRVLN-----LDTGKIRVLTTE--LDNLPGWSPDG  518

Query  459  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSPDSE  283
            K I F+       N   F I  + PDG+ L+++ H   ++G          H  +SPD  
Sbjct  519  KRIVFTRKV----NGTTFQICTIAPDGSDLQQLTHGLESDG----------HAVWSPDGR  564

Query  282  WVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
             ++++ +  G   E     N FQ YG +Y+M  DG+  + LT + +E+  P
Sbjct  565  -IMWSGSAHGFRDEAALYDNTFQQYGQIYVMNADGSDKKMLTDSKWEDSMP  614


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 91/200 (46%), Gaps = 31/200 (16%)
 Frame = -1

Query  672  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  493
            E K+L       N   + SP G  I+F S R+G     +  +L    DG GIRQL  G+ 
Sbjct  54   ERKLLADAAYDYNV--TLSPKGDRIIFTSERNGDGQSDLFIALP---DGSGIRQLAQGSS  108

Query  492  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  313
            +D     SPDG+ +AF S R    N    +I+V+      ++++   G    +  + +  
Sbjct  109  MDDAGVLSPDGRTLAFVSTR----NGYRANIWVMDVKSGAMKQLTGIGDVRGKADSPDCY  164

Query  312  NHVCFSPDSEWVLFTAN-----------LGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  166
                +SPD +W+ F+++            G    + +SI          Y++R DGTG +
Sbjct  165  FRPAWSPDGKWIAFSSDRDTSWRGHDDGRGWEHTQELSI----------YVIRADGTGFR  214

Query  165  RL-TWNGYENGTPAWHPKAE  109
            ++ +  G+  G+PAW P  +
Sbjct  215  QVASRKGWCLGSPAWSPDGK  234



>gb|ENH85242.1| WD40 domain protein beta propeller [Colletotrichum orbiculare 
MAFF 240422]
Length=655

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 88/176 (50%), Gaps = 22/176 (13%)
 Frame = -1

Query  645  TGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  466
            T ++ FPS SPDG  IVFR     +  L ++D     L    +R LTD    D +PSWSP
Sbjct  497  TVHSGFPSYSPDGGSIVFREWGVRY-GLRVVD-----LATRAVRNLTDA--TDNLPSWSP  548

Query  465  DGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDS  286
            DG  I F+       +A  F +  +RPDG+GLR +  +GA  +         H  ++ D 
Sbjct  549  DGTRIVFTRKV----DAANFDVCTIRPDGSGLRVLTSSGANDA---------HAVWTADG  595

Query  285  EWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  118
              +L+++ + G   E  +    FQPYG + +M  DG   + LT + +E+  P + P
Sbjct  596  R-ILYSSGMYGFRDEAAAYDQTFQPYGQIVVMDADGANKRMLTDSLWEDSMPLYVP  650


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 25/106 (24%)
 Frame = -1

Query  618  SPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLTDGAWI--DTM-------PSWS  469
            SPDG  + + S  +G++ N++++D   GE      R LTD   +  D +       PSWS
Sbjct  140  SPDGTKLAYVSTENGYRANIWVLDLATGER-----RNLTDTPEVAGDPLLPDGHFRPSWS  194

Query  468  PDGKLIAFSSNRHNP----GNADCF------SIYVVRPDGTGLRRI  361
            PDG  IAF+S+R+ P    GN   +      S+Y +RPDGTG R+I
Sbjct  195  PDGGWIAFASDRNTPWRGHGNGTGWEHTQELSVYAIRPDGTGFRQI  240



>ref|XP_007914327.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
 gb|EOO00969.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
Length=679

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 87/176 (49%), Gaps = 23/176 (13%)
 Frame = -1

Query  639  NNAFPSCSPDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  466
            N  FPS SPDG  +V+R     +G   LYI+D     L  G   +LTDG W D  P WSP
Sbjct  512  NAGFPSFSPDGTKLVYRLWDWNNGPLGLYIMD-----LATGNTTRLTDG-W-DNTPGWSP  564

Query  465  DGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  298
            DGKLI F+   +    N    D F I  ++PDGT L+ +  + A  +         H  +
Sbjct  565  DGKLIVFTRQTNWTWGNSWELDRFDICTIKPDGTDLKVLTESQANDA---------HAVW  615

Query  297  SPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  130
            S D   +++++ + G   E     N FQPYG + +M  DG+    LT + +E+  P
Sbjct  616  SLDGR-IMYSSGMYGFRDESSLYDNTFQPYGQIIVMNADGSNKTMLTDSMWEDSMP  670



>ref|WP_026159723.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=319

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 94/190 (49%), Gaps = 36/190 (19%)
 Frame = -1

Query  630  FPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLI  451
            +PS SPDGKHI F S R G   +Y++D+     DG   R+LT+    DT PSWSPDG+ I
Sbjct  154  YPSWSPDGKHIAFVSDRDGASEIYVMDA-----DGKNQRRLTENLSPDTGPSWSPDGERI  208

Query  450  AFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLF  271
            AF S+R   GN   F IYV+  DG   RR+    +  +            +SPD + ++F
Sbjct  209  AFVSDRD--GN---FDIYVMDADGKNQRRLTRNPSPDTGP---------SWSPDGKRIVF  254

Query  270  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT-GLQRLTWNGYENGTPAWHPKAEVDLAR  94
             +   G                ++Y+M  DG   ++R T +G ++  PAW   A V +  
Sbjct  255  VSTRNGNK--------------EIYVMNADGARQVRRRTKDGSDDTDPAWFDPAFVPV--  298

Query  93   LSLGKSGEKL  64
             ++  +G+K 
Sbjct  299  FAVSPAGKKF  308


 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 36/174 (21%)
 Frame = -1

Query  627  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  448
            PS SPDGK I F S R G+K +Y++D+     DG   R LT+    +  PSWSPD K IA
Sbjct  68   PSWSPDGKRIAFVSDRDGNKEIYVMDA-----DGKNPRNLTNSHVGEWEPSWSPDSKRIA  122

Query  447  FSSN-RHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLF  271
            F+ N RH       + IYV+  DG   +  H+       +       +  +SPD + + F
Sbjct  123  FTLNGRH-------WRIYVIDADG---KNQHILTNNDFHDW------YPSWSPDGKHIAF  166

Query  270  TANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
             ++  G +              ++Y+M  DG   +RLT N   +  P+W P  E
Sbjct  167  VSDRDGAS--------------EIYVMDADGKNQRRLTENLSPDTGPSWSPDGE  206


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 79/168 (47%), Gaps = 40/168 (24%)
 Frame = -1

Query  603  HIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNP  424
             IVF S R G++++Y++D+     DG   R+LT+    +  PSWSPDGK IAF S+R   
Sbjct  32   QIVFSSDRDGNRDIYVMDA-----DGKNPRRLTENLSHEWDPSWSPDGKRIAFVSDRD--  84

Query  423  GNADCFSIYVVRPDGTGLRRI---HVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGG  253
            GN +   IYV+  DG   R +   HV   E S            +SPDS+ + FT N   
Sbjct  85   GNKE---IYVMDADGKNPRNLTNSHVGEWEPS------------WSPDSKRIAFTLN---  126

Query  252  VTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
                          +  +Y++  DG     LT N + +  P+W P  +
Sbjct  127  ------------GRHWRIYVIDADGKNQHILTNNDFHDWYPSWSPDGK  162



>gb|EMS34061.1| tolB protein precursor, periplasmic protein involved in the tonb-independent 
uptake of group A colicins [Mariniradius saccharolyticus 
AK6]
Length=331

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 92/164 (56%), Gaps = 25/164 (15%)
 Frame = -1

Query  624  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  445
            S SPDGK+I+F S R G+  +Y +D+     DG     L++    D +P+WSPDGK IAF
Sbjct  95   SWSPDGKYILFYSNRDGNNEIYRMDA-----DGSNPTNLSNHPANDYLPAWSPDGKTIAF  149

Query  444  SSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTA  265
            +SNR    ++D   IY++  DG+ +RR+     +  EEV         +SP+ + ++FT 
Sbjct  150  TSNR----DSDNREIYIMAIDGSNVRRL--THNDLFEEV-------PTWSPNGKQIVFTR  196

Query  264  NLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW-NGYENG  136
             L  +  + V   N     G+L++M +DG   +RLT+  GY++G
Sbjct  197  QLEEM-VDTVKTTN-----GELFVMDIDGKNEKRLTFREGYDSG  234


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 72/164 (44%), Gaps = 32/164 (20%)
 Frame = -1

Query  600  IVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG  421
            + F + R G+  +Y +++     DG  +  LT    +D   SWSPDGK I F SNR   G
Sbjct  59   LAFLTTRDGNFEVYTMNA-----DGREVNNLTQNKALDFWSSWSPDGKYILFYSNRD--G  111

Query  420  NADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSPDSEWVLFTANLGGVTAE  241
            N + +     R D  G    +++    ++ +         +SPD + + FT+N      E
Sbjct  112  NNEIY-----RMDADGSNPTNLSNHPANDYL-------PAWSPDGKTIAFTSNRDSDNRE  159

Query  240  PVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  109
                         +Y+M +DG+ ++RLT N      P W P  +
Sbjct  160  -------------IYIMAIDGSNVRRLTHNDLFEEVPTWSPNGK  190


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 81/187 (43%), Gaps = 37/187 (20%)
 Frame = -1

Query  654  KETTGNNAF---PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGEL-----DGGGIRQLTDG  499
            +  T N+ F   P+ SP+GK IVF   R   + +  + + NGEL     DG   ++LT  
Sbjct  171  RRLTHNDLFEEVPTWSPNGKQIVF--TRQLEEMVDTVKTTNGELFVMDIDGKNEKRLTFR  228

Query  498  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  319
               D+   +SP+GK IAF    +   ++  F I+ +  DGT +  +     E        
Sbjct  229  EGYDSGGKFSPNGKKIAF----YGQDSSKNFEIFTMNADGTDVVNLTNDILEDYSP----  280

Query  318  RLNHVCFSPDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  139
                  +SPD +W+ +T+   G + +            D++++ L      RLT     N
Sbjct  281  -----DWSPDGKWIAYTS---GTSKQ-----------YDVWVIHLKSLKKFRLTTEPKRN  321

Query  138  GTPAWHP  118
             TP W P
Sbjct  322  ETPVWRP  328



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680