BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047G24

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57279.1|  alpha-expansin                                         453   6e-159   Ipomoea nil [qian niu]
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        398   2e-137   Nicotiana sylvestris
gb|AEQ55274.1|  expansin                                                397   4e-137   Breonia chinensis
gb|AAR82849.1|  expansin-1                                              397   5e-137   Petunia x hybrida [garden petunia]
gb|ACJ48968.2|  expansin                                                397   1e-136   Breonia chinensis
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        396   2e-136   Glycine max [soybeans]
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         396   2e-136   Jatropha curcas
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        395   3e-136   Nicotiana tomentosiformis
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        395   3e-136   Glycine max [soybeans]
gb|AEQ55290.1|  expansin                                                395   5e-136   Breonia chinensis
gb|KJB16930.1|  hypothetical protein B456_002G257400                    395   5e-136   Gossypium raimondii
gb|AEQ55275.1|  expansin                                                394   7e-136   Breonia chinensis
ref|NP_001234881.1|  expansin9 precursor                                393   2e-135   Solanum lycopersicum
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       394   2e-135   
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        394   2e-135   Nicotiana tomentosiformis
ref|XP_002298353.1|  alpha-expansin 1 family protein                    393   3e-135   Populus trichocarpa [western balsam poplar]
gb|KJB76740.1|  hypothetical protein B456_012G104400                    393   3e-135   Gossypium raimondii
emb|CDP09064.1|  unnamed protein product                                393   3e-135   Coffea canephora [robusta coffee]
gb|KHN17924.1|  Expansin-A3                                             394   5e-135   Glycine soja [wild soybean]
ref|NP_001234081.1|  expansin A4 precursor                              392   5e-135   Solanum lycopersicum
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       392   6e-135   Theobroma cacao [chocolate]
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               392   6e-135   Ricinus communis
gb|KHG12430.1|  Expansin-A4 -like protein                               392   6e-135   Gossypium arboreum [tree cotton]
gb|ADC35365.1|  alpha-expansin 2                                        392   7e-135   Coffea arabica [arabica coffee]
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             392   8e-135   Prunus persica
ref|XP_004249634.1|  PREDICTED: expansin-A3                             391   1e-134   
ref|XP_006341021.1|  PREDICTED: expansin-A3                             392   1e-134   Solanum tuberosum [potatoes]
ref|XP_011035307.1|  PREDICTED: expansin-A6                             391   1e-134   Populus euphratica
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        391   2e-134   Glycine max [soybeans]
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        391   2e-134   
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        391   2e-134   Nicotiana tomentosiformis
ref|XP_006366490.1|  PREDICTED: expansin-A6                             390   2e-134   Solanum tuberosum [potatoes]
gb|KHG30766.1|  Expansin-A4 -like protein                               391   2e-134   Gossypium arboreum [tree cotton]
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        392   2e-134   Nicotiana sylvestris
gb|ACN94264.1|  expansin                                                390   2e-134   Rehmannia glutinosa [Chinese foxglove]
ref|NP_001284471.1|  expansin-A4 precursor                              390   3e-134   Cucumis melo [Oriental melon]
ref|XP_008223717.1|  PREDICTED: expansin-A4                             390   3e-134   Prunus mume [ume]
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        390   4e-134   Cicer arietinum [garbanzo]
dbj|BAN09210.1|  alpha expansin                                         390   4e-134   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AAR82850.1|  expansin-2                                              390   4e-134   Petunia x hybrida [garden petunia]
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         390   4e-134   Jatropha curcas
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        390   4e-134   Nicotiana sylvestris
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        390   4e-134   Nicotiana sylvestris
emb|CBI16120.3|  unnamed protein product                                390   5e-134   Vitis vinifera
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             390   5e-134   Phaseolus vulgaris [French bean]
ref|XP_002283530.1|  PREDICTED: expansin-A4                             390   5e-134   Vitis vinifera
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         390   6e-134   Jatropha curcas
gb|AFZ78606.1|  expansin protein                                        390   6e-134   Populus tomentosa [Chinese white poplar]
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         389   7e-134   Rumex palustris
gb|AEU08407.1|  expansin 2                                              389   7e-134   Prunus salicina [Japanese plum]
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       389   8e-134   
ref|XP_003543517.1|  PREDICTED: expansin-A4                             389   8e-134   Glycine max [soybeans]
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        389   8e-134   Nicotiana sylvestris
ref|XP_003616412.1|  Expansin                                           389   9e-134   Medicago truncatula
gb|KJB46592.1|  hypothetical protein B456_007G376300                    389   1e-133   Gossypium raimondii
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        389   1e-133   Cucumis sativus [cucumbers]
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        389   1e-133   Prunus mume [ume]
ref|XP_010256907.1|  PREDICTED: expansin-A4                             389   1e-133   Nelumbo nucifera [Indian lotus]
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        389   1e-133   
ref|XP_003538409.1|  PREDICTED: expansin-A6                             389   1e-133   Glycine max [soybeans]
emb|CDP00110.1|  unnamed protein product                                389   1e-133   Coffea canephora [robusta coffee]
ref|XP_011089478.1|  PREDICTED: expansin-A6                             389   1e-133   Sesamum indicum [beniseed]
gb|AAR09168.1|  alpha-expansin 1                                        389   1e-133   Populus tremula x Populus tremuloides
ref|XP_002313434.1|  alpha-expansin 1 family protein                    389   1e-133   Populus trichocarpa [western balsam poplar]
ref|XP_010106493.1|  hypothetical protein L484_025251                   389   1e-133   Morus notabilis
gb|KJB55836.1|  hypothetical protein B456_009G098800                    389   2e-133   Gossypium raimondii
gb|AEE69071.1|  expansin-4                                              388   2e-133   Petunia hybrid cultivar [hybrid petunia]
ref|NP_001242978.1|  expansin-A4-like precursor                         388   2e-133   Glycine max [soybeans]
gb|ADY68814.1|  expansin                                                388   2e-133   Gossypium barbadense [Egyptian cotton]
gb|ACK36943.1|  expansin                                                388   2e-133   Annona cherimola [cherimoya]
gb|AHL25255.1|  expansin                                                388   2e-133   Boehmeria nivea [Chinese silk-plant]
gb|KHG20113.1|  Expansin-A4 -like protein                               388   3e-133   Gossypium arboreum [tree cotton]
ref|XP_008461679.1|  PREDICTED: expansin-A4                             388   3e-133   Cucumis melo [Oriental melon]
gb|AEN70914.1|  expansin                                                388   3e-133   Gossypium trilobum
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             388   3e-133   Prunus persica
ref|XP_004300427.1|  PREDICTED: expansin-A6                             388   3e-133   Fragaria vesca subsp. vesca
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         387   4e-133   Rumex palustris
gb|ACO07292.1|  expansin 10                                             387   4e-133   Cucumis sativus [cucumbers]
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        387   4e-133   Solanum tuberosum [potatoes]
ref|XP_009364387.1|  PREDICTED: expansin-A4                             387   4e-133   Pyrus x bretschneideri [bai li]
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        387   5e-133   Glycine max [soybeans]
gb|AFB77223.1|  expansin 1                                              387   5e-133   Betula platyphylla [Asian white birch]
gb|ADY68815.1|  expansin                                                387   5e-133   Gossypium barbadense [Egyptian cotton]
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        387   5e-133   Citrus sinensis [apfelsine]
gb|AAT11859.2|  expansin 1                                              387   5e-133   Mangifera indica
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         387   5e-133   Rumex palustris
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        387   5e-133   Cucumis sativus [cucumbers]
gb|AEN70893.1|  expansin                                                387   6e-133   Gossypium schwendimanii
ref|XP_008464122.1|  PREDICTED: expansin-A4                             387   6e-133   Cucumis melo [Oriental melon]
gb|ADY68817.1|  expansin                                                387   7e-133   Gossypium raimondii
gb|AEN70891.1|  expansin                                                387   7e-133   Gossypium thurberi
ref|XP_010264435.1|  PREDICTED: expansin-A4                             387   8e-133   Nelumbo nucifera [Indian lotus]
gb|KHG15821.1|  Expansin-A4 -like protein                               387   8e-133   Gossypium arboreum [tree cotton]
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             387   9e-133   Citrus clementina [clementine]
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             387   9e-133   Phaseolus vulgaris [French bean]
ref|XP_008384848.1|  PREDICTED: expansin-A4                             387   9e-133   Malus domestica [apple tree]
gb|AEN70901.1|  expansin                                                387   1e-132   Gossypium barbadense var. brasiliense
gb|KJB36710.1|  hypothetical protein B456_006G172400                    387   1e-132   Gossypium raimondii
gb|ABO32367.1|  expansin                                                386   1e-132   Litchi
gb|ADY68818.1|  expansin                                                386   1e-132   Gossypium hirsutum [American cotton]
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        386   1e-132   Elaeis guineensis
ref|NP_001233958.1|  expansin precursor                                 387   1e-132   Solanum lycopersicum
gb|AEN70907.1|  expansin                                                386   1e-132   Gossypium armourianum
ref|XP_003552173.1|  PREDICTED: expansin-A4                             386   1e-132   Glycine max [soybeans]
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        386   2e-132   Pyrus x bretschneideri [bai li]
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        386   2e-132   Populus euphratica
gb|AAK48848.1|AF350939_1  expansin                                      386   2e-132   Prunus cerasus [pie cherry]
ref|XP_002283358.1|  PREDICTED: expansin-A4                             386   2e-132   Vitis vinifera
ref|XP_006350774.1|  PREDICTED: expansin-A6                             386   2e-132   Solanum tuberosum [potatoes]
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        385   2e-132   Sesamum indicum [beniseed]
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        385   2e-132   Eucalyptus grandis [rose gum]
emb|CAN73252.1|  hypothetical protein VITISV_027049                     385   2e-132   Vitis vinifera
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        385   3e-132   Nicotiana tomentosiformis
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     385   3e-132   Eucalyptus grandis [rose gum]
ref|XP_010685747.1|  PREDICTED: expansin-A4                             385   3e-132   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        385   3e-132   Nicotiana tomentosiformis
ref|XP_010521846.1|  PREDICTED: expansin-A6                             385   3e-132   Tarenaya hassleriana [spider flower]
gb|AEN70900.1|  expansin                                                385   3e-132   Gossypium tomentosum
ref|XP_010528418.1|  PREDICTED: expansin-A3                             385   3e-132   Tarenaya hassleriana [spider flower]
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        385   4e-132   Pyrus x bretschneideri [bai li]
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        385   4e-132   Cicer arietinum [garbanzo]
gb|KJB78839.1|  hypothetical protein B456_013G022200                    385   4e-132   Gossypium raimondii
gb|AAL31480.1|AF319475_1  alpha-expansin 9 precursor                    384   4e-132   Cucumis sativus [cucumbers]
gb|AEN70895.1|  expansin                                                385   5e-132   Gossypium mustelinum
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        385   5e-132   Pyrus x bretschneideri [bai li]
ref|XP_010111457.1|  hypothetical protein L484_021280                   385   5e-132   Morus notabilis
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                385   5e-132   Erythranthe guttata [common monkey flower]
ref|NP_001234761.1|  expansin18 precursor                               385   5e-132   
gb|KJB73995.1|  hypothetical protein B456_011G266000                    384   7e-132   Gossypium raimondii
ref|NP_001288899.1|  expansin-A6 precursor                              384   8e-132   Brassica rapa
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             384   1e-131   Citrus clementina [clementine]
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        384   1e-131   Phoenix dactylifera
ref|XP_010067412.1|  PREDICTED: expansin-A4                             385   2e-131   Eucalyptus grandis [rose gum]
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        383   2e-131   Nicotiana sylvestris
ref|XP_010690765.1|  PREDICTED: expansin-A4                             383   2e-131   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        383   2e-131   Malus domestica [apple tree]
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             383   3e-131   Eutrema salsugineum [saltwater cress]
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      383   3e-131   Gossypium hirsutum [American cotton]
emb|CDY31742.1|  BnaA04g16780D                                          383   3e-131   Brassica napus [oilseed rape]
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        382   4e-131   Cicer arietinum [garbanzo]
emb|CDX77222.1|  BnaC04g40170D                                          382   4e-131   
ref|XP_008802710.1|  PREDICTED: expansin-A4                             382   4e-131   Phoenix dactylifera
ref|NP_181300.1|  expansin-A3                                           382   5e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011027216.1|  PREDICTED: expansin-A4                             382   5e-131   Populus euphratica
gb|KEH39447.1|  expansin A10                                            382   5e-131   Medicago truncatula
ref|XP_002266625.1|  PREDICTED: expansin-A6                             382   5e-131   Vitis vinifera
ref|XP_008357089.1|  PREDICTED: expansin-A6                             382   6e-131   
emb|CDP06606.1|  unnamed protein product                                382   6e-131   Coffea canephora [robusta coffee]
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        382   6e-131   Populus euphratica
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             382   7e-131   Phaseolus vulgaris [French bean]
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          382   7e-131   Populus trichocarpa [western balsam poplar]
gb|AEQ55271.1|  expansin                                                382   8e-131   Breonia chinensis
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          382   8e-131   
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        382   8e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             381   1e-130   Eutrema salsugineum [saltwater cress]
ref|XP_002881524.1|  ATEXPA3                                            381   1e-130   Arabidopsis lyrata subsp. lyrata
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        381   2e-130   Nicotiana tomentosiformis
gb|KHG29956.1|  Expansin-A4 -like protein                               380   2e-130   Gossypium arboreum [tree cotton]
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    380   2e-130   Arabis alpina [alpine rockcress]
ref|XP_009380637.1|  PREDICTED: expansin-A4                             380   2e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010517036.1|  PREDICTED: expansin-A3                             380   3e-130   Camelina sativa [gold-of-pleasure]
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        380   3e-130   Solanum lycopersicum
gb|KHG24991.1|  Expansin-A4 -like protein                               380   3e-130   Gossypium arboreum [tree cotton]
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                380   3e-130   Erythranthe guttata [common monkey flower]
gb|AIE54285.1|  expansin                                                380   3e-130   Nicotiana tabacum [American tobacco]
ref|XP_002881024.1|  ATEXPA6                                            380   4e-130   Arabidopsis lyrata subsp. lyrata
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        380   4e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        380   5e-130   Tarenaya hassleriana [spider flower]
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             380   5e-130   Citrus clementina [clementine]
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        379   6e-130   Citrus sinensis [apfelsine]
gb|ABK93541.1|  unknown                                                 379   6e-130   Populus trichocarpa [western balsam poplar]
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        379   7e-130   Phoenix dactylifera
ref|XP_010033123.1|  PREDICTED: expansin-A4                             379   7e-130   Eucalyptus grandis [rose gum]
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        379   7e-130   Pyrus x bretschneideri [bai li]
gb|ABO30976.2|  alpha expansin protein 1                                379   1e-129   Calotropis procera
emb|CAA59470.1|  orf                                                    379   1e-129   Pisum sativum [garden pea]
ref|XP_007132063.1|  hypothetical protein PHAVU_011G063800g             379   1e-129   Phaseolus vulgaris [French bean]
gb|KJB08889.1|  hypothetical protein B456_001G111100                    379   1e-129   Gossypium raimondii
gb|AAP48989.1|  expansin                                                378   1e-129   Sambucus nigra
ref|XP_003552064.1|  PREDICTED: expansin-A4                             379   1e-129   Glycine max [soybeans]
emb|CAA04385.1|  Expansin                                               378   2e-129   Brassica napus [oilseed rape]
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        378   3e-129   Solanum tuberosum [potatoes]
gb|AAV85475.1|  expansin                                                377   3e-129   Populus tomentosa [Chinese white poplar]
ref|XP_010937609.1|  PREDICTED: expansin-A4                             377   3e-129   Elaeis guineensis
ref|NP_001288852.1|  expansin-A3 precursor                              378   3e-129   Brassica rapa
dbj|BAC67194.1|  expansin                                               377   4e-129   Pyrus communis
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          377   4e-129   Amborella trichopoda
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        377   4e-129   
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             377   4e-129   Prunus persica
emb|CDY47883.1|  BnaA07g14280D                                          377   5e-129   Brassica napus [oilseed rape]
emb|CDX74942.1|  BnaA05g06880D                                          377   5e-129   
ref|XP_002309061.1|  expansin family protein                            377   5e-129   Populus trichocarpa [western balsam poplar]
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             377   6e-129   Eutrema salsugineum [saltwater cress]
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        377   6e-129   Cucumis melo [Oriental melon]
ref|XP_011019858.1|  PREDICTED: expansin-A6                             377   7e-129   Populus euphratica
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             377   8e-129   Capsella rubella
ref|XP_010534508.1|  PREDICTED: expansin-A4                             377   9e-129   Tarenaya hassleriana [spider flower]
ref|XP_010111142.1|  hypothetical protein L484_010756                   376   1e-128   Morus notabilis
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        376   1e-128   Malus domestica [apple tree]
gb|EPS64820.1|  hypothetical protein M569_09956                         376   1e-128   Genlisea aurea
gb|KFK36651.1|  alpha-expansin 4                                        376   1e-128   Arabis alpina [alpine rockcress]
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        376   2e-128   
emb|CDY07024.1|  BnaA04g22910D                                          375   2e-128   
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        375   2e-128   Phoenix dactylifera
gb|ACT67493.1|  expansin A1                                             375   2e-128   Raphanus sativus
gb|ACA05164.1|  expansin 1                                              375   3e-128   Dimocarpus longan [longan]
ref|XP_011094866.1|  PREDICTED: expansin-A6                             375   3e-128   Sesamum indicum [beniseed]
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        375   3e-128   Elaeis guineensis
emb|CDY20467.1|  BnaC04g05770D                                          375   4e-128   Brassica napus [oilseed rape]
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        375   4e-128   Brassica rapa
emb|CDY07642.1|  BnaA03g18690D                                          375   4e-128   Brassica napus [oilseed rape]
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             374   7e-128   Phaseolus vulgaris [French bean]
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    374   7e-128   
ref|XP_002878036.1|  ATEXPA16                                           374   9e-128   Arabidopsis lyrata subsp. lyrata
gb|EPS67093.1|  hypothetical protein M569_07682                         374   9e-128   Genlisea aurea
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          374   1e-127   Sorghum bicolor [broomcorn]
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        374   1e-127   Brassica rapa
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        373   1e-127   Brassica rapa
emb|CDY24952.1|  BnaC03g22200D                                          373   2e-127   Brassica napus [oilseed rape]
ref|XP_009388613.1|  PREDICTED: expansin-A7                             373   2e-127   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH22886.1|  expansin-A1-like protein                                373   2e-127   Medicago truncatula
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        373   2e-127   Tarenaya hassleriana [spider flower]
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    373   2e-127   Cucumis sativus [cucumbers]
ref|NP_001288961.1|  expansin-A4 precursor                              373   3e-127   Brassica rapa
dbj|BAC67193.1|  expansin                                               373   3e-127   Pyrus communis
dbj|BAH36862.1|  alpha expansin                                         372   3e-127   Rosa hybrid cultivar
emb|CDY69611.1|  BnaCnng64440D                                          372   3e-127   Brassica napus [oilseed rape]
ref|NP_181500.1|  expansin A4                                           372   3e-127   Arabidopsis thaliana [mouse-ear cress]
gb|KJB46593.1|  hypothetical protein B456_007G376300                    374   4e-127   Gossypium raimondii
ref|XP_002881669.1|  ATEXPA4                                            372   4e-127   
dbj|BAE06067.1|  expansin                                               372   4e-127   Sagittaria pygmaea
gb|AAQ08016.1|  expansin                                                372   5e-127   Melilotus albus
emb|CAH18933.1|  expansin                                               372   5e-127   Pyrus communis
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             372   5e-127   Phaseolus vulgaris [French bean]
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              372   5e-127   Triphysaria versicolor
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             372   6e-127   Capsella rubella
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        371   1e-126   Pyrus x bretschneideri [bai li]
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        371   1e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        371   2e-126   Setaria italica
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        370   2e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        370   3e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010554612.1|  PREDICTED: expansin-A4                             370   3e-126   Tarenaya hassleriana [spider flower]
ref|XP_010505648.1|  PREDICTED: expansin-A4                             370   3e-126   Camelina sativa [gold-of-pleasure]
ref|XP_004302749.1|  PREDICTED: expansin-A6                             370   5e-126   Fragaria vesca subsp. vesca
gb|ABN09939.1|  expansin A4                                             369   5e-126   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        369   6e-126   Camelina sativa [gold-of-pleasure]
gb|KHN30166.1|  Expansin-A4                                             370   1e-125   Glycine soja [wild soybean]
ref|NP_191109.1|  expansin A16                                          369   1e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        369   1e-125   Prunus mume [ume]
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        369   1e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        368   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_004505858.1|  PREDICTED: expansin-A6-like                        368   1e-125   Cicer arietinum [garbanzo]
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        368   2e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        368   2e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010558331.1|  PREDICTED: expansin-A9                             368   2e-125   Tarenaya hassleriana [spider flower]
ref|NP_001051731.1|  Os03g0822000                                       368   3e-125   
ref|NP_180461.1|  expansin A6                                           367   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288942.1|  expansin-A16 precursor                             367   3e-125   Brassica rapa
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             367   3e-125   Capsella rubella
ref|XP_010510558.1|  PREDICTED: expansin-A6                             367   4e-125   Camelina sativa [gold-of-pleasure]
ref|XP_004145295.1|  PREDICTED: expansin-A4-like                        367   4e-125   
gb|ABK24904.1|  unknown                                                 367   4e-125   Picea sitchensis
ref|XP_010516124.1|  PREDICTED: expansin-A16                            367   4e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        367   5e-125   Camelina sativa [gold-of-pleasure]
gb|KHN21950.1|  Expansin-A4                                             369   5e-125   Glycine soja [wild soybean]
ref|XP_006294844.1|  hypothetical protein CARUB_v10023895mg             366   9e-125   Capsella rubella
ref|XP_010490643.1|  PREDICTED: expansin-A9                             366   1e-124   Camelina sativa [gold-of-pleasure]
gb|ACF87150.1|  unknown                                                 366   1e-124   Zea mays [maize]
ref|NP_001150534.1|  alpha-expansin 6 precursor                         366   2e-124   
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    365   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       365   2e-124   Camelina sativa [gold-of-pleasure]
emb|CDY40233.1|  BnaA09g35150D                                          365   3e-124   Brassica napus [oilseed rape]
ref|NP_195846.1|  expansin A9                                           365   3e-124   Arabidopsis thaliana [mouse-ear cress]
gb|ABN09942.1|  expansin A5                                             364   3e-124   Musa acuminata AAA Group [Cavendish banana]
gb|AAM62987.1|  expansin AtEx6                                          364   4e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    364   4e-124   Arabis alpina [alpine rockcress]
gb|ABN09940.1|  expansin A5                                             364   6e-124   Musa acuminata AAA Group [Cavendish banana]
gb|KHN33378.1|  Expansin-A4                                             364   6e-124   Glycine soja [wild soybean]
gb|KJB08890.1|  hypothetical protein B456_001G111100                    365   8e-124   Gossypium raimondii
ref|NP_001236550.1|  expansin precursor                                 363   1e-123   
gb|ABM54492.1|  expansin 2                                              363   2e-123   
emb|CDY10456.1|  BnaCnng03570D                                          363   2e-123   
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    363   2e-123   
ref|XP_003563572.1|  PREDICTED: expansin-A7                             362   4e-123   
emb|CDX76090.1|  BnaA04g03540D                                          362   4e-123   
ref|XP_009122794.1|  PREDICTED: expansin-A9                             362   5e-123   
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        362   5e-123   
ref|XP_002870966.1|  ATEXPA9                                            362   5e-123   
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       362   5e-123   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       362   5e-123   
ref|XP_011077647.1|  PREDICTED: expansin-A6-like                        362   6e-123   
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             362   6e-123   
emb|CDX80810.1|  BnaC03g00640D                                          361   8e-123   
gb|AAS48878.1|  expansin EXPA9                                          361   2e-122   
emb|CDY02943.1|  BnaC04g25430D                                          360   2e-122   
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                360   3e-122   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             360   3e-122   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             360   3e-122   
ref|NP_001288956.1|  expansin-A9-like precursor                         359   5e-122   
emb|CDY04847.1|  BnaAnng00290D                                          359   5e-122   
emb|CDY48101.1|  BnaC02g03580D                                          359   5e-122   
ref|XP_008458865.1|  PREDICTED: expansin-A4                             359   9e-122   
emb|CDY41218.1|  BnaC08g26400D                                          359   9e-122   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        358   1e-121   
gb|AFK40565.1|  unknown                                                 357   2e-121   
gb|KEH30169.1|  expansin A10                                            357   4e-121   
gb|AFK44569.1|  unknown                                                 357   4e-121   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    355   2e-120   
gb|ACG46282.1|  alpha-expansin 6 precursor                              355   2e-120   
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       355   3e-120   
gb|ACF84785.1|  unknown                                                 353   1e-119   
gb|EPS68567.1|  hypothetical protein M569_06200                         351   8e-119   
dbj|BAD00017.1|  expansin                                               350   9e-119   
gb|KHN07218.1|  Expansin-A4                                             350   1e-118   
gb|ADD14635.1|  expansin precursor                                      343   2e-116   
gb|ADD14631.1|  expansin precursor                                      343   2e-116   
ref|NP_001267685.1|  expansin-A16-like                                  343   5e-116   
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        344   7e-116   
gb|ADD14630.1|  expansin precursor                                      340   3e-115   
gb|AAR10411.2|  EXP1                                                    340   5e-115   
gb|ABM66430.1|  expansin 3                                              340   9e-115   
gb|KHN32128.1|  Expansin-A4                                             338   2e-114   
gb|AEL88239.1|  expansin                                                338   4e-114   
gb|AEQ55268.1|  expansin                                                339   5e-114   
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        338   9e-114   
gb|AEV43315.1|  expansin A5                                             335   2e-113   
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        337   3e-113   
gb|ADD14636.1|  expansin precursor                                      335   4e-113   
ref|NP_001289251.1|  expansin-A4-like precursor                         336   5e-113   
gb|KHF98169.1|  Expansin-A4 -like protein                               334   6e-113   
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        336   7e-113   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             336   8e-113   
gb|AAL87023.1|  cell wall protein Exp4 precursor                        335   9e-113   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        335   2e-112   
gb|AEQ55270.1|  expansin                                                334   3e-112   
gb|AAL87021.1|  cell wall protein EXP2 precursor                        334   3e-112   
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               334   4e-112   
gb|AEQ55269.1|  expansin                                                333   5e-112   
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        333   6e-112   
emb|CDP04049.1|  unnamed protein product                                333   6e-112   
gb|AEQ55284.1|  expansin                                                333   6e-112   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             333   6e-112   
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   333   9e-112   
gb|ABO32366.1|  expansin                                                333   1e-111   
emb|CDP13911.1|  unnamed protein product                                332   1e-111   
gb|AAC33529.1|  expansin                                                333   1e-111   
gb|EYU19913.1|  hypothetical protein MIMGU_mgv1a012177mg                333   1e-111   
ref|NP_001275780.1|  expansin 2 precursor                               333   1e-111   
gb|KHN07565.1|  Expansin-A4                                             331   1e-111   
gb|AGU13763.1|  expansin                                                332   2e-111   
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        332   2e-111   
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             332   2e-111   
gb|AAG13982.1|AF297521_1  expansin 1                                    332   2e-111   
gb|AAB81662.1|  expansin                                                332   2e-111   
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             332   3e-111   
ref|NP_001055842.1|  Os05g0477600                                       331   3e-111   
ref|NP_001281040.1|  expansin-A4-like precursor                         332   4e-111   
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        332   4e-111   
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        331   4e-111   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        331   5e-111   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             331   6e-111   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        331   6e-111   
gb|ACX69842.1|  expansin                                                330   9e-111   
gb|ADN03964.1|  EXP1                                                    330   1e-110   
ref|NP_001276255.1|  expansin-A4-like precursor                         329   1e-110   
ref|XP_010103644.1|  hypothetical protein L484_011237                   330   1e-110   
gb|AEQ55272.1|  expansin                                                330   1e-110   
gb|AAZ08313.1|  putative alpha-expansin                                 328   1e-110   
gb|ADC35366.1|  alpha-expansin 3                                        330   1e-110   
gb|AFK34543.1|  unknown                                                 330   1e-110   
ref|XP_002323665.1|  expansin S1 precursor family protein               330   2e-110   
ref|XP_009384771.1|  PREDICTED: expansin-A2                             330   2e-110   
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        330   2e-110   
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       329   2e-110   
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             330   2e-110   
gb|AAF35900.1|AF230331_1  expansin 1                                    327   2e-110   
emb|CBI15823.3|  unnamed protein product                                328   2e-110   
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        329   3e-110   
ref|XP_010108480.1|  hypothetical protein L484_010673                   329   3e-110   
ref|XP_002276565.3|  PREDICTED: expansin-A4                             329   3e-110   
gb|ACM90161.1|  expansin 3                                              329   4e-110   
ref|XP_010678491.1|  PREDICTED: expansin-A10-like                       328   4e-110   
ref|XP_003613849.1|  Expansin                                           328   5e-110   
gb|ADC35364.1|  alpha-expansin 1                                        328   5e-110   
gb|AAR82851.1|  expansin-3                                              328   5e-110   
gb|AFK24458.1|  expansin 5                                              328   7e-110   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       328   7e-110   
ref|XP_003607738.1|  Expansin                                           329   7e-110   
gb|ACK43222.1|  expansin 2                                              328   8e-110   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             330   8e-110   
gb|ABB59694.1|  alpha-expansin 2                                        328   8e-110   
ref|XP_003519289.1|  PREDICTED: expansin-A8-like                        328   8e-110   
dbj|BAH36861.1|  alpha expansin                                         328   8e-110   
gb|KHG27586.1|  Expansin-A8 -like protein                               328   9e-110   
ref|XP_009399910.1|  PREDICTED: expansin-A2-like                        328   1e-109   
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         328   1e-109   
gb|AJR32958.1|  expansin                                                328   1e-109   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             328   1e-109   
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        328   1e-109   
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        328   1e-109   
gb|AFK24457.1|  expansin 4                                              328   1e-109   
ref|XP_004294733.1|  PREDICTED: expansin-A4-like                        327   1e-109   
gb|KHN40987.1|  Expansin-A8                                             327   1e-109   
gb|ACA05166.1|  expansin 3                                              327   2e-109   
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       327   2e-109   
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        327   2e-109   
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  327   2e-109   
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        327   2e-109   
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  327   3e-109   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               327   3e-109   
ref|XP_009399909.1|  PREDICTED: expansin-A2-like                        328   3e-109   
gb|ABM66452.1|  expansin                                                326   4e-109   
gb|AAM08930.1|  expansin 1                                              326   4e-109   
gb|ABF48653.1|  expansin precursor                                      327   4e-109   
gb|EYU46016.1|  hypothetical protein MIMGU_mgv1a012336mg                326   4e-109   
gb|KJB74926.1|  hypothetical protein B456_012G014400                    326   4e-109   
gb|ABC55453.1|  expansin protein                                        326   4e-109   
ref|XP_003568245.1|  PREDICTED: expansin-A4                             326   5e-109   
gb|AEE69072.1|  expansin-5                                              326   6e-109   
gb|ACK87022.1|  expansin                                                326   6e-109   
gb|ACJ70084.1|  expansin                                                326   6e-109   
gb|AHL25254.1|  expansin                                                325   7e-109   
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          325   9e-109   
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             325   9e-109   
ref|XP_007209512.1|  hypothetical protein PRUPE_ppa010443mg             325   1e-108   
gb|ACI02326.1|  expansion-related protein                               325   1e-108   
gb|ACK43884.1|  expansin                                                325   1e-108   
ref|XP_010253098.1|  PREDICTED: expansin-A8-like                        325   1e-108   
gb|AAL87025.1|  cell wall protein Exp1 precursor                        325   1e-108   
ref|XP_010670609.1|  PREDICTED: expansin-A4                             325   1e-108   
ref|XP_002887242.1|  ATEXPA1                                            325   2e-108   
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         325   2e-108   
ref|NP_001240113.1|  expansin precursor                                 325   2e-108   
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        324   2e-108   
ref|XP_008239926.1|  PREDICTED: expansin-A1-like                        324   2e-108   
ref|NP_001265970.1|  expansin-A8-like precursor                         325   2e-108   
gb|AAL01624.1|  expansin                                                322   2e-108   
ref|XP_002325925.2|  alpha-expansin 8 precursor family protein          324   2e-108   
gb|AFZ78603.1|  expansin protein                                        324   2e-108   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             324   3e-108   
ref|XP_011011315.1|  PREDICTED: expansin-A8-like                        324   3e-108   
ref|NP_001105040.1|  alpha expansin1 precursor                          324   3e-108   
gb|AEN70881.1|  alpha-expansin 1                                        324   3e-108   
ref|XP_002522457.1|  Alpha-expansin 1 precursor, putative               324   3e-108   
dbj|BAJ10398.1|  alpha-expansin                                         324   3e-108   
ref|XP_004970396.1|  PREDICTED: expansin-A2-like                        323   4e-108   
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             323   4e-108   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             323   5e-108   
gb|ACD37706.1|  alpha expansin                                          324   5e-108   
gb|AGF90536.1|  expansin 2                                              323   5e-108   
ref|XP_011080662.1|  PREDICTED: expansin-A4-like                        323   6e-108   
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        323   6e-108   
ref|XP_009404081.1|  PREDICTED: expansin-A15                            323   6e-108   
ref|XP_010108685.1|  hypothetical protein L484_015671                   323   6e-108   
gb|ADY68810.1|  alpha-expansin 1                                        323   6e-108   
gb|ABD48785.1|  alpha-expansin 1                                        323   7e-108   
ref|XP_002532867.1|  Alpha-expansin 8 precursor, putative               323   7e-108   
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              323   7e-108   
ref|NP_001267550.1|  expansin-A8-like precursor                         323   8e-108   
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        323   1e-107   
gb|AAF35901.1|AF230332_1  expansin 2                                    322   1e-107   
ref|NP_001240136.1|  expansin-A1-like precursor                         323   1e-107   
dbj|BAJ10397.1|  alpha-expansin                                         323   1e-107   
gb|AEN70871.1|  alpha-expansin 1                                        323   1e-107   
gb|AEN70883.1|  alpha-expansin 1                                        323   1e-107   
gb|KDP41217.1|  hypothetical protein JCGZ_15624                         322   1e-107   
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        322   1e-107   
gb|AEQ55281.1|  expansin                                                322   1e-107   
ref|XP_004961745.1|  PREDICTED: expansin-A4-like                        322   1e-107   
gb|KEH35550.1|  expansin A10                                            322   1e-107   
gb|AEQ28765.1|  expansin 3                                              322   1e-107   
gb|AEN70869.1|  alpha-expansin 1                                        323   1e-107   
gb|KEH35551.1|  expansin A10                                            322   1e-107   
ref|NP_001266033.1|  expansin-A15-like precursor                        322   2e-107   
gb|KHG29916.1|  Expansin-A8 -like protein                               322   2e-107   
gb|KJB73009.1|  hypothetical protein B456_011G209100                    322   2e-107   
gb|AHL25252.1|  expansin                                                322   2e-107   
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        322   2e-107   
gb|KHG02505.1|  Expansin-A2                                             322   2e-107   
gb|KHG01029.1|  Expansin-A15 -like protein                              322   2e-107   
ref|XP_008808309.1|  PREDICTED: expansin-A2-like                        322   2e-107   
ref|NP_001117573.1|  expansin A1                                        323   2e-107   
gb|AEN70887.1|  alpha-expansin 1                                        322   2e-107   
gb|AAY43797.1|  expansin                                                322   2e-107   
ref|XP_011076589.1|  PREDICTED: expansin-A4-like                        322   2e-107   
gb|AAG13983.1|AF297522_1  expansin 2                                    322   2e-107   
gb|AEN70875.1|  alpha-expansin 1                                        322   2e-107   
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             322   2e-107   
ref|XP_004297292.1|  PREDICTED: expansin-A1                             322   2e-107   
gb|AEN70867.1|  alpha-expansin 1                                        322   2e-107   
ref|NP_849869.1|  expansin A1                                           323   2e-107   
gb|AEN70868.1|  alpha-expansin 1                                        322   3e-107   
ref|XP_008446373.1|  PREDICTED: expansin-A1                             322   3e-107   
ref|XP_002441263.1|  hypothetical protein SORBIDRAFT_09g023440          322   3e-107   
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         321   3e-107   
ref|XP_010066900.1|  PREDICTED: expansin-A1                             322   3e-107   
ref|NP_177112.1|  expansin A1                                           321   3e-107   
ref|XP_010525408.1|  PREDICTED: expansin-A8                             322   3e-107   
gb|AEN70885.1|  alpha-expansin 1                                        322   3e-107   
gb|AAM46997.1|AF512539_1  alpha-expansin precursor                      322   4e-107   



>dbj|BAO57279.1| alpha-expansin [Ipomoea nil]
Length=257

 Score =   453 bits (1165),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 220/222 (99%), Positives = 220/222 (99%), Gaps = 0/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC
Sbjct  22   RIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  81

Query  497  GACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI  318
            GACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI
Sbjct  82   GACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI  141

Query  317  AAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWI  138
            AAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWI
Sbjct  142  AAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWI  201

Query  137  TLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            TLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN
Sbjct  202  TLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  243



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   398 bits (1023),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/231 (83%), Positives = 211/231 (91%), Gaps = 5/231 (2%)
 Frame = -2

Query  689  LFML----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            LF+L      PGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTA
Sbjct  16   LFLLTVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTA  75

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNGLSCGACFEIKC N  + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFD
Sbjct  76   LFNNGLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFD  135

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K++
Sbjct  136  LAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKLM  195

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT WIT+SRNWGQNW+T++ LVGQ+LSFRV ASDRR+ TSWN+APA+
Sbjct  196  VKGSRTGWITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTSWNIAPAH  246



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   397 bits (1021),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 210/230 (91%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L+L+     PGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN  ALSTAL
Sbjct  13   LALVAEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTGALSTAL  72

Query  518  FNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FN+GLSCGACFE+KC+ND   C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDL
Sbjct  73   FNSGLSCGACFELKCANDPGWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDL  132

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI +V V
Sbjct  133  AMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVRVFV  192

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGSRT WI++SRNWGQNW+T++ LVGQSLSFRV ASDRR  TSWN+ PA+
Sbjct  193  KGSRTGWISMSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTSWNMVPAH  242



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   397 bits (1021),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 209/234 (89%), Gaps = 5/234 (2%)
 Frame = -2

Query  698  LSLLFML----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAAL  531
            L LL +L      PGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN AL
Sbjct  13   LVLLMLLTVEARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGAL  72

Query  530  STALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRP  354
            STALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRP
Sbjct  73   STALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRP  132

Query  353  HFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQ  174
            HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI 
Sbjct  133  HFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIV  192

Query  173  KVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +V VKGS+T WITLSRNWGQNW+T+A L GQSLSFRV ASDRR  TSWN+APA+
Sbjct  193  RVRVKGSKTNWITLSRNWGQNWQTNAVLTGQSLSFRVTASDRRSSTSWNIAPAH  246



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   397 bits (1019),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 210/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            LSLL  L     PGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  12   LSLLLTLAEARIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  71

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFE+KC++D + C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPH
Sbjct  72   TALFNNGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRPH  131

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+TNVAGAGDI +
Sbjct  132  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLITNVAGAGDIVQ  191

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
              VKGSRT WI+LSRNWGQNW+T++ L GQSLSFRVRASDRR  TSWN+ P+N
Sbjct  192  AWVKGSRTGWISLSRNWGQNWQTNSVLAGQSLSFRVRASDRRSSTSWNIVPSN  244



>ref|XP_003544219.1| PREDICTED: expansin-A6-like [Glycine max]
Length=260

 Score =   396 bits (1017),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/232 (81%), Positives = 211/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            ++LL   E   PGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  15   ITLLASTEARVPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI + 
Sbjct  135  DLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGDIVRT  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PAN
Sbjct  195  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPAN  246



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   396 bits (1017),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 185/223 (83%), Positives = 209/223 (94%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D + C+PG+PSIF+TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCADDPKWCNPGSPSIFITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPVNFRRIPCRKQGGIRFT+NGFRYFNLVLV+NVAGAGDI KV +KGS+T W
Sbjct  142  IAEYRAGIVPVNFRRIPCRKQGGIRFTINGFRYFNLVLVSNVAGAGDIVKVSIKGSKTDW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+APAN
Sbjct  202  LSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPAN  244



>ref|XP_009613959.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   395 bits (1016),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 207/223 (93%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC
Sbjct  24   RIPGVYTGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC N  + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K++VKGSR+ W
Sbjct  144  IAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDILKLMVKGSRSGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            IT+SRNWGQNW+T++ LVGQ+LSFRV ASDRR+ TSWN+APA+
Sbjct  204  ITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTSWNIAPAH  246



>ref|XP_003519349.1| PREDICTED: expansin-A4-like [Glycine max]
Length=257

 Score =   395 bits (1015),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 205/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG YSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  21   RIPGAYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  80

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND S C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  81   GACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLK  140

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI K  VKGS+T W
Sbjct  141  IAQYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGDIVKTSVKGSKTGW  200

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PAN
Sbjct  201  MSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNLVPAN  243



>gb|AEQ55290.1| expansin [Breonia chinensis]
Length=259

 Score =   395 bits (1014),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 207/228 (91%), Gaps = 1/228 (0%)
 Frame = -2

Query  692  LLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  513
            L+     PGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   LVAEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  512  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  336
            +GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  78   SGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAM  137

Query  335  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  156
            PMFLKIA YRAGIVPV +RR+PCRKQGG RFT+NGFRYFNLVLVTNVAGAGDI +V VKG
Sbjct  138  PMFLKIAEYRAGIVPVTYRRVPCRKQGGTRFTINGFRYFNLVLVTNVAGAGDIVRVFVKG  197

Query  155  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            SRT WI+LSRNWGQNW+T++ LVGQSLSFRV ASDRR  TSWN+ PA+
Sbjct  198  SRTGWISLSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTSWNIVPAH  245



>gb|KJB16930.1| hypothetical protein B456_002G257400 [Gossypium raimondii]
Length=264

 Score =   395 bits (1015),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 207/228 (91%), Gaps = 1/228 (0%)
 Frame = -2

Query  692  LLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  513
            +L     PGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  23   VLVNARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  82

Query  512  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  336
            NGLSCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALP+DNGGWCNPPRPHFDLAM
Sbjct  83   NGLSCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPSDNGGWCNPPRPHFDLAM  142

Query  335  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  156
            PMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV +KG
Sbjct  143  PMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSIKG  202

Query  155  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + T W ++SRNWGQNW+++  LVGQ+LSFRV+ SD+R  TSWNVAP N
Sbjct  203  TNTGWTSMSRNWGQNWQSNVILVGQALSFRVKGSDKRTSTSWNVAPTN  250



>gb|AEQ55275.1| expansin [Breonia chinensis]
Length=259

 Score =   394 bits (1013),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 207/228 (91%), Gaps = 1/228 (0%)
 Frame = -2

Query  692  LLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  513
            L+     PGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  18   LVAEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  77

Query  512  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  336
            +GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAM
Sbjct  78   SGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAM  137

Query  335  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  156
            PMFLKIA YRAGIVPV +RR+PCRKQGG RFT+NGFRYFNLVLVTNVAGAGDI +V VKG
Sbjct  138  PMFLKIAEYRAGIVPVTYRRVPCRKQGGTRFTINGFRYFNLVLVTNVAGAGDIVRVFVKG  197

Query  155  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            SRT WI+LSRNWGQNW+T++ LVGQSLSFRV ASDRR  TSWN+ PA+
Sbjct  198  SRTGWISLSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTSWNIVPAH  245



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   393 bits (1010),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/232 (81%), Positives = 210/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            L +L  +E   PGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST
Sbjct  12   LVILVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALST  71

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPPR HF
Sbjct  72   ALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRTHF  131

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGF YFNL+LVTNVAGAGDI KV
Sbjct  132  DLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFSYFNLILVTNVAGAGDITKV  191

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +VKG+RT WITLSRNWGQNW+T++ LVGQSLSFRV ASD+R+ TSWN+AP++
Sbjct  192  MVKGTRTNWITLSRNWGQNWQTNSVLVGQSLSFRVTASDKRKSTSWNIAPSH  243



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   394 bits (1011),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 185/230 (80%), Positives = 209/230 (91%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
             S++     PGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  20   FSVVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  79

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNGLSCGACFEIKC+ND R C PG+PSIFVTATNFCPPN+ALP+DNGGWCNPPR HFDL
Sbjct  80   FNNGLSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNYALPSDNGGWCNPPRSHFDL  139

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV V
Sbjct  140  AMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSV  199

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KG++T W+++SRNWGQNW+++A LVGQ+LSFRV  SD+R  TSWNVA AN
Sbjct  200  KGTKTGWLSMSRNWGQNWQSNAVLVGQALSFRVTGSDKRTSTSWNVASAN  249



>ref|XP_009607348.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=293

 Score =   394 bits (1013),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 204/222 (92%), Gaps = 0/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            +  G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFNNGLSC
Sbjct  23   KISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNNGLSC  82

Query  497  GACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI  318
            GACFE+KC++ + C+PGNPSI VTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI
Sbjct  83   GACFELKCTDQKWCTPGNPSILVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI  142

Query  317  AAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWI  138
            A YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDIQKV VKG++T WI
Sbjct  143  AEYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIQKVYVKGTKTNWI  202

Query  137  TLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             ++RNWGQNW+T+A LVGQ+LSFRV ASD+R   S+++APAN
Sbjct  203  AMNRNWGQNWQTNALLVGQALSFRVTASDKRSSASYDIAPAN  244



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   393 bits (1010),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 213/232 (92%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S L+M E   PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  17   MSSLWMAEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALST  76

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGL+CG+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHF
Sbjct  77   ALFNNGLTCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHF  136

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  137  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQV  196

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TSWN+APA+
Sbjct  197  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIAPAH  248



>gb|KJB76740.1| hypothetical protein B456_012G104400 [Gossypium raimondii]
Length=264

 Score =   393 bits (1010),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 206/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  28   RIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  87

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  88   GACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  147

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            +A YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKG+ T W
Sbjct  148  MAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGTNTGW  207

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ LSFRV  SDRR  TSWN+APAN
Sbjct  208  LSMSRNWGQNWQSNAVLVGQQLSFRVTGSDRRTSTSWNMAPAN  250



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   393 bits (1009),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/234 (81%), Positives = 211/234 (90%), Gaps = 5/234 (2%)
 Frame = -2

Query  698  LSLLFML----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAAL  531
            L+L FML      PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AAL
Sbjct  13   LALAFMLGAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  72

Query  530  STALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRP  354
            STALF++GLSCGACFEIKC++D   C PG+PSIFVTATNFCPPN+ALPNDNGGWCNPPRP
Sbjct  73   STALFSSGLSCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNYALPNDNGGWCNPPRP  132

Query  353  HFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQ  174
            HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAG+I 
Sbjct  133  HFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGNIV  192

Query  173  KVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +V VKGSRT WI++SRNWGQNW+T+  LVGQSLSFRV ASDRR  TSWN+APA+
Sbjct  193  RVSVKGSRTGWISMSRNWGQNWQTNGNLVGQSLSFRVAASDRRSSTSWNIAPAH  246



>gb|KHN17924.1| Expansin-A3 [Glycine soja]
Length=307

 Score =   394 bits (1013),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 185/235 (79%), Positives = 212/235 (90%), Gaps = 6/235 (3%)
 Frame = -2

Query  698  LSLLFML-----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            +SLL ++     + PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AA
Sbjct  10   VSLLLLIIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  533  LSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPR  357
            LSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+ALP+DNGGWCNPPR
Sbjct  70   LSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSDNGGWCNPPR  129

Query  356  PHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDI  177
            PHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GG+RFT+NGFRYFNLVL+TNVAGAGDI
Sbjct  130  PHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVLITNVAGAGDI  189

Query  176  QKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             +  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PAN
Sbjct  190  MRASVKGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPAN  244



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   392 bits (1008),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 185/223 (83%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFNNGLSC
Sbjct  27   RIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNNGLSC  86

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC ND + C PGNPSIFVTATNFCPPNFALPND+GGWCNPPRPHFDLAMPMFLK
Sbjct  87   GACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCNPPRPHFDLAMPMFLK  146

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNL+LVTNVAGAGDIQKVL+KG+ T W
Sbjct  147  IGLYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLLLVTNVAGAGDIQKVLIKGTNTQW  206

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I +SRNWGQNW+T++ LVGQ+LS RV+ASD R VT+ NVAP+N
Sbjct  207  IAMSRNWGQNWQTNSPLVGQALSIRVKASDHRSVTNVNVAPSN  249



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   392 bits (1007),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 187/232 (81%), Positives = 209/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S ++M E   PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  13   ISSMWMAEAKIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  72

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND + C  G PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  73   ALFNNGLSCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNYALPNDNGGWCNPPRPHF  132

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV
Sbjct  133  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKV  192

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV   DRR  TSWN+ PAN
Sbjct  193  SVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTSTSWNIVPAN  244



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   392 bits (1007),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 208/234 (89%), Gaps = 7/234 (3%)
 Frame = -2

Query  692  LLFML------EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAAL  531
            LL ML        PGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AAL
Sbjct  12   LLVMLMGASEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  71

Query  530  STALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRP  354
            STALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPNFALPNDNGGWCNPPRP
Sbjct  72   STALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFALPNDNGGWCNPPRP  131

Query  353  HFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQ  174
            HFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI 
Sbjct  132  HFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIV  191

Query  173  KVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  192  KVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAN  245



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   392 bits (1008),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 206/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTA+FNNGLSC
Sbjct  28   RIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAIFNNGLSC  87

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  88   GACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  147

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAG+I KV VKG+ T W
Sbjct  148  IAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGNIVKVSVKGTNTGW  207

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ LSFRV  SDRR  TSWNVAPAN
Sbjct  208  LSMSRNWGQNWQSNAVLVGQQLSFRVTGSDRRTSTSWNVAPAN  250



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   392 bits (1007),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            LSLL  L     PGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  12   LSLLLTLTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  71

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPPRPH
Sbjct  72   TALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRPH  131

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFL+IA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+TNVAGAGDI +
Sbjct  132  FDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLITNVAGAGDIVQ  191

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
              VKGS+T WITLSRNWGQNW+T+A L GQSLSFRVRASDRR  TSWN+APAN
Sbjct  192  ASVKGSKTGWITLSRNWGQNWQTNAVLAGQSLSFRVRASDRRSSTSWNIAPAN  244



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   392 bits (1006),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 212/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL+++ E   PGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  15   ISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TSWNV PAN
Sbjct  195  SVKGSKTSWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNVVPAN  246



>ref|XP_004249634.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
Length=259

 Score =   391 bits (1005),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 185/224 (83%), Positives = 205/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            +  GVY+GG W +AHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC
Sbjct  22   KIAGVYTGGPWTSAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  81

Query  497  GACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  324
            GACFEIKC++ +   C+PGNPSI VT TNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMFL
Sbjct  82   GACFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFL  141

Query  323  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  144
            KIA YRAGIV VN+RR+PCRKQGGIRFTVNGF+YFNLVLVTNVAGAGDIQKV VKG+ TP
Sbjct  142  KIAVYRAGIVAVNYRRVPCRKQGGIRFTVNGFQYFNLVLVTNVAGAGDIQKVYVKGTNTP  201

Query  143  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            WI+++RNWGQNW+T+A LVGQ+LSFRV ASDRR   S+N+APAN
Sbjct  202  WISMTRNWGQNWQTNAKLVGQALSFRVTASDRRSSASYNIAPAN  245



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   392 bits (1006),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFNNGLSC
Sbjct  27   RIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNNGLSC  86

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC ND + C PGNPSIFVTATNFCPPNFALPND+GGWCNPPRPHFDLAMPMFLK
Sbjct  87   GACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCNPPRPHFDLAMPMFLK  146

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNL+LVTNVAGAGDIQKVL+KG+ T W
Sbjct  147  IGLYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLLLVTNVAGAGDIQKVLIKGTNTQW  206

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I +SRNWGQNW+T++ LVGQ+LS RV+ASD R VT+ NVAP+N
Sbjct  207  IAMSRNWGQNWQTNSPLVGQALSIRVKASDHRSVTNVNVAPSN  249



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   391 bits (1005),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 212/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S L+M E   PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  17   MSSLWMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALST  76

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHF
Sbjct  77   ALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHF  136

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  137  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQV  196

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TSWN+ PA+
Sbjct  197  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIVPAH  248



>ref|XP_003547326.1| PREDICTED: expansin-A4-like [Glycine max]
Length=256

 Score =   391 bits (1004),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 208/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL++M+E   PGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  11   MSLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  70

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  71   ALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHF  130

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+NGFRYFNLVL++NVAGAGDI   
Sbjct  131  DLAMPMFLKIAEYRAGIVPVAYRRVACRKHGGIRFTINGFRYFNLVLISNVAGAGDIVHA  190

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGSRT WI +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TSWN+ P N
Sbjct  191  YVKGSRTGWIAMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSWNIVPPN  242



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   391 bits (1004),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMFLK
Sbjct  83   GACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV VKGS T W
Sbjct  143  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKGSNTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TSWNVAP+N
Sbjct  203  MSMSRNWGQNWQSNAVLVGQTLSFRLTGSDRRTSTSWNVAPSN  245



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   391 bits (1004),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/232 (81%), Positives = 209/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            L L+  +E   PGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALST
Sbjct  15   LMLVVAVESRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALST  74

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPR HF
Sbjct  75   ALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRSHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T WIT+SRNWGQN++T++ L+GQSLSFRV ASDRR  TSWN+APA+
Sbjct  195  YVKGSKTNWITMSRNWGQNYQTNSVLIGQSLSFRVTASDRRSSTSWNIAPAH  246



>ref|XP_006366490.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=257

 Score =   390 bits (1003),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/223 (83%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC
Sbjct  21   RIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  80

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC N  + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMFLK
Sbjct  81   GACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLK  140

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+ CRKQGGIRFT+NGF YFNLVLVTNVAGAGDI KV+VKG+RT W
Sbjct  141  IAEYRAGIVPVVYRRVSCRKQGGIRFTINGFSYFNLVLVTNVAGAGDITKVMVKGTRTNW  200

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            ITLSRNWGQNW+T++ LVGQSLSFRV ASD+R+ TSWN+AP++
Sbjct  201  ITLSRNWGQNWQTNSVLVGQSLSFRVTASDKRKSTSWNIAPSH  243



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   391 bits (1004),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 207/223 (93%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGV+S G+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  26   RIPGVFSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  85

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PG+PSIFVTATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  86   GACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLK  145

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRKQGGIRFTVNGFRYFNLVL+TNVAGAGDI KV +KG++T W
Sbjct  146  IAEYRAGIVPVSFRRVPCRKQGGIRFTVNGFRYFNLVLITNVAGAGDIVKVSIKGTKTGW  205

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A L+GQ+LSFRV  SD+R  TSWNVAP+N
Sbjct  206  MSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTSWNVAPSN  248



>ref|XP_009787901.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=293

 Score =   392 bits (1007),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 203/222 (91%), Gaps = 0/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            +  G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFNNGLSC
Sbjct  23   KISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNNGLSC  82

Query  497  GACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI  318
            GACFE+KC++ + C+PGNPSI VTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMFLKI
Sbjct  83   GACFELKCTDQKWCTPGNPSILVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLKI  142

Query  317  AAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWI  138
            A YRAGIVPVN+RR+PCRKQGGIRFTVNGF YFNLVLVTNVAGAGDIQKV VKG++T WI
Sbjct  143  AEYRAGIVPVNYRRVPCRKQGGIRFTVNGFNYFNLVLVTNVAGAGDIQKVYVKGTKTNWI  202

Query  137  TLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             ++RNWGQNW+T+A LVGQ+LSFRV ASDRR   S+++APAN
Sbjct  203  AMNRNWGQNWQTNALLVGQALSFRVTASDRRSSASYDIAPAN  244



>gb|ACN94264.1| expansin [Rehmannia glutinosa]
 gb|ACN94265.1| expansin [Rehmannia glutinosa]
Length=260

 Score =   390 bits (1003),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/223 (83%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG Y GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  24   RIPGNYGGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  83

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND+  C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMFLK
Sbjct  84   GACFEIKCANDKQWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPVNFRR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV +KGSRT W
Sbjct  144  IAEYRAGIVPVNFRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSIKGSRTGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +T+SRNWGQNW++++ L+GQSLSFRV  SDRR  TSWN+AP+N
Sbjct  204  MTMSRNWGQNWQSNSVLIGQSLSFRVTGSDRRTSTSWNIAPSN  246



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   390 bits (1003),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMFLK
Sbjct  83   GACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKGS T W
Sbjct  143  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGSNTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAP+N
Sbjct  203  MSMSRNWGQNWQSNAVLVGQTLSFRVTGSDRRTSTSWNVAPSN  245



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   390 bits (1003),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 212/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL+++ E   PGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  15   ISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TSWNV PAN
Sbjct  195  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNVVPAN  246



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   390 bits (1002),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 208/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL ++ E   PG Y+GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  12   MSLTWLAESRIPGNYNGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  71

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFN GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  72   ALFNKGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHF  131

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV FRR+PCRKQGGIRFTVNGFRYFNLVL++NVAGAGDI + 
Sbjct  132  DLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTVNGFRYFNLVLISNVAGAGDIVRT  191

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKG+RT W+ +SRNWGQNW+++A LVGQSLSFRV +SDRR  TSWN+AP N
Sbjct  192  YVKGTRTRWMPMSRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPHN  243



>dbj|BAN09210.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=262

 Score =   390 bits (1002),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 203/225 (90%), Gaps = 3/225 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  24   RIPGVYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  83

Query  497  GACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  327
            GACFEIKC ND   R C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  84   GACFEIKCINDPNWRWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  143

Query  326  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  147
            L +A YRAGIVPV +RR+PCRK GG+RFT+NGFRYFNLVL+TNVAGAGDI +  VKGSRT
Sbjct  144  LNLAQYRAGIVPVTYRRVPCRKHGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKGSRT  203

Query  146  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             WI+LSRNWGQNW+T+  L+GQSLSFRV ASDRR  TSWN+AP+N
Sbjct  204  NWISLSRNWGQNWQTNGVLIGQSLSFRVTASDRRTSTSWNIAPSN  248



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   390 bits (1002),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 209/237 (88%), Gaps = 8/237 (3%)
 Frame = -2

Query  698  LSLLFMLEF-----PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            L+LLF++       PGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AA
Sbjct  12   LALLFLISLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  71

Query  533  LSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNP  363
            LSTALFNNGLSCGACFE+KC+ND   + C PGNPSI +TATNFCPPN+A PNDNGGWCNP
Sbjct  72   LSTALFNNGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNYAKPNDNGGWCNP  131

Query  362  PRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAG  183
            PR HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVL+ NVAGAG
Sbjct  132  PRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTMNGFRYFNLVLIPNVAGAG  191

Query  182  DIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            DI KV VKG++T WI LSRNWGQNW+T++ L GQSLSFRV+ASD R  TSWN+AP++
Sbjct  192  DIIKVWVKGTKTNWIPLSRNWGQNWQTNSILTGQSLSFRVKASDHRTSTSWNIAPSH  248



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   390 bits (1002),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 210/233 (90%), Gaps = 6/233 (3%)
 Frame = -2

Query  692  LLFMLEF-----PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            LL +L+      PGVYSGG+W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  12   LLLVLKLADARIPGVYSGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  71

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPH
Sbjct  72   TALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPH  131

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K
Sbjct  132  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVK  191

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
              VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  192  ASVKGSKTGWMSLSRNWGQNWQSNAILVGQSLSFRVTGSDRRTSTSWNIVPAN  244



>ref|XP_009768238.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=257

 Score =   390 bits (1001),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 184/221 (83%), Positives = 202/221 (91%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALSTALFNNGLSC
Sbjct  21   RIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALSTALFNNGLSC  80

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC  D +SC  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  81   GACFEIKCDKDPQSCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  140

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVLV NVAGAGDI +V VKGS+T W
Sbjct  141  IAEYRAGIVPVVYRRVPCRKKGGIRFTINGFRYFNLVLVANVAGAGDIVRVYVKGSKTNW  200

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            IT+SRNWGQN++T++ L+GQSLSFRV ASDRR   SWN+AP
Sbjct  201  ITMSRNWGQNYQTNSVLIGQSLSFRVTASDRRSSASWNIAP  241



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   390 bits (1001),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 185/223 (83%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFNNGLSC
Sbjct  23   KIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC +D + C PGNPSIFVTATNFCPPNFALPND+GGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFEIKCVDDGKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNL+LVTNVAGAGDIQKVL+KG+ T W
Sbjct  143  IGQYRAGIVPVTYRRVPCRKAGGIRFTINGFRYFNLLLVTNVAGAGDIQKVLIKGTNTQW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I +SRNWGQNW+T+A LVGQ+LS RV+ASD R VTS NVAP N
Sbjct  203  IAMSRNWGQNWQTNAVLVGQALSIRVKASDHRSVTSTNVAPPN  245



>emb|CBI16120.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   390 bits (1003),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -2

Query  689  LFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  510
            L   + PG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  18   LVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  77

Query  509  GLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  333
            GLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  78   GLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  137

Query  332  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  153
            MFLKIA YRAGIVPV FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +  VKGS
Sbjct  138  MFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKGS  197

Query  152  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+APA+
Sbjct  198  KTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPAH  244



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   390 bits (1001),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC  D R C+PGNPSI +TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV FRR+ CRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKGS+T W
Sbjct  142  IAQYRAGIVPVAFRRVACRKTGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGSKTAW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TSWNVAP N
Sbjct  202  LSMSRNWGQNWQSNAVLVGQTLSFRITGSDRRTSTSWNVAPPN  244



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   390 bits (1001),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -2

Query  689  LFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  510
            L   + PG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  18   LVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  77

Query  509  GLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  333
            GLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  78   GLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  137

Query  332  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  153
            MFLKIA YRAGIVPV FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +  VKGS
Sbjct  138  MFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKGS  197

Query  152  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+APA+
Sbjct  198  KTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPAH  244



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   390 bits (1001),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 210/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +SL++++     PG Y GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  14   MSLMWVVAEARIPGNYMGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  73

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPH
Sbjct  74   TALFNNGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPH  133

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  134  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFRYFNLVLISNVAGAGDIVK  193

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKG+RT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  194  VSVKGTRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRSSTSWNIVPSN  246



>gb|AFZ78606.1| expansin protein [Populus tomentosa]
Length=262

 Score =   390 bits (1001),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 212/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S L+M E   PGVYSGGAW+ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  17   VSSLWMAEARIPGVYSGGAWENAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALST  76

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHF
Sbjct  77   ALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHF  136

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  137  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQV  196

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQ+LSFRVRASDRR  TSWN+ PA+
Sbjct  197  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQTLSFRVRASDRRSSTSWNIVPAH  248



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   389 bits (1000),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 205/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PG+PSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+TNVAGAGDI +V +KGSR+ W
Sbjct  142  IAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLITNVAGAGDIVRVSIKGSRSDW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TSWNVAPA+
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNVAPAS  244



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   389 bits (1000),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 212/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL+++ E   PGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  15   ISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+D+GGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDDGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TSWNV PAN
Sbjct  195  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNVVPAN  246



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   389 bits (1000),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSG  WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGVYSGAEWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+N+ + C  G+PSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFEIKCANEPQWCHAGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS+T W
Sbjct  143  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKGSKTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            ++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  203  MSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  245



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   389 bits (1000),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 208/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL++M++   PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  12   MSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  71

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  72   ALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHF  131

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV FRR+ CRK GGIRFT+NGFRYFNLVL++NVAGAGDI   
Sbjct  132  DLAMPMFLKIAEYRAGIVPVAFRRVACRKHGGIRFTINGFRYFNLVLISNVAGAGDIVHA  191

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGSRT W+ +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TSWN+ P+N
Sbjct  192  YVKGSRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSWNIVPSN  243



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   389 bits (1000),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 205/232 (88%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L  L     PGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  16   LVSLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  75

Query  518  FNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            FNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A PNDNGGWCNPPR HF
Sbjct  76   FNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAKPNDNGGWCNPPRSHF  135

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RRIPCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI KV
Sbjct  136  DLAMPMFLKIAEYRAGIVPVTYRRIPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIIKV  195

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T WI+LSRNWGQNW+++A L GQSLSFRV+ASD R  TSWN+ P++
Sbjct  196  WVKGSKTNWISLSRNWGQNWQSNAVLTGQSLSFRVKASDHRSSTSWNIVPSH  247



>ref|XP_003616412.1| Expansin [Medicago truncatula]
 gb|AES99370.1| expansin A10 [Medicago truncatula]
Length=259

 Score =   389 bits (999),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RLPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            G+CFE+KCSND S C PG+PSI VTATNFCPPNFA  +DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GSCFELKCSNDPSWCHPGSPSILVTATNFCPPNFAQASDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIR+T+NGFRYFNLVL+TNVAGAGDI K  VKGS+T W
Sbjct  143  IAQYRAGIVPVSYRRVPCRKQGGIRYTINGFRYFNLVLITNVAGAGDIVKTSVKGSKTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFRV +SD+R  TSWN+ P+N
Sbjct  203  MSMSRNWGQNWQSNSVLVGQSLSFRVTSSDKRTSTSWNIVPSN  245



>gb|KJB46592.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=262

 Score =   389 bits (999),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 206/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVYS G+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  26   KIPGVYSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  85

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PG+PSIFVTATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  86   GACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLK  145

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK GGIRFTVNGFRYFNLVL+TNVAGAGD+ KV +KG++T W
Sbjct  146  IAEYRAGIVPVSFRRVPCRKHGGIRFTVNGFRYFNLVLITNVAGAGDLVKVSIKGTKTGW  205

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A L+GQ+LSFRV  SD+R  TSWNVAP N
Sbjct  206  MSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTSWNVAPPN  248



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   389 bits (999),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 205/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNL+L+TNVAGAGDI K  VKGS+T W
Sbjct  143  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLILITNVAGAGDIVKASVKGSKTEW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQSLSFRV +SDRR  TSWN+ P+N
Sbjct  203  MSMSRNWGQNWQSNAILVGQSLSFRVTSSDRRTSTSWNIVPSN  245



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   389 bits (999),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            S +     PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  17   STIVEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  76

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            NNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLA
Sbjct  77   NNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLA  136

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI KV VK
Sbjct  137  MPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVLITNVAGAGDIVKVSVK  196

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            GS+T W++LSRNWGQNW+++A L GQSLSFRV  SDRR  TSWN+ PAN
Sbjct  197  GSKTGWMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTSWNIVPAN  245



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   389 bits (999),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 209/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S L +++   PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  15   ISFLTLVDARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  74

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFN GLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  75   ALFNAGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV
Sbjct  135  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFR+  SDRR  TSWNV P+N
Sbjct  195  SVKGSQTGWMSMSRNWGQNWQSNAVLVGQSLSFRITGSDRRTSTSWNVVPSN  246



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   389 bits (998),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 208/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            ++L + +E   PG+YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  14   ITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  73

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHF
Sbjct  74   ALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHF  133

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFTVNGFRYFNLVLV+NVAGAGDI + 
Sbjct  134  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTVNGFRYFNLVLVSNVAGAGDIVRT  193

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKG+RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+AP N
Sbjct  194  YVKGTRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPPN  245



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   389 bits (998),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 209/235 (89%), Gaps = 6/235 (3%)
 Frame = -2

Query  698  LSLLFML-----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            +SLL ++     + PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AA
Sbjct  10   VSLLLLMIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  533  LSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPR  357
            LSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+ALP+DNGGWCNPPR
Sbjct  70   LSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSDNGGWCNPPR  129

Query  356  PHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDI  177
            PHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GG+RFT+NGFRYFNLVL+TNVAGAGDI
Sbjct  130  PHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVLITNVAGAGDI  189

Query  176  QKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             +  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV   DRR  TSWN+ P N
Sbjct  190  MRASVKGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTSTSWNIVPRN  244



>emb|CDP00110.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   389 bits (998),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 208/233 (89%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFM---LEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            LSLL        PGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  9    LSLLLTPTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  68

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPPRPH
Sbjct  69   TALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRPH  128

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFL+IA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+TNVAGAGDI +
Sbjct  129  FDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLITNVAGAGDIVQ  188

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
              VKGS+T WITLSRNWGQNW+T+A L GQSLSFRVRASDRR  TSWN+APAN
Sbjct  189  ASVKGSKTGWITLSRNWGQNWQTNAVLAGQSLSFRVRASDRRSSTSWNIAPAN  241



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   389 bits (998),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  24   RIPGVYTGGGWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  83

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ ++  C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI +V +KGSRT W
Sbjct  144  IAEYRAGIVPVTYRRVPCRKKGGIRFTINGFRYFNLVLITNVAGAGDIVRVSIKGSRTGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+AP+N
Sbjct  204  MSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPSN  246



>gb|AAR09168.1| alpha-expansin 1 [Populus tremula x Populus tremuloides]
Length=262

 Score =   389 bits (998),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 212/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S L+M E   PGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  17   VSSLWMAEARIPGVYSGGAWENAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALST  76

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHF
Sbjct  77   ALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHF  136

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  137  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQV  196

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQ+LSFRVRASDRR  TSWN+ PA+
Sbjct  197  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQTLSFRVRASDRRSSTSWNIVPAH  248



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   389 bits (998),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 210/237 (89%), Gaps = 9/237 (4%)
 Frame = -2

Query  695  SLLFMLEF--------PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  540
            SLL M+          PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV+ 
Sbjct  12   SLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVST  71

Query  539  AALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNP  363
            AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+ALP+DNGGWCNP
Sbjct  72   AALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNP  131

Query  362  PRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAG  183
            PRPHFDLAMPMFLKIA Y AGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAG
Sbjct  132  PRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAG  191

Query  182  DIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            DI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TSWN+ PA+
Sbjct  192  DIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIVPAH  248



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   389 bits (998),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 209/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            LSL++M E   PGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  13   LSLMWMAEARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALST  72

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  73   ALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNYALPNDNGGWCNPPRPHF  132

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI + 
Sbjct  133  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRT  192

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  193  SVKGSKTGWMLMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAN  244



>gb|KJB55836.1| hypothetical protein B456_009G098800 [Gossypium raimondii]
Length=259

 Score =   389 bits (998),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 210/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S ++M E   PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  14   ISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  73

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HF
Sbjct  74   ALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHF  133

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGD+ KV
Sbjct  134  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDLVKV  193

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  194  SVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>gb|AEE69071.1| expansin-4 [Petunia hybrid cultivar]
Length=248

 Score =   388 bits (997),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFN+GLSC
Sbjct  12   KIPGVYIGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNSGLSC  71

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND   C PGNPSIFVTATNFCPPN+ALPND+GGWCNPPRPHFDLAMPMFLK
Sbjct  72   GACFELKCTNDEPWCLPGNPSIFVTATNFCPPNYALPNDDGGWCNPPRPHFDLAMPMFLK  131

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDIQ+V VKG+ T W
Sbjct  132  IAQYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIQQVYVKGTNTEW  191

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I +SRNWGQNW+++A + GQ+LSFRVR SD+R   S N+APAN
Sbjct  192  IAMSRNWGQNWQSNALIAGQALSFRVRGSDQRSSASLNIAPAN  234



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   388 bits (997),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L+ +     PGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  16   LTCMVQARIPGVYSAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  75

Query  518  FNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDL
Sbjct  76   FNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDL  135

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL++NVAGAGDI +  V
Sbjct  136  AMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTINGFRYFNLVLISNVAGAGDIVRTYV  195

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KG+RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+AP N
Sbjct  196  KGTRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPPN  245



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
 gb|KJB20062.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=259

 Score =   388 bits (997),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 210/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   388 bits (997),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 203/227 (89%), Gaps = 1/227 (0%)
 Frame = -2

Query  689  LFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  510
            L     PGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN A LSTA FNN
Sbjct  19   LVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAVLSTAFFNN  78

Query  509  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  333
            GLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  79   GLSCGACFEIKCADDPKWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  138

Query  332  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  153
            MFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKGS
Sbjct  139  MFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGS  198

Query  152  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            RT W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  199  RTGWMAMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAN  245



>gb|AHL25255.1| expansin [Boehmeria nivea]
Length=260

 Score =   388 bits (997),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 208/230 (90%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            ++L      PGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  17   MTLATEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  76

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FN+GLSCGACFE+KC+ND +SC  G+PSI VTATNFCPPN+ALPND+GGWCNPPRPHFDL
Sbjct  77   FNSGLSCGACFELKCANDPKSCHSGSPSIIVTATNFCPPNYALPNDHGGWCNPPRPHFDL  136

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NG RYFNL+L++NVAG+GDI +  V
Sbjct  137  AMPMFLKIAEYRAGIVPVSFRRVPCRKRGGVRFTINGHRYFNLILISNVAGSGDIVRASV  196

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+APAN
Sbjct  197  KGSKTGWMSLSRNWGQNWQSNAALVGQSLSFRVTGSDRRTSTSWNIAPAN  246



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   388 bits (996),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 210/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S ++M E   PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  14   ISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  73

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HF
Sbjct  74   ALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHF  133

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGD+ KV
Sbjct  134  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDLVKV  193

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  194  SVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   388 bits (996),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 205/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  24   RIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNL+L+TNVAGAGDI K  VKGS+T W
Sbjct  144  IAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLILITNVAGAGDIVKASVKGSKTEW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQSLSFRV +SDRR  TSWN+ P+N
Sbjct  204  MSMSRNWGQNWQSNAILVGQSLSFRVTSSDRRTSTSWNIVPSN  246



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   388 bits (996),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 210/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPNFALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSH  245



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   388 bits (996),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            S +     PGVYSG AWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  17   STIVEARIPGVYSGEAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  76

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            NNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPPR HFDLA
Sbjct  77   NNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPNDNGGWCNPPRSHFDLA  136

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV++RR+PCRKQGGIRFTVNGF+YFNLVL+TNVAGAGDI KV VK
Sbjct  137  MPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTVNGFKYFNLVLITNVAGAGDIVKVSVK  196

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            GS+T W++LSRNWGQNW+++A L GQSLSFRV  SDRR  TSWN+ PAN
Sbjct  197  GSKTGWMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTSWNIVPAN  245



>ref|XP_004300427.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=259

 Score =   388 bits (996),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 207/230 (90%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L+ +     PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTAL
Sbjct  16   LTSITEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTAL  75

Query  518  FNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDL
Sbjct  76   FNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDL  135

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V V
Sbjct  136  AMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRVSV  195

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGSRT W++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  196  KGSRTGWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTSWNIVPAN  245



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   387 bits (995),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYSQGYGVN AALSTALFNNG+SC
Sbjct  22   RIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQGYGVNTAALSTALFNNGMSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSI +TATNFCPPNFA P+DNGGWCNPP PHFDLAMPMFLK
Sbjct  82   GACFEIKCADDPRWCHPGNPSILITATNFCPPNFAEPSDNGGWCNPPLPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+TNVAGAGDI +V +KGSR+ W
Sbjct  142  IAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLITNVAGAGDIVRVSIKGSRSDW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TSWNVAPA+
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNVAPAS  244



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   387 bits (995),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWC PPR HFD AMPMFLK
Sbjct  83   GACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCTPPRTHFDFAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV VKGS T W
Sbjct  143  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKVSVKGSNTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TSWNVAP+N
Sbjct  203  MSMSRNWGQNWQSNAVLVGQTLSFRLTGSDRRTSTSWNVAPSN  245



>ref|XP_006349505.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=259

 Score =   387 bits (995),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 205/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            +  GVY+GG+W +AHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN+GLSC
Sbjct  22   KIVGVYTGGSWTSAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNSGLSC  81

Query  497  GACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  324
            G+CFEIKC++ +   C+PGNPSI VT TNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMFL
Sbjct  82   GSCFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFL  141

Query  323  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  144
            KIA YRAGIV VN+RR+PCRKQGGIRFTVNGF+YFNLVLVTNVAGAGDIQKV VKG+ TP
Sbjct  142  KIAVYRAGIVAVNYRRVPCRKQGGIRFTVNGFQYFNLVLVTNVAGAGDIQKVYVKGTNTP  201

Query  143  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            WI+++RNWGQNW+T+A L+GQ+LSFRV  SDRR   S+N+APAN
Sbjct  202  WISMTRNWGQNWQTNAKLIGQALSFRVTGSDRRSSASYNIAPAN  245



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   387 bits (995),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 209/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL+++ E   PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN  ALST
Sbjct  15   ISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTGALST  74

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  195  SVKGARTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAN  246



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   387 bits (995),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 206/233 (88%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFM---LEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            LSLL      + PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  16   LSLLLTQSHAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  75

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNG SCGACFEIKC++D + C+PGNPSI VTATNFCPPN+ALP DNGGWCNPPRPH
Sbjct  76   TALFNNGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNYALPTDNGGWCNPPRPH  135

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+ CRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI +
Sbjct  136  FDLAMPMFLKIAQYRAGIVPVSYRRVACRKQGGMRFTINGFRYFNLVLITNVAGAGDIMR  195

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
              VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P N
Sbjct  196  ASVKGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPRN  248



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   387 bits (995),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 209/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            ++LL +++   PGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  13   MALLTLVDAKIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALST  72

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+N+ + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHF
Sbjct  73   ALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHF  132

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV
Sbjct  133  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKV  192

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W++LSRNWGQNW+++  L GQSLSFRV  SDRR  TSWN+ P++
Sbjct  193  SVKGSKTEWMSLSRNWGQNWQSNVVLAGQSLSFRVTGSDRRTSTSWNIVPSD  244



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   387 bits (995),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>ref|XP_006488339.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO72838.1| hypothetical protein CISIN_1g046524mg [Citrus sinensis]
Length=259

 Score =   387 bits (995),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/235 (79%), Positives = 211/235 (90%), Gaps = 6/235 (3%)
 Frame = -2

Query  698  LSLLFML-----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            LSL+ ++       PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AA
Sbjct  11   LSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  70

Query  533  LSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPR  357
            LSTALFNNGLSCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALP+DNGGWCNPPR
Sbjct  71   LSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPR  130

Query  356  PHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDI  177
            PHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI
Sbjct  131  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDI  190

Query  176  QKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             +V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV+ASDRR  TSWN+ PAN
Sbjct  191  LRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPAN  245



>gb|AAT11859.2| expansin 1 [Mangifera indica]
Length=260

 Score =   387 bits (995),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 211/230 (92%), Gaps = 3/230 (1%)
 Frame = -2

Query  692  LLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L++M+E   PGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  17   LMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  76

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDL
Sbjct  77   FNNGFSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDL  136

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV++RR+PCR++GGIRFT+NGFRYFNLVL+ +VAG+GDI KV V
Sbjct  137  AMPMFLKIAEYRAGIVPVSYRRVPCRERGGIRFTINGFRYFNLVLIADVAGSGDIVKVSV  196

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KG+RT W+++SRNWGQNW+++  LVGQ+LSFRVRASDRR  TSWN+ PAN
Sbjct  197  KGTRTGWMSMSRNWGQNWQSNTVLVGQALSFRVRASDRRSSTSWNIVPAN  246



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   387 bits (994),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PG+PSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
             A YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+TNVAGAGDI +V +KGSR+ W
Sbjct  142  FAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLITNVAGAGDIVRVSIKGSRSDW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TSWNVAPA+
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTSWNVAPAS  244



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   387 bits (994),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 205/230 (89%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
             SLL     PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  15   FSLLIEARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  74

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPR HFDL
Sbjct  75   FNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNGGWCNPPRSHFDL  134

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +V V
Sbjct  135  AMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSV  194

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KG+RT W++L+RNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+APA+
Sbjct  195  KGTRTGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIAPAH  244



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   387 bits (994),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSIWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   387 bits (994),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
             SLL     PGVYSGG WQ+AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  15   FSLLIDARIPGVYSGGPWQSAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTAL  74

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPR HFDL
Sbjct  75   FNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPNDNGGWCNPPRSHFDL  134

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI +V V
Sbjct  135  AMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVRVSV  194

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KG+RT W++L+RNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+ PA+
Sbjct  195  KGTRTGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNIVPAH  244



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   387 bits (994),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 210/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYF+LVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFDLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   387 bits (993),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 210/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSH  245



>ref|XP_010264435.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   387 bits (993),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 185/223 (83%), Positives = 200/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  24   RIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND + C PG PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFEIKCANDPQWCHPGGPSILITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKGS T W
Sbjct  144  IAEYRAGIVPVAYRRVPCRKHGGIRFTINGFRYFNLVLVTNVAGAGDIVKVSVKGSNTGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +T+SRNWGQNW+++A LVGQ+LSFR+  SD R  TSWNVAPAN
Sbjct  204  LTMSRNWGQNWQSNAVLVGQALSFRITGSDHRTSTSWNVAPAN  246



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   387 bits (994),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 209/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFML--EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            LS L ++    PGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  19   LSFLAVVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  78

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  79   ALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHF  138

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV
Sbjct  139  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKV  198

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKG+ T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPAN
Sbjct  199  KVKGTNTNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSLNVAPAN  250



>ref|XP_006424843.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
 gb|ESR38083.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
Length=259

 Score =   387 bits (993),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 185/235 (79%), Positives = 211/235 (90%), Gaps = 6/235 (3%)
 Frame = -2

Query  698  LSLLFML-----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            LSL+ ++       PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AA
Sbjct  11   LSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  70

Query  533  LSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPR  357
            LSTALFNNGLSCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALP+DNGGWCNPPR
Sbjct  71   LSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPR  130

Query  356  PHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDI  177
            PHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI
Sbjct  131  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDI  190

Query  176  QKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             +V VKGSRT W+++SRNWGQNW+++A L+GQSLSFRV+ASDRR  TSWN+ PAN
Sbjct  191  LRVNVKGSRTGWMSMSRNWGQNWQSNAVLIGQSLSFRVKASDRRSSTSWNIVPAN  245



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   387 bits (993),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+GLSC
Sbjct  24   RIPGVYGGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGLSC  83

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D S C  G+PSI VTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFEIKCADDPSWCHAGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGD+ +  VKG++T W
Sbjct  144  IAEYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGDVVRTSVKGAKTGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PAN
Sbjct  204  MSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPAN  246



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   387 bits (993),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 210/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL+++ E   PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  15   ISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFE+KC+ D S C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFELKCAEDPSWCHAGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI KV
Sbjct  135  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVKV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  195  SVKGARTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAH  246



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   387 bits (993),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
              VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  193  ASVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>gb|KJB36710.1| hypothetical protein B456_006G172400 [Gossypium raimondii]
Length=264

 Score =   387 bits (993),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 208/232 (90%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFML--EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            LS L ++    PGVY+GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  19   LSFLAVVNARIPGVYTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  78

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCG CFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  79   ALFNNGLSCGGCFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHF  138

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV
Sbjct  139  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKV  198

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKG+ T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPAN
Sbjct  199  KVKGTNTNWLSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSLNVAPAN  250



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/233 (80%), Positives = 208/233 (89%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            LSLLF+    + PGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  10   LSLLFLTANAKIPGVYTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  69

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFE+KC  D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR H
Sbjct  70   TALFNNGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDDGGWCNPPRTH  129

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K
Sbjct  130  FDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVK  189

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGS+T W+T+SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVA +N
Sbjct  190  VSVKGSKTGWLTMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNVAKSN  242



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY QGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYGQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/235 (79%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = -2

Query  698  LSLLFML-----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            +SLL  L       PGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AA
Sbjct  12   VSLLAFLTLADARIPGVYAGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAA  71

Query  533  LSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPR  357
            LSTALFN GLSCGACFEIKC++D R C PG+PSIF+TATNFCPPN+ALP+DNGGWCNPPR
Sbjct  72   LSTALFNEGLSCGACFEIKCADDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPR  131

Query  356  PHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDI  177
            PHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVA AGDI
Sbjct  132  PHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVASAGDI  191

Query  176  QKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             +V VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PAN
Sbjct  192  VRVSVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPAN  246



>ref|NP_001233958.1| expansin precursor [Solanum lycopersicum]
 gb|AAC63088.1| expansin [Solanum lycopersicum]
 gb|AAQ12264.1| expansin 1 protein [Solanum lycopersicum]
Length=261

 Score =   387 bits (993),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 203/225 (90%), Gaps = 3/225 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGVYSGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  327
            GACFE+KC+N    + C PGNPSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMF
Sbjct  83   GACFELKCTNTPNWKWCLPGNPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF  142

Query  326  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  147
            LK+A YRAGIVPV +RRIPCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI KV VKG++T
Sbjct  143  LKLAQYRAGIVPVTYRRIPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIIKVWVKGTKT  202

Query  146  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             WI LSRNWGQNW+++A L GQSLSFRV+ASD R  TSWN+ P++
Sbjct  203  NWIPLSRNWGQNWQSNAVLTGQSLSFRVKASDHRSSTSWNMVPSH  247



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSH  245



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC  D R C+PG+PSI +TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCDQDPRWCNPGSPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +V +KGS+T W
Sbjct  142  IAQYRAGIVPVAYRRVPCRKTGGIRFTINGFRYFNLVLITNVAGAGDIVRVSMKGSKTAW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SD+R  TSWNVAP N
Sbjct  202  MSMSRNWGQNWQSNAVLVGQALSFRVTGSDQRTSTSWNVAPPN  244



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   386 bits (991),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 210/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL+++ E   PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  15   ISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  195  SVKGSRTDWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAH  246



>ref|XP_011042710.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=262

 Score =   386 bits (992),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 210/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL++  E   PGVYSGGAW+TAHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  17   MSLMWKGEARIPGVYSGGAWETAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALST  76

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+ALP+DNGGWC PPRPHF
Sbjct  77   ALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCTPPRPHF  136

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA Y AGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  137  DLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVQV  196

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TSWN+ PA+
Sbjct  197  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIVPAH  248



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   386 bits (991),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 211/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +S++++ E   PGVY+G AW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALST
Sbjct  15   ISVMWVAEARIPGVYTGDAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TSWN+ PAN
Sbjct  195  SVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTSWNIVPAN  246



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   386 bits (991),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND   C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS+T W
Sbjct  142  IAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKGSKTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            ++LSRNWGQNW+++A LVGQSLSFRV  SD R  TSWN+ P+N
Sbjct  202  MSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSWNIVPSN  244



>ref|XP_006350774.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=260

 Score =   386 bits (991),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALSTALFNNGLSC
Sbjct  24   RIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALSTALFNNGLSC  83

Query  497  GACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC N  + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL 
Sbjct  84   GACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLH  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI  + +KGS+T W
Sbjct  144  IAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVSLSIKGSKTNW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I++SRNWGQNW+T++ L GQSLSFRVRA DRR  TSWN+APA+
Sbjct  204  ISMSRNWGQNWQTNSVLFGQSLSFRVRAGDRRSSTSWNIAPAH  246



>ref|XP_011077214.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=259

 Score =   385 bits (990),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  23   RIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC ++ + C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMFLK
Sbjct  83   GACFEIKCRDEPQWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PC K+GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT W
Sbjct  143  IAEYRAGIVPVSYRRVPCHKKGGIRFTINGFRYFNLVLISNVAGAGDIMKVWVKGSRTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV+ASD R  T+WN+ P+N
Sbjct  203  MAMSRNWGQNWQSNAVLVGQSLSFRVKASDHRSSTAWNIVPSN  245



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   385 bits (990),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 209/231 (90%), Gaps = 3/231 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
             SL+++ +   PGVYSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  15   FSLMWLADARIPGVYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLISNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPA  15
             VKG+RT W+++SRNWGQNW+++A L GQ+LSFRV ASDRR  TSWN+ PA
Sbjct  195  SVKGARTGWMSMSRNWGQNWQSNAVLAGQALSFRVTASDRRSSTSWNMVPA  245



>emb|CAN73252.1| hypothetical protein VITISV_027049 [Vitis vinifera]
Length=247

 Score =   385 bits (989),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  11   RIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  70

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND   C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  71   GACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  130

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS+T W
Sbjct  131  IAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKASVKGSKTGW  190

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            ++LSRNWGQNW+++A LVGQSLSFRV  SD R  TSWN+ P+N
Sbjct  191  MSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSWNIVPSN  233



>ref|XP_009587747.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=259

 Score =   385 bits (990),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST LFNNGLSC
Sbjct  23   KIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTVLFNNGLSC  82

Query  497  GACFEIKC-SNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC  +D+ C PGNPSIFVTATNFCPPNFALPND+GGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFEIKCVDDDKWCLPGNPSIFVTATNFCPPNFALPNDDGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+ CRK GGIRFT+NGFRYFNL+LVTNVAGAGDIQKVL+KG+ T W
Sbjct  143  IGLYRAGIVPVSYRRVACRKAGGIRFTINGFRYFNLLLVTNVAGAGDIQKVLIKGTNTQW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I +SRNWGQNW+T+A LVG++LS RV+ASD R VTS NVAP N
Sbjct  203  IAMSRNWGQNWQTNAVLVGKALSIRVKASDHRSVTSNNVAPPN  245



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   385 bits (990),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
             S L     PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  16   FSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  75

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPRPHFDL
Sbjct  76   FNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPNDNGGWCNPPRPHFDL  135

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K+ V
Sbjct  136  AMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDINKLWV  195

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGS+T W+++SRNWGQNW++++ L GQSLSFRV A DRR  TSWN+ P+N
Sbjct  196  KGSKTGWMSMSRNWGQNWQSNSVLAGQSLSFRVTAGDRRTSTSWNIVPSN  245



>ref|XP_010685747.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   385 bits (990),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            S L     PG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   STLVDARIPGNYQGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            N+GLSCGACFE+KC+ND R C PG+PSI +TATNFCPPNFALPNDNGGWCNPPRPHFDLA
Sbjct  79   NSGLSCGACFELKCANDPRWCHPGSPSILITATNFCPPNFALPNDNGGWCNPPRPHFDLA  138

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLK+A YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGAGDI  V +K
Sbjct  139  MPMFLKLAQYRAGIVPVAFRRVPCRKRGGIRFTMNGFRYFNLVLVSNVAGAGDIVNVYIK  198

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            GS+T W+ +SRNWGQNW++++ LVGQSLSFRVR SD+R  TSWN+AP+N
Sbjct  199  GSKTNWMAMSRNWGQNWQSNSVLVGQSLSFRVRGSDKRSSTSWNIAPSN  247



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   385 bits (990),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 207/237 (87%), Gaps = 8/237 (3%)
 Frame = -2

Query  698  LSLLFMLEF-----PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            + L+F++       PGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AA
Sbjct  11   IGLIFLVSLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  70

Query  533  LSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNP  363
            LSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A PNDNGGWCNP
Sbjct  71   LSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAKPNDNGGWCNP  130

Query  362  PRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAG  183
            PR HFDLAMPMFL IA YRAGIVPV +RRIPCRK+GGIRFT+NGFRYFNLVL+TNVAGAG
Sbjct  131  PRSHFDLAMPMFLNIAQYRAGIVPVTYRRIPCRKRGGIRFTINGFRYFNLVLITNVAGAG  190

Query  182  DIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            DI KV VKGS+T WI+LSRNWGQNW+++A L  QSLSFRV+ASD R  TSWN+ P++
Sbjct  191  DIIKVWVKGSKTNWISLSRNWGQNWQSNAVLTAQSLSFRVKASDHRSSTSWNIVPSH  247



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   385 bits (989),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 206/230 (90%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L+L+     PGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  16   LTLMSEARIPGVYGGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  75

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG  CGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDL
Sbjct  76   FNNGFRCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDL  135

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGD+ +V V
Sbjct  136  AMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDVVRVSV  195

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+AP++
Sbjct  196  KGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTSWNIAPSH  245



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   385 bits (989),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 208/233 (89%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHAT YGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATLYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR H
Sbjct  73   TALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTH  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   385 bits (990),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  28   RIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  87

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ D + C+PGNPSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  88   GACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPRQHFDLAMPMFLK  147

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGD+ +  +KGS+T W
Sbjct  148  IAQYRAGIVPVSFRRVPCRKKGGIRFTINGFRYFNLVLITNVAGAGDVVRASIKGSKTAW  207

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A  VGQSLSFRV ASDRR  TS+NVAPAN
Sbjct  208  MSMSRNWGQNWQSNAVFVGQSLSFRVTASDRRTSTSFNVAPAN  250



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   385 bits (989),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            +++     PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   TIVVEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            NNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDLA
Sbjct  79   NNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLA  138

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI KV VK
Sbjct  139  MPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKVYVK  198

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            G+ TPW++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ P+N
Sbjct  199  GTNTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTSWNIVPSN  247



>ref|XP_004490888.1| PREDICTED: expansin-A4-like [Cicer arietinum]
Length=260

 Score =   385 bits (989),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN GLSC
Sbjct  24   RIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNEGLSC  83

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKCS+D + C  G+PSI VTATNFCPPN+A P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFEIKCSDDPNWCHAGSPSILVTATNFCPPNYAQPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGDI K  VKGS++ W
Sbjct  144  IAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGDIVKTSVKGSKSGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWN+ P+N
Sbjct  204  MSMSRNWGQNWQSNAILIGQSLSFRVTASDRRTSTSWNIVPSN  246



>gb|KJB78839.1| hypothetical protein B456_013G022200 [Gossypium raimondii]
Length=258

 Score =   385 bits (988),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 208/235 (89%), Gaps = 6/235 (3%)
 Frame = -2

Query  698  LSLLFML-----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            +SLLF++       PGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AA
Sbjct  10   VSLLFIIVTVEARIPGVYSDGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  533  LSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPR  357
            LSTALFNNG SCGACFEIKC N  + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR
Sbjct  70   LSTALFNNGFSCGACFEIKCVNQPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPR  129

Query  356  PHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDI  177
             HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAG+GDI
Sbjct  130  SHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGSGDI  189

Query  176  QKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             K  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+AP+N
Sbjct  190  VKASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPSN  244



>gb|AAL31480.1|AF319475_1 alpha-expansin 9 precursor [Cucumis sativus]
Length=245

 Score =   384 bits (987),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNL+L+TNVAGAGDI K  VKGS+T W
Sbjct  143  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLILITNVAGAGDIVKASVKGSKTEW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQSLSFRV +SDR   TSWN+  +N
Sbjct  203  MSMSRNWGQNWQSNAILVGQSLSFRVTSSDRHTSTSWNIVISN  245



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   385 bits (988),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            +S ++M+     PGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLYSQGYGV+ AALS
Sbjct  13   ISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALS  72

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR  
Sbjct  73   TALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRTR  132

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI K
Sbjct  133  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVK  192

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  193  VSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAH  245



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   385 bits (988),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 210/232 (91%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL+++ E   PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  15   ISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  74

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  195  SVKGARTDWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAH  246



>ref|XP_010111457.1| hypothetical protein L484_021280 [Morus notabilis]
 gb|EXC30980.1| hypothetical protein L484_021280 [Morus notabilis]
Length=263

 Score =   385 bits (988),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 204/220 (93%), Gaps = 1/220 (0%)
 Frame = -2

Query  668  GVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSCGAC  489
            GVY+G  W +AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSCG+C
Sbjct  30   GVYTGSPWDSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSC  89

Query  488  FEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAA  312
            FE+KC  D + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIA 
Sbjct  90   FELKCDGDPKWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAE  149

Query  311  YRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWITL  132
            YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAG+I +V VKGS+T W+++
Sbjct  150  YRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGNIVQVGVKGSKTGWLSM  209

Query  131  SRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            SRNWGQNW+++A LVGQ+LSFRVRASDRR  TSWN+APAN
Sbjct  210  SRNWGQNWQSNAVLVGQALSFRVRASDRRSSTSWNIAPAN  249



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   385 bits (988),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  24   RIPGVYSGGGWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  83

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+N++  C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMFLK
Sbjct  84   GACFEIKCANEKQWCHAGSPSILVTATNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPVNFRR+ CRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI ++ +KG+RT W
Sbjct  144  IAEYRAGIVPVNFRRVACRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVRLSIKGTRTGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+APAN
Sbjct  204  MSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIAPAN  246



>ref|NP_001234761.1| expansin18 precursor [Solanum lycopersicum]
 emb|CAA06271.2| expansin18 [Solanum lycopersicum]
Length=260

 Score =   385 bits (988),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALSTALFNNGLSC
Sbjct  24   RIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALSTALFNNGLSC  83

Query  497  GACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC N  + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL 
Sbjct  84   GACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLH  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI  + +KGS+T W
Sbjct  144  IAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVSLSIKGSKTNW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I++SRNWGQNW+T++ L GQSLSFRVRA DRR  TSWN+ PA+
Sbjct  204  ISMSRNWGQNWQTNSVLFGQSLSFRVRAGDRRSSTSWNITPAH  246



>gb|KJB73995.1| hypothetical protein B456_011G266000 [Gossypium raimondii]
Length=258

 Score =   384 bits (987),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            +S       PGVYSGGAWQ+AHATFYGG DASGTMGGACG+GNLYSQGYGVN AALSTAL
Sbjct  15   ISTAVEARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGFGNLYSQGYGVNTAALSTAL  74

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDL
Sbjct  75   FNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHFDL  134

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI K  V
Sbjct  135  AMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIVKASV  194

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGS+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++
Sbjct  195  KGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSH  244



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   384 bits (987),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 205/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  24   RIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG+RT W
Sbjct  144  IAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKGTRTSW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFRV ASDRR  TSWN+APA+
Sbjct  204  MSMSRNWGQNWQSNSVLVGQSLSFRVTASDRRSSTSWNIAPAH  246



>ref|XP_006435550.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 ref|XP_006486470.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|ESR48790.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 gb|KDO69285.1| hypothetical protein CISIN_1g024916mg [Citrus sinensis]
Length=260

 Score =   384 bits (986),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            SL      PGVY G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  18   SLSVDARIPGVYGGEAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALF  77

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            NNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLA
Sbjct  78   NNGLSCGACFEIKCANDPQWCHAGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLA  137

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI K  VK
Sbjct  138  MPMFLKMAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIVKASVK  197

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            GSRT W++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  198  GSRTGWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAN  246



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   384 bits (985),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 205/235 (87%), Gaps = 6/235 (3%)
 Frame = -2

Query  698  LSLLFML-----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            +SLL  L       PGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AA
Sbjct  12   VSLLAFLTLADARIPGVYAGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAA  71

Query  533  LSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPR  357
            LSTALFN+GLSCGACFEIKC  + R C PG+PSI +TATNFCPPN+ALP+DNGGWCNPPR
Sbjct  72   LSTALFNDGLSCGACFEIKCGEEPRWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPR  131

Query  356  PHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDI  177
            PHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF YFNLVL+TNVAGAGDI
Sbjct  132  PHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKAGGIRFTINGFEYFNLVLITNVAGAGDI  191

Query  176  QKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             +V VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ PAN
Sbjct  192  VRVSVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSWNIVPAN  246



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   385 bits (989),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
             S L     PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  64   FSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  123

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPRPHFDL
Sbjct  124  FNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPNDNGGWCNPPRPHFDL  183

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K+ V
Sbjct  184  AMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDINKLWV  243

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGS+T W+++SRNWGQNW++++ L GQSLSFRV A DRR  TSWN+ P+N
Sbjct  244  KGSKTGWMSMSRNWGQNWQSNSVLAGQSLSFRVTAGDRRTSTSWNIVPSN  293



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   383 bits (984),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 207/233 (89%), Gaps = 5/233 (2%)
 Frame = -2

Query  695  SLLFML-----EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAAL  531
            SLL +L     + PGVY+GG WQ+AHATFYGG DASGTMGGACGYGNLYS GYGVNNAAL
Sbjct  11   SLLSLLTAANAKVPGVYTGGPWQSAHATFYGGEDASGTMGGACGYGNLYSAGYGVNNAAL  70

Query  530  STALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            STALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPH
Sbjct  71   STALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPH  130

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLA PMFLK A YRAGIVPV +RR+PC+K GGIRFT+NGF YFN+V+VTNVAGAGDIQK
Sbjct  131  FDLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTINGFNYFNMVIVTNVAGAGDIQK  190

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKG+ T W+ +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT++NVAP+N
Sbjct  191  VFVKGTNTKWMAMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTTYNVAPSN  243



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   383 bits (984),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/227 (80%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -2

Query  689  LFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  510
            L    +PGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+
Sbjct  18   LIHARYPGVYSRGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNS  77

Query  509  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  333
            G SCGACFE+KC++D R C PG+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  78   GQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  137

Query  332  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  153
            MFLKIA YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGD+  V VKGS
Sbjct  138  MFLKIAEYRAGIVPVAFRRVPCRKKGGIRFTINGFRYFNLVLISNVAGAGDLVSVSVKGS  197

Query  152  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            RT W++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TS N+AP+N
Sbjct  198  RTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTSLNIAPSN  244



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   383 bits (984),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            +++     PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   TIVVEARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            NNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLA
Sbjct  79   NNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDDGGWCNPPRTHFDLA  138

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI KV VK
Sbjct  139  MPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKVYVK  198

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            G+ TPW++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TSWN+ P+N
Sbjct  199  GTNTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTSWNIVPSN  247



>ref|XP_006410954.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
 dbj|BAJ34443.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52407.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
Length=263

 Score =   383 bits (984),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 200/222 (90%), Gaps = 1/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  27   KIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  86

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  87   GACFEIKCTDDPRWCVPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK  146

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVL+TNVAGAGDI  V VKGS+T W
Sbjct  147  IGLYRAGIVPVSYRRVPCRKLGGIRFTVNGFRYFNLVLITNVAGAGDITGVSVKGSKTDW  206

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPA  15
            + +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAPA
Sbjct  207  VRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPA  248



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   383 bits (984),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS ALFNNGLSC
Sbjct  28   RIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSPALFNNGLSC  87

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  88   GACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMFLK  147

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI KV VKG+ T W
Sbjct  148  IAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVKVKVKGTNTNW  207

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPAN
Sbjct  208  MSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSLNVAPAN  250



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   383 bits (983),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 205/223 (92%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  24   RIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG+RT W
Sbjct  144  IAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKGTRTSW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TSWN+APA+
Sbjct  204  MSMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTSWNIAPAH  246



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   382 bits (982),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 199/223 (89%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG YSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGFYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            G+CFEIKC  D R C+PGNPSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GSCFEIKCDQDPRWCNPGNPSILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG+ T W
Sbjct  142  IAQYRAGIVPVAYRRVPCRKKGGIRFTINGFRYFNLVLITNVAGAGDIIRVSVKGTNTAW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A  VGQ+LSFRV  SDRR  TSWNVAP N
Sbjct  202  MSMSRNWGQNWQSNAVFVGQALSFRVTGSDRRTSTSWNVAPPN  244



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   382 bits (982),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  24   RIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG+RT W
Sbjct  144  IAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKGTRTSW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TSWN+AP +
Sbjct  204  ISMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTSWNIAPTH  246



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   382 bits (982),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTALFN+GLSC
Sbjct  22   RIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVDTAALSTALFNDGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+++ + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCADEPQWCHSGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVLITNVAGAGDIMRASVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  202  MPLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAN  244



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   382 bits (982),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/222 (82%), Positives = 199/222 (90%), Gaps = 1/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  26   KIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  85

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  86   GACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK  145

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKGS+T W
Sbjct  146  IGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDW  205

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPA  15
            + +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAPA
Sbjct  206  VRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPA  247



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   382 bits (981),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 203/227 (89%), Gaps = 1/227 (0%)
 Frame = -2

Query  689  LFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  510
            L     PGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+
Sbjct  18   LVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNS  77

Query  509  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  333
            GLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  78   GLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  137

Query  332  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  153
            MFLKIA YRAGIVPV++RR+PCRK+GGIRF +NG RYFNLVL+TNVAGAGDI KV VKGS
Sbjct  138  MFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVLITNVAGAGDIVKVSVKGS  197

Query  152  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+N
Sbjct  198  KTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSN  244



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   382 bits (981),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  24   RIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  83

Query  497  GACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            G+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +  VKG++T W
Sbjct  144  IAEYRAGIVPVAFRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRTYVKGTQTGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW++++ LVGQ+LSFRV  SDRR  TSWN+AP N
Sbjct  204  MPMSRNWGQNWQSNSVLVGQALSFRVTGSDRRTSTSWNIAPHN  246



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   382 bits (981),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+ G W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+GLSC
Sbjct  22   RIPGVYTSGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND + C  G+PSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCANDPKWCHSGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV FRR+ CRK GGIRFTVNGFRYFNLVLVTNVAGAGDI +V +KGS+T W
Sbjct  142  IAEYRAGIVPVAFRRVSCRKSGGIRFTVNGFRYFNLVLVTNVAGAGDIVRVSIKGSKTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWNVAPAN
Sbjct  202  MSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNVAPAN  244



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   382 bits (981),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 207/232 (89%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL+++ E   PGVY+GGAWQ AHATFYGG+DASGTM GACGYGNLYSQGYGVN  ALST
Sbjct  15   ISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMXGACGYGNLYSQGYGVNTGALST  74

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHF
Sbjct  75   ALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHF  134

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  135  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRV  194

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKG+ T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  195  SVKGAGTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPAN  246



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   382 bits (981),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+GLSC
Sbjct  22   RLPGAYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNDGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFELKCADDPKWCLPGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPVNFRR+PCRK+GGIRFTV+GFRYFNLVL+TNVAGAG++ +  VKG+RT W
Sbjct  142  IAQYRAGIVPVNFRRVPCRKRGGIRFTVDGFRYFNLVLITNVAGAGNVMRASVKGTRTQW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + LSRNWGQNW+++A L GQ+LSFRV  SDRR  TSWNVAP N
Sbjct  202  LPLSRNWGQNWQSNAQLAGQALSFRVTTSDRRTSTSWNVAPPN  244



>ref|XP_011031225.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=258

 Score =   382 bits (981),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGDI KV VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+N
Sbjct  202  MSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSN  244



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   382 bits (980),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 206/229 (90%), Gaps = 3/229 (1%)
 Frame = -2

Query  695  SLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            S+++M++   PGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTA
Sbjct  12   SIMWMVDARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTA  71

Query  521  LFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFD
Sbjct  72   LFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFD  131

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMPMFLKIA YRAGIVPV +RR+ C K GGIRFT+NGFRYFNLVL++NVAGAGD+    
Sbjct  132  LAMPMFLKIAEYRAGIVPVAYRRVACMKHGGIRFTINGFRYFNLVLISNVAGAGDLVHAY  191

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            VKG+R+ W+ +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TSWN+AP
Sbjct  192  VKGTRSGWMPMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTSWNIAP  240



>ref|XP_002312101.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEE89468.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   382 bits (980),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGDI KV VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+N
Sbjct  202  MSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSN  244



>gb|AEQ55271.1| expansin [Breonia chinensis]
 gb|AEQ55286.1| expansin [Breonia chinensis]
Length=258

 Score =   382 bits (980),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN  ALSTALFNNGLSC
Sbjct  22   RIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTGALSTALFNNGLSC  81

Query  497  GACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+N  + C PGNPSIF+TATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFELKCANAPKWCLPGNPSIFITATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPVN+RR+PCRK+GGIRFTVNGFRYFNL+L+TNVAGAG++ +  VKG+RT W
Sbjct  142  IAEYRAGIVPVNYRRVPCRKRGGIRFTVNGFRYFNLILITNVAGAGNVIRASVKGTRTQW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + LSRNWGQNW+++A L+GQ+LSFRV ASD R  TSWNVAP N
Sbjct  202  LPLSRNWGQNWQSNAQLIGQALSFRVTASDGRTSTSWNVAPPN  244



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   382 bits (980),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 203/227 (89%), Gaps = 1/227 (0%)
 Frame = -2

Query  689  LFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  510
            L     PGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  18   LVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  77

Query  509  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  333
            GLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  78   GLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  137

Query  332  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGS  153
            +FLKIA YRAGIVPV++RR+PCRK+GGIRF +NG RYFNLVL+TNVAGAGDI KV VKGS
Sbjct  138  VFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVLITNVAGAGDIVKVSVKGS  197

Query  152  RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+N
Sbjct  198  KTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSN  244



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   382 bits (980),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            +LL     PGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTAL+
Sbjct  19   ALLADARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALY  78

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            N+GL CGACFEIKC++D R C  GNPSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLA
Sbjct  79   NDGLRCGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLA  138

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV+FRR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VK
Sbjct  139  MPMFLKIAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVK  198

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            G+R+ WI +SRNWGQNW+++A LVGQSLSFRV  SD R  TSWN+APA+
Sbjct  199  GTRSGWIAMSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTSWNIAPAS  247



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   381 bits (979),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 208/230 (90%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L+ ++    PGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  17   LTAIYEARIPGVYNGGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  76

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDL
Sbjct  77   FNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDL  136

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ V
Sbjct  137  AMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSV  196

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+APA+
Sbjct  197  KGTRTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIAPAH  246



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   381 bits (979),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 199/222 (90%), Gaps = 1/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  26   KIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  85

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  86   GACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK  145

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKGS+T W
Sbjct  146  IGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDW  205

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPA  15
            + +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAP+
Sbjct  206  VRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPS  247



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   381 bits (978),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 202/222 (91%), Gaps = 0/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS GYGVNNAALSTALFNNGLSC
Sbjct  22   KVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYSAGYGVNNAALSTALFNNGLSC  81

Query  497  GACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI  318
            GACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFDLA PMFLK 
Sbjct  82   GACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFDLAEPMFLKF  141

Query  317  AAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWI  138
            A YRAGIVPV +RR+PC+K GGIRFT+NGF YFN+V+VTNVAGAGDIQKV VKG+ T W+
Sbjct  142  AQYRAGIVPVTYRRVPCKKSGGIRFTINGFNYFNMVIVTNVAGAGDIQKVFVKGTNTKWM  201

Query  137  TLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT++NVAP+N
Sbjct  202  AMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTTYNVAPSN  243



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   380 bits (977),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 202/230 (88%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            +S       PG YSGG WQ+AHATFYGG DASGTMGGACGYGNLYSQGYGV+ AALSTAL
Sbjct  15   ISTAVEARIPGFYSGGEWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVSTAALSTAL  74

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPR HFDL
Sbjct  75   FNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRSHFDL  134

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI K  V
Sbjct  135  AMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIVKASV  194

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGS+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++
Sbjct  195  KGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSH  244



>gb|KFK32246.1| hypothetical protein AALP_AA6G217100 [Arabis alpina]
Length=257

 Score =   380 bits (977),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 207/230 (90%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L+ L     PGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  14   LADLTEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  73

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDL
Sbjct  74   FNNGYSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDL  133

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ V
Sbjct  134  AMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSV  193

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+APA+
Sbjct  194  KGTRTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIAPAH  243



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   380 bits (977),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            +LL     PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALF
Sbjct  20   ALLADARIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALF  79

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            N+GLSCGACFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDLA
Sbjct  80   NDGLSCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLA  139

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VK
Sbjct  140  MPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDIIRATVK  199

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            GSRT W+ +SRNWGQNW+++A LVGQSLSFRV  SD R  TSWN+APA 
Sbjct  200  GSRTGWMPMSRNWGQNWQSNAALVGQSLSFRVTGSDHRTSTSWNIAPAT  248



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   380 bits (977),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 198/221 (90%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  26   KIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  85

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  86   GACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK  145

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKGS+T W
Sbjct  146  IGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDW  205

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            + +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAP
Sbjct  206  VRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAP  246



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   380 bits (976),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            LS L ++E    GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS GYGVNNAALST
Sbjct  13   LSFLTIVESKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYSTGYGVNNAALST  72

Query  524  ALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
             LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFD
Sbjct  73   VLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFD  132

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            L+MP+FL+IA YRAGIVPV +RR+PC+KQGGIRFT+NGF YFN+++VTNVAGAGDIQ+V 
Sbjct  133  LSMPVFLQIAQYRAGIVPVTYRRVPCKKQGGIRFTINGFNYFNMIIVTNVAGAGDIQQVQ  192

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKG+ T WI +SRNWGQNW+++A L GQ+LSF+V+ SD R VTS+NVAP+N
Sbjct  193  VKGTNTKWIIMSRNWGQNWQSNAMLTGQALSFKVKTSDHRYVTSYNVAPSN  243



>gb|KHG24991.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=260

 Score =   380 bits (976),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 207/231 (90%), Gaps = 3/231 (1%)
 Frame = -2

Query  695  SLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            S ++M E   PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTA
Sbjct  16   STMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTA  75

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFD
Sbjct  76   LFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFD  135

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAG+G+I K  
Sbjct  136  LAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGSGNIVKAS  195

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W+++SRNWGQNW+++  LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  196  VKGSRTGWMSMSRNWGQNWQSNVVLVGQSLSFRVTGSDRRTSTSWNIVPAH  246



>gb|EYU41729.1| hypothetical protein MIMGU_mgv1a012073mg [Erythranthe guttata]
Length=262

 Score =   380 bits (976),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 200/223 (90%), Gaps = 3/223 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  24   RIPGVYAGGPWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  83

Query  497  GACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  327
            GACFEIKC    + + C+PG+PSI VTATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  84   GACFEIKCDAAQDSKWCNPGSPSILVTATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  143

Query  326  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  147
            LKIA YRAGIVPVNFRRIPCRKQGG+RFT+NGFRYFNLVLVTNVAGAGDI +V +KG+ T
Sbjct  144  LKIAQYRAGIVPVNFRRIPCRKQGGMRFTINGFRYFNLVLVTNVAGAGDIVRVSIKGTNT  203

Query  146  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
             WI++SRNWGQNW+++A LVGQ+LSFRV A DRR  TS NVAP
Sbjct  204  QWISMSRNWGQNWQSNAVLVGQALSFRVTAGDRRTSTSINVAP  246



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   380 bits (976),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 202/222 (91%), Gaps = 0/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS GYGVNNAALSTALFNNGLSC
Sbjct  22   KVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYSAGYGVNNAALSTALFNNGLSC  81

Query  497  GACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKI  318
            GACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFDLA PMFLK 
Sbjct  82   GACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFDLAEPMFLKF  141

Query  317  AAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWI  138
            A YRAGIVPV +RR+PC+K GGI+FT+NGF YFN+V+VTNVAGAGDIQKV VKG+ T W+
Sbjct  142  AQYRAGIVPVTYRRVPCKKSGGIKFTINGFNYFNMVIVTNVAGAGDIQKVFVKGTNTKWM  201

Query  137  TLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT++NVAP+N
Sbjct  202  AMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTTYNVAPSN  243



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   380 bits (975),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  21   RIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  80

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D R C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  81   GACFELKCASDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  140

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAG G+I ++ VKG+ T W
Sbjct  141  IAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGVGNIVRLGVKGTHTSW  200

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+APAN
Sbjct  201  MSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTSWNIAPAN  243



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   380 bits (976),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 198/221 (90%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  26   KIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  85

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  86   GACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK  145

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKG++T W
Sbjct  146  IGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGTKTEW  205

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            + +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAP
Sbjct  206  VRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAP  246



>ref|XP_010557251.1| PREDICTED: expansin-A6-like [Tarenaya hassleriana]
Length=259

 Score =   380 bits (975),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 204/230 (89%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L+ +     PGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+ AALSTAL
Sbjct  16   LTSMSEARIPGVYRGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVSTAALSTAL  75

Query  518  FNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNG  CGACFEIKC+ND + C  G+PSIF+TATNFCPPNFALP+DNGGWCNPPRPHFDL
Sbjct  76   FNNGYRCGACFEIKCANDPTWCHSGSPSIFITATNFCPPNFALPSDNGGWCNPPRPHFDL  135

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFL+IA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+TNVAGAGDI +V V
Sbjct  136  AMPMFLRIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLITNVAGAGDIVRVSV  195

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ P++
Sbjct  196  KGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPSH  245



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   380 bits (975),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   KIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC  D + C+PGNP+I +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            +A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKG+ T W
Sbjct  143  LAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAPAN
Sbjct  203  LSMSRNWGQNWQSNAQLVGQALSFRVTGSDRRTSTSWNVAPAN  245



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   379 bits (974),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   KIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC  D + C+PGNP+I +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            +A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKG+ T W
Sbjct  143  LAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAPAN
Sbjct  203  LSMSRNWGQNWQSNAQLVGQALSFRVTGSDRRTSTSWNVAPAN  245



>gb|ABK93541.1| unknown [Populus trichocarpa]
Length=258

 Score =   379 bits (974),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGDI KV VKG RT W
Sbjct  142  IAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGCRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P+N
Sbjct  202  MSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSN  244



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   379 bits (974),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 200/220 (91%), Gaps = 1/220 (0%)
 Frame = -2

Query  668  GVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSCGAC  489
            GVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SCGAC
Sbjct  25   GVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSCGAC  84

Query  488  FEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAA  312
            FEIKC++D S C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLKIA 
Sbjct  85   FEIKCADDPSWCHRGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAE  144

Query  311  YRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWITL  132
            YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +V VKGSRT W+ L
Sbjct  145  YRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLITNVAGAGDIVRVSVKGSRTGWMPL  204

Query  131  SRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWNV PAN
Sbjct  205  SRNWGQNWQSNAVLVGQSLSFRVTGSDRRTATSWNVVPAN  244



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   379 bits (974),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 204/231 (88%), Gaps = 3/231 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            LS   M E   PG+Y+GG WQ+AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  18   LSATRMAEARIPGIYTGGPWQSAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALST  77

Query  524  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNG SCGACFEIKC+ND + C  G+ SIFVTATNFCPPN+A P+DNGGWCNPPRPHF
Sbjct  78   ALFNNGFSCGACFEIKCANDPQWCHSGSSSIFVTATNFCPPNYAQPSDNGGWCNPPRPHF  137

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  138  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIVRV  197

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPA  15
             VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ PA
Sbjct  198  SVKGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPA  248



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   379 bits (974),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            +++     PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   TIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            NNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDLA
Sbjct  79   NNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLA  138

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI K  VK
Sbjct  139  MPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKAYVK  198

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            G+ TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  199  GTNTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPSN  247



>gb|ABO30976.2| alpha expansin protein 1 [Calotropis procera]
Length=260

 Score =   379 bits (973),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 207/234 (88%), Gaps = 5/234 (2%)
 Frame = -2

Query  698  LSLLFM---LEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS-QGYGVNNAAL  531
            LSLL +      PGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYS   YGVN AAL
Sbjct  13   LSLLVVGIQARIPGVYSGGTWQRAHATFYGGSDASGTMGGACGYGNLYSPNEYGVNTAAL  72

Query  530  STALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRP  354
            STALFNNGLSCGACFEIKC+N+ + C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPRP
Sbjct  73   STALFNNGLSCGACFEIKCANEPQWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRP  132

Query  353  HFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQ  174
            HFDLAMPMFL+IA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL++NVAGAGDI 
Sbjct  133  HFDLAMPMFLRIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLISNVAGAGDIV  192

Query  173  KVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +V VKG+RT W+++SRNWGQNW+++A LVGQSLSFRV  SDR   TSWN+ PAN
Sbjct  193  RVSVKGTRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVPGSDRPPSTSWNIVPAN  246



>emb|CAA59470.1| orf [Pisum sativum]
Length=258

 Score =   379 bits (972),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 197/221 (89%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG W +AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGGPWTSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC  D R C+PGNPSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFELKCDQDPRWCNPGNPSILITATNFCPPNFAEPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKG+ T W
Sbjct  142  IAQYRAGIVPVAYRRVPCRKAGGIRFTINGFRYFNLVLITNVAGAGDIVRVSVKGTNTAW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            +T+SRNWGQNW+++A  VGQ+LSFRV  SDRR  TSWNVAP
Sbjct  202  MTMSRNWGQNWQSNAVFVGQALSFRVTGSDRRTSTSWNVAP  242



>ref|XP_007132063.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
 gb|ESW04057.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
Length=259

 Score =   379 bits (972),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/230 (81%), Positives = 209/230 (91%), Gaps = 3/230 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL +M+E   PG+YSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  14   ISLTWMVEARIPGIYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  73

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHF
Sbjct  74   ALFNNGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHF  133

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV FRR+PCRK GGIRFTVNGFRYFNLVLV+NVAGAGDI ++
Sbjct  134  DLAMPMFLKIAEYRAGIVPVAFRRVPCRKHGGIRFTVNGFRYFNLVLVSNVAGAGDIVRI  193

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
             VKGSRT W+ +SRNWGQNW+++A LVGQ+LSFRV +SD R  TSWN+AP
Sbjct  194  YVKGSRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTSSDSRTSTSWNIAP  243



>gb|KJB08889.1| hypothetical protein B456_001G111100 [Gossypium raimondii]
Length=260

 Score =   379 bits (972),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 206/231 (89%), Gaps = 3/231 (1%)
 Frame = -2

Query  695  SLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            S ++M E   PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTA
Sbjct  16   STMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTA  75

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFD
Sbjct  76   LFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFD  135

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAG+G+I K  
Sbjct  136  LAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGSGNIVKAS  195

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W+++ RNWGQNW+++  LVGQSLSFRV  SDRR  TSWN+ PA+
Sbjct  196  VKGSRTGWMSMGRNWGQNWQSNVVLVGQSLSFRVTGSDRRTSTSWNIVPAH  246



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   378 bits (971),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 204/232 (88%), Gaps = 3/232 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL  ++E   PG Y GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  11   ISLFSVVEARIPGNYGGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  70

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFN G SCGACFEIKC+ND + C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPR HF
Sbjct  71   ALFNKGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYALPNDNGGWCNPPRTHF  130

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV +RR+PCRKQGG+RFT+NGFRYFNLVL++NVAGAGDI +V
Sbjct  131  DLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGVRFTINGFRYFNLVLISNVAGAGDIVRV  190

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             VKGSRT W+++SRNWGQNW+++  LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  191  SVKGSRTGWMSMSRNWGQNWQSNTVLVGQSLSFRVTGSDRRTSTSWNIVPAN  242



>ref|XP_003552064.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   379 bits (972),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGV++GGAWQ AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC  D R C+PG+PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCDQDPRWCNPGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA Y+AGIVPV++RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +V VKGS+T W
Sbjct  142  IAQYKAGIVPVSYRRVPCRKVGGIRFTINGFRYFNLVLITNVAGAGDIARVSVKGSKTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             ++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAP++
Sbjct  202  NSMSRNWGQNWQSNANLVGQALSFRVTGSDRRTSTSWNVAPSH  244



>emb|CAA04385.1| Expansin [Brassica napus]
Length=260

 Score =   378 bits (971),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 203/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W+TAHATFYGG+DASGTMG ACGYGNLY++GYGVN AALSTALFNNG SC
Sbjct  24   RIPGVYSGGGWETAHATFYGGSDASGTMGSACGYGNLYTKGYGVNTAALSTALFNNGFSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAGAG+I ++ VKG+RT W
Sbjct  144  IAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAGAGNIVRLSVKGTRTSW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            I++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TSWN+AP +
Sbjct  204  ISMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTSWNIAPTH  246



>ref|XP_006339024.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=257

 Score =   378 bits (970),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  668  GVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSCGAC  489
            GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS GYGVNNAALST LFN+GLSCGAC
Sbjct  25   GVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYSTGYGVNNAALSTVLFNSGLSCGAC  84

Query  488  FEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAAY  309
            FEIKC++++ C+PGNPSIFVT TNFCPPN+ALPNDNGGWCNPPRPHFDL+MP+FL+IA Y
Sbjct  85   FEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDNGGWCNPPRPHFDLSMPVFLQIAQY  144

Query  308  RAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWITLS  129
            RAGIVPV +RR+PC+KQ GIRFT+NGF YFN+++VTNVAGAGDIQ+V VKG+ T WI +S
Sbjct  145  RAGIVPVTYRRVPCKKQEGIRFTINGFNYFNMIIVTNVAGAGDIQQVQVKGTNTKWIIMS  204

Query  128  RNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            RNWGQNW+++A L GQ+LSF+V+ SDRR VTS+NVAP+N
Sbjct  205  RNWGQNWQSNALLTGQALSFKVKTSDRRYVTSYNVAPSN  243



>gb|AAV85475.1| expansin [Populus tomentosa]
Length=258

 Score =   377 bits (969),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+G  WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGADWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCR+ GGIRFT+NG RYFNLVL+TNVAGAGD+ KV VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVPCREPGGIRFTINGHRYFNLVLITNVAGAGDLVKVSVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFRV  SDRR  TSWNV P N
Sbjct  202  MSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPPN  244



>ref|XP_010937609.1| PREDICTED: expansin-A4 [Elaeis guineensis]
Length=260

 Score =   377 bits (969),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 200/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+G +WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+GLSC
Sbjct  24   RIPGVYTGESWQKAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGLSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D + C  G PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFEIKCADDPQWCHHGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +V VKGS T W
Sbjct  144  IAQYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVLITNVAGAGDIVRVSVKGSHTGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV ASD R+ TSWN+ PAN
Sbjct  204  MPMSRNWGQNWQSNAVLVGQSLSFRVTASDHRRSTSWNIVPAN  246



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   378 bits (970),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 198/221 (90%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  27   KIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  86

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  87   GACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK  146

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLVLVTNVAGAGDI  V VKGS+T W
Sbjct  147  IGLYRAGIVPVSYRRVPCRKLGGIRFTINGFRYFNLVLVTNVAGAGDINGVSVKGSKTDW  206

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            + +SRNWGQNW+++A L+GQ+LSFRV ASDRR  TSWNVAP
Sbjct  207  VRMSRNWGQNWQSNAVLIGQALSFRVTASDRRSSTSWNVAP  247



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   377 bits (969),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            +++     PGVY+G AWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   TIVVDARIPGVYTGAAWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            NNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDLA
Sbjct  79   NNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLA  138

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI K  VK
Sbjct  139  MPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKAYVK  198

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            G+ TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  199  GTNTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPSN  247



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   377 bits (969),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSG  W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+GLSC
Sbjct  22   RIPGVYSGSDWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNSGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+ CRK GGIRFT+NGFRYFNLVL++NVAGAGDI KV VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVSCRKPGGIRFTINGFRYFNLVLISNVAGAGDIVKVWVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQ+LSFRV +SDRR  TSWNV PAN
Sbjct  202  MSMSRNWGQNWQSNSILVGQALSFRVTSSDRRTSTSWNVVPAN  244



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   377 bits (969),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 205/233 (88%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            L  LFM      PGVY+GGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  12   LLSLFMAABARIPGVYTGGAWEGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  71

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC +D R C PGNPSIFVTATNFCPPNFA P+D+GGWCNPPR H
Sbjct  72   TALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFAQPSDDGGWCNPPRTH  131

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGDI +
Sbjct  132  FDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGAGDIVR  191

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKG+ T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPA+
Sbjct  192  VSVKGANTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSLNVAPAH  244



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   377 bits (968),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 205/233 (88%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            L  LFM      PGVY+GG W+ AHATFYGG+DASGTMGGACGYGNLYS+GYGVN AALS
Sbjct  12   LLSLFMAANARIPGVYTGGPWEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAALS  71

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+ALPND+GGWCNPPR H
Sbjct  72   TALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPRTH  131

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFL+IA Y+AGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL+TNVAGAGDI +
Sbjct  132  FDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDIVR  191

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKG+ T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAP +
Sbjct  192  VSVKGANTEWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSWNVAPGH  244



>emb|CDY47883.1| BnaA07g14280D [Brassica napus]
Length=260

 Score =   377 bits (968),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  24   RIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGYSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK GG+RFT+NGFRYFNLVLVTNVAG G+I ++ VKG+RT W
Sbjct  144  IAEYRAGIVPVSFRRVPCRKIGGMRFTINGFRYFNLVLVTNVAGVGNIVRLSVKGTRTSW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +T+SRNWGQNW++++ LVGQ+LSFRV  SDRR  TSWN+APA+
Sbjct  204  MTMSRNWGQNWQSNSVLVGQALSFRVTGSDRRSSTSWNIAPAH  246



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   377 bits (968),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 198/221 (90%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  27   KIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  86

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  87   GACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK  146

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNL+LVTNVAGAGDI  V VKGS+T W
Sbjct  147  IGLYRAGIVPVSYRRVPCRKLGGIRFTINGFRYFNLILVTNVAGAGDINGVSVKGSKTDW  206

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            + +SRNWGQNW+++A L+GQ+LSFRV ASDRR  TSWNVAP
Sbjct  207  VRMSRNWGQNWQSNAVLIGQALSFRVTASDRRSSTSWNVAP  247



>ref|XP_002309061.1| expansin family protein [Populus trichocarpa]
 gb|ABK94860.1| unknown [Populus trichocarpa]
 gb|EEE92584.1| expansin family protein [Populus trichocarpa]
Length=260

 Score =   377 bits (968),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 205/233 (88%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            L+ +F+L     PGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  14   LTSVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  73

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC++D R C+PGNPSI VTATNFCPPNFA P+DNGGWCNPPRPH
Sbjct  74   TALFNNGLSCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNFAQPSDNGGWCNPPRPH  133

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA YRAGIVPV  RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI  
Sbjct  134  FDLAMPMFLKIAQYRAGIVPVAHRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVN  193

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V +KGS T W+++SRNWGQNW+++A LVGQSLSFRVR SD R  TS NVA  N
Sbjct  194  VWIKGSETDWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDGRTSTSKNVASPN  246



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   377 bits (968),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 200/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+SC
Sbjct  22   KIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFDLAMP+FLK
Sbjct  82   GACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPRAHFDLAMPVFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  142  IAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            ++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  202  MSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  244



>ref|XP_008457477.1| PREDICTED: expansin-A4-like [Cucumis melo]
Length=259

 Score =   377 bits (968),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGVYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVL+TNVAGAGDI KV VKG+RT W
Sbjct  143  IAEYRAGIVPVAYRRVACRKPGGIRFTIHGFRYFNLVLITNVAGAGDIVKVSVKGTRTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAP++
Sbjct  203  MSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSINVAPSD  245



>ref|XP_011019858.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=260

 Score =   377 bits (967),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = -2

Query  692  LLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFN  513
            +L     PGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN
Sbjct  19   VLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFN  78

Query  512  NGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAM  336
            NGLSCGACFEIKC++D R C+PGNPSIFVTATNFCPPNFA  +DNGGWCNPPRPHFDLAM
Sbjct  79   NGLSCGACFEIKCADDPRWCNPGNPSIFVTATNFCPPNFAQASDNGGWCNPPRPHFDLAM  138

Query  335  PMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKG  156
            PMFLKIA YRAGIVPV  RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI  V +KG
Sbjct  139  PMFLKIAQYRAGIVPVAHRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVNVWIKG  198

Query  155  SRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            S+T W+++SRNWGQNW+++A LVGQSLSFRVR SD R  TS NVA  N
Sbjct  199  SKTDWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDGRTSTSKNVASPN  246



>ref|XP_006294816.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
 gb|EOA27714.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
Length=262

 Score =   377 bits (967),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 196/221 (89%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            +  GVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  26   KIAGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGYSC  85

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PGNPSI VTATNFCPPNFA  +DNGGWCNPPR HFDLAMPMFLK
Sbjct  86   GACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQASDNGGWCNPPREHFDLAMPMFLK  145

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGDI  V VKGS+T W
Sbjct  146  IGLYRAGIVPVSYRRVPCRKVGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDW  205

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            + +SRNWGQNW+++A L+GQSLSFRV ASDRR  TSWNVAP
Sbjct  206  VRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAP  246



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   377 bits (967),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 200/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG+YSG AWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  25   RIPGIYSGSAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  84

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPR HFDLAMPMFLK
Sbjct  85   GACFEIKCANDPQWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRAHFDLAMPMFLK  144

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVP+++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  145  IAEYRAGIVPISYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTGW  204

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            ++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++
Sbjct  205  MSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSS  247



>ref|XP_010111142.1| hypothetical protein L484_010756 [Morus notabilis]
 gb|EXC30507.1| hypothetical protein L484_010756 [Morus notabilis]
Length=258

 Score =   376 bits (966),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   KIPGNYGGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND + C  G+PSI VTATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMFLK
Sbjct  82   GACFEIKCANDPQWCHSGSPSILVTATNFCPPNYALPNDNGGWCNPPRSHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRKQGG+RFT+NGF+YFNLVL+TNVAGAGDI +  VKGS+T W
Sbjct  142  IAEYRAGIVPVTYRRVPCRKQGGVRFTINGFKYFNLVLITNVAGAGDIVRASVKGSKTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW++++ LVGQSLSFR+  SDRR  T+WN+ P++
Sbjct  202  MSMSRNWGQNWQSNSVLVGQSLSFRITGSDRRTSTAWNIVPSH  244



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   376 bits (966),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -2

Query  695  SLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  516
            +++     PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   TIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  515  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  339
            N+GLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA P+D+GGWCNPPR HFDLA
Sbjct  79   NSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQPSDDGGWCNPPRTHFDLA  138

Query  338  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVK  159
            MPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNLVL+ NVAGAGDI K  VK
Sbjct  139  MPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNLVLIHNVAGAGDIVKAYVK  198

Query  158  GSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            G+ TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  199  GTNTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNIVPSN  247



>gb|EPS64820.1| hypothetical protein M569_09956, partial [Genlisea aurea]
Length=260

 Score =   376 bits (966),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 203/224 (91%), Gaps = 4/224 (2%)
 Frame = -2

Query  671  PGVY-SGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSCG  495
            PGVY +GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G SCG
Sbjct  25   PGVYYTGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNDGYSCG  84

Query  494  ACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFL  324
            ACFEIKC N+     C PG+PS+FVTATNFCPPN+ALPND GGWCNPPRPHFDLAMPMFL
Sbjct  85   ACFEIKCRNEPNWHWCHPGSPSVFVTATNFCPPNYALPNDGGGWCNPPRPHFDLAMPMFL  144

Query  323  KIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTP  144
            +IA YRAGIVPV+FRR+ CRK+GGIRFTVNGFRYFNLVL+TNVAGAGD+++  VKGSR+ 
Sbjct  145  QIAEYRAGIVPVSFRRVACRKRGGIRFTVNGFRYFNLVLITNVAGAGDVRRTWVKGSRSG  204

Query  143  WITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            W+ +SRNWGQNW+++A LVGQSLSFRV+ASD R VTSWN APAN
Sbjct  205  WMGMSRNWGQNWQSNAVLVGQSLSFRVQASDGRVVTSWNAAPAN  248



>gb|KFK36651.1| alpha-expansin 4 [Arabis alpina]
Length=261

 Score =   376 bits (965),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 197/221 (89%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVY+GG WQ AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  25   KIPGVYTGGPWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  84

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLAMPMFLK
Sbjct  85   GACFEMKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK  144

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            I  YRAGIVPV++RR+PCRK GGIRFTVNGF+YFNLVLVTNVAGAGD+  V +KGS+T W
Sbjct  145  IGIYRAGIVPVSYRRVPCRKLGGIRFTVNGFKYFNLVLVTNVAGAGDLTGVSIKGSKTDW  204

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            + +SRNWGQNW+++A  +GQSLSFRV ASD R  TSWNVAP
Sbjct  205  VRMSRNWGQNWQSNAVFIGQSLSFRVTASDHRSSTSWNVAP  245



>ref|XP_004154408.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004173564.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN65728.1| hypothetical protein Csa_1G522540 [Cucumis sativus]
Length=259

 Score =   376 bits (965),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVLVTNVAGAGDI KV VKG+RT W
Sbjct  143  IAEYRAGIVPVAYRRVGCRKPGGIRFTIHGFRYFNLVLVTNVAGAGDIVKVSVKGTRTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAP++
Sbjct  203  MSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSINVAPSD  245



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   375 bits (964),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 204/231 (88%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L   + PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  14   VLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  73

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFD
Sbjct  74   LFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFD  133

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  
Sbjct  134  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTS  193

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  194  VKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  244



>ref|XP_008799850.1| PREDICTED: expansin-A6-like [Phoenix dactylifera]
Length=260

 Score =   375 bits (964),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 199/223 (89%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+G SC
Sbjct  24   RIPGVYTGGPWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGQSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC  D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFEIKCGEDLKWCHHGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVLVTNVAGAGDI ++ VKGSRT W
Sbjct  144  IAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVLVTNVAGAGDIVRLSVKGSRTGW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFR+ ASDRR  TSWN+ PA+
Sbjct  204  MPMSRNWGQNWQSNAVLVGQSLSFRLTASDRRTSTSWNIVPAH  246



>gb|ACT67493.1| expansin A1 [Raphanus sativus]
Length=258

 Score =   375 bits (964),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 204/231 (88%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L   + PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  14   VLFSLADAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  73

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFD
Sbjct  74   LFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFD  133

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  
Sbjct  134  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTS  193

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  194  VKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  244



>gb|ACA05164.1| expansin 1 [Dimocarpus longan]
Length=256

 Score =   375 bits (963),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 203/233 (87%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            LSLLF+    + PGVY+G  W++ HATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  10   LSLLFLTANAKIPGVYTGSPWESGHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  69

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFN+GLSCGACFE+KC  D R C PGNPSI VTATNFCPPNFA P+DNGGWCNPPR H
Sbjct  70   TALFNSGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDNGGWCNPPRTH  129

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMF  IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI K
Sbjct  130  FDLAMPMFFAIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVK  189

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKGS T W+T+SRNWGQNW+++A L+GQ+LSFRV  SDRR  TSWNVA +N
Sbjct  190  VSVKGSNTGWLTMSRNWGQNWQSNAVLLGQALSFRVTGSDRRTSTSWNVAKSN  242



>ref|XP_011094866.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=262

 Score =   375 bits (963),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 200/225 (89%), Gaps = 3/225 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  24   RIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  83

Query  497  GACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  327
            GACFEIKC    + + C+PG+PSI VTATNFCPPN+ALPNDNGGWCNPPR HFDLAMPMF
Sbjct  84   GACFEIKCDAAQDPKWCNPGSPSILVTATNFCPPNYALPNDNGGWCNPPREHFDLAMPMF  143

Query  326  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  147
            LKIA Y AGIVPVNFRRIPCRKQGGIRFT+NGFRYFNLVLVTNV GAGDI ++ +KG+ T
Sbjct  144  LKIAQYSAGIVPVNFRRIPCRKQGGIRFTINGFRYFNLVLVTNVGGAGDIVRLSIKGANT  203

Query  146  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             W+ +SRNWGQNW+++A +VGQ+LSFRV ASD R+ TS NVAPAN
Sbjct  204  QWLPMSRNWGQNWQSNADIVGQALSFRVTASDGRKSTSMNVAPAN  248



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   375 bits (963),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 200/220 (91%), Gaps = 1/220 (0%)
 Frame = -2

Query  668  GVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSCGAC  489
            GV++GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+G SCGAC
Sbjct  25   GVFTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGQSCGAC  84

Query  488  FEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAA  312
            FEIKC ++ + C PG+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLKIA 
Sbjct  85   FEIKCVDEPQWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAE  144

Query  311  YRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWITL  132
            YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +V VKGSRT W+ +
Sbjct  145  YRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLITNVAGAGDIVRVSVKGSRTGWMPM  204

Query  131  SRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  205  SRNWGQNWQSNAVLVGQSLSFRVTGSDRRTTTSWNIVPAN  244



>emb|CDY20467.1| BnaC04g05770D [Brassica napus]
Length=256

 Score =   375 bits (962),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 200/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+SC
Sbjct  20   KIPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSC  79

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMP+FLK
Sbjct  80   GACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFLK  139

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  140  IAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGSRTGW  199

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            ++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  200  MSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  242



>ref|XP_009124371.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A6 [Brassica rapa]
Length=260

 Score =   375 bits (962),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  24   RIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGYSC  83

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+ C++D + C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  84   GACFELXCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  143

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK GG+RFT+NGFRYFNLVLVTNVAG G+I ++ VKG+RT W
Sbjct  144  IAEYRAGIVPVSFRRVPCRKIGGMRFTINGFRYFNLVLVTNVAGVGNIVRLSVKGTRTSW  203

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +T+SRNWGQNW++++ LVGQ+LSFRV  SDRR  TSWN+APA+
Sbjct  204  MTMSRNWGQNWQSNSVLVGQALSFRVTGSDRRSSTSWNIAPAH  246



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   375 bits (962),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 204/231 (88%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L   + PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  14   VLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  73

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFD
Sbjct  74   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFD  133

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  
Sbjct  134  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTS  193

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSW++ P+N
Sbjct  194  VKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIVPSN  244



>ref|XP_007163413.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
 gb|ESW35407.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
Length=258

 Score =   374 bits (961),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PG +SGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG SC
Sbjct  22   KIPGAFSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACF+IKC++D + C PGNPSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFQIKCTHDPKWCLPGNPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+ CRK+GG+RFT+NGFRYFNL+L+TNV GAGDI +  +KGSR+ W
Sbjct  142  IAQYRAGIVPVSYRRVGCRKEGGMRFTMNGFRYFNLILITNVGGAGDIVRASLKGSRSGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++  LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  202  MSMSRNWGQNWQSNTVLVGQSLSFRVTGSDRRSSTSWNIVPSN  244



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   374 bits (960),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 199/223 (89%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN+G+SC
Sbjct  22   RIPGVYSSGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGMSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPP PHFDLAMPMFLK
Sbjct  82   GACFEIKCADDPQWCHSGSPSIFITATNFCPPNYALPSDDGGWCNPPXPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ PAN
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPAN  244



>ref|XP_002878036.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54295.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   374 bits (960),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 201/233 (86%), Gaps = 6/233 (3%)
 Frame = -2

Query  692  LLFMLEF-----PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            L  +L F     PGVYSGG+WQTAHATFYGG DASGTMGGACGYGNLYSQGYG N AALS
Sbjct  14   LFLLLSFTDAGIPGVYSGGSWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALS  73

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFN+G SCGACFEIKC ND + C PGNPS+FVTATNFCPPN A P+DNGGWCNPPR H
Sbjct  74   TALFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSH  133

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMP+FLKIA YRAGIVP+++RR+ CRK GGIRFT+NG RYFNLVL+TNVAGAGDI +
Sbjct  134  FDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDILR  193

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
              VKGS+T W++L+RNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+AP+N
Sbjct  194  TSVKGSKTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTTSDRRTSTSWNIAPSN  246



>gb|EPS67093.1| hypothetical protein M569_07682, partial [Genlisea aurea]
Length=261

 Score =   374 bits (960),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 3/225 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+G  W++AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALFN GLSC
Sbjct  23   RIPGVYAGTGWESAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALFNTGLSC  82

Query  497  GACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  327
            GACFEI+C    + R CSPG PSI VTATNFCPPN+ALP+D GGWCNPPRPHFDLAMPMF
Sbjct  83   GACFEIRCDESQDGRWCSPGRPSISVTATNFCPPNYALPSDKGGWCNPPRPHFDLAMPMF  142

Query  326  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  147
            LKIA YRAGIV VNFRRIPCRK GGIRFTVNGFRYFNLVL+TNVAGAGDI +  VKG+RT
Sbjct  143  LKIAEYRAGIVAVNFRRIPCRKAGGIRFTVNGFRYFNLVLITNVAGAGDIVRASVKGTRT  202

Query  146  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             W+ +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TS +VAPA+
Sbjct  203  EWMPMSRNWGQNWQSNAILVGQALSFRVAASDRRTTTSIDVAPAD  247



>ref|XP_002463623.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
 gb|EER90621.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
Length=262

 Score =   374 bits (960),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 196/225 (87%), Gaps = 3/225 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN GLSC
Sbjct  24   RIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGLSC  83

Query  497  GACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  327
            GACFE+KC N    R C PG+PSI VTATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPMF
Sbjct  84   GACFELKCENQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMF  143

Query  326  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  147
            L IA YRAGIVPV++RR+PCRK GG+RFT+NGFRYFNLVL+TNVAGAGDI +  VK S T
Sbjct  144  LHIAEYRAGIVPVSYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKASST  203

Query  146  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             W+T+SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN AP N
Sbjct  204  GWLTMSRNWGQNWQSNAILVGQALSFRVTGSDRRTSTSWNAAPRN  248



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   374 bits (959),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 203/231 (88%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L   + PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  14   VLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  73

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFD
Sbjct  74   LFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFD  133

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNL L+TNVAGAGDI +  
Sbjct  134  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLFLITNVAGAGDIVRTS  193

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  194  VKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  244



>ref|XP_009143296.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=256

 Score =   373 bits (958),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 200/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
            + PGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTALFNNG+SC
Sbjct  20   KIPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSC  79

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFDLAMP+FLK
Sbjct  80   GACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPRAHFDLAMPVFLK  139

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKG+RT W
Sbjct  140  IAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTSVKGTRTGW  199

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            ++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  200  MSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  242



>emb|CDY24952.1| BnaC03g22200D [Brassica napus]
Length=258

 Score =   373 bits (958),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 202/231 (87%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            LLF L     PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  14   LLFNLADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  73

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFD
Sbjct  74   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFD  133

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG +YFNLVL+TNVAGAGDI +  
Sbjct  134  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHQYFNLVLITNVAGAGDIVRTS  193

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  194  VKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  244



>ref|XP_009388613.1| PREDICTED: expansin-A7 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   373 bits (958),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 198/222 (89%), Gaps = 1/222 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SC
Sbjct  22   RIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            G+CFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDL+MPMFLK
Sbjct  82   GSCFEIKCADDPRWCHGGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLSMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGD+ +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNLVLITNVAGAGDLVRASVKGSRTEW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPA  15
            + +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPS  243



>gb|KEH22886.1| expansin-A1-like protein [Medicago truncatula]
Length=258

 Score =   373 bits (958),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 195/221 (88%), Gaps = 1/221 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSGG W +AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYSGGPWTSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC  D R C+PGNPSI +TATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFELKCDQDPRWCNPGNPSILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVLVTNVAGAGDI +V VKG+ T W
Sbjct  142  IAQYRAGIVPVAYRRVPCRKAGGIRFTINGFRYFNLVLVTNVAGAGDIIRVSVKGTNTAW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAP  18
            + +SRNWGQNW+++A  VGQ+LSFRV  SDRR  TS N+AP
Sbjct  202  MPMSRNWGQNWQSNAVFVGQALSFRVTGSDRRTSTSMNIAP  242



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   373 bits (958),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 204/234 (87%), Gaps = 8/234 (3%)
 Frame = -2

Query  689  LFMLEF-------PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAAL  531
            LF+L F       PGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AAL
Sbjct  14   LFVLFFSFADARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAAL  73

Query  530  STALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRP  354
            STALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCNPPR 
Sbjct  74   STALFNNGFSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRA  133

Query  353  HFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQ  174
            HFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI 
Sbjct  134  HFDLAMPMFLKLAEYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIV  193

Query  173  KVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +  VKGS+T W+++SRNWGQNW+++A L GQSLSFRV  SDRR  TSWN+ P++
Sbjct  194  RASVKGSKTGWMSMSRNWGQNWQSNAVLAGQSLSFRVTGSDRRSSTSWNIVPSH  247



>gb|AAL31477.1|AF319472_1 alpha-expansin 6 precursor [Cucumis sativus]
Length=259

 Score =   373 bits (957),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 200/223 (90%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  23   RIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  82

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  83   GACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLK  142

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVLVTNVAGAGDI KV VKG+RT W
Sbjct  143  IAEYRAGIVPVAYRRVGCRKPGGIRFTIHGFRYFNLVLVTNVAGAGDIVKVSVKGTRTGW  202

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            +++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS N AP++
Sbjct  203  MSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSINGAPSD  245



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   373 bits (957),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 202/231 (87%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            LLF L     PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  14   LLFNLADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  73

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFD
Sbjct  74   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFD  133

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  
Sbjct  134  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTS  193

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSW++ P+N
Sbjct  194  VKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIVPSN  244



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   373 bits (957),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 203/238 (85%), Gaps = 9/238 (4%)
 Frame = -2

Query  698  LSLLFMLEF--------PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  543
            L + FML          PGVY+GG+W+ AHATFYGG DASGTMGGACGYGNLYSQGYGVN
Sbjct  7    LYIAFMLSLFMAANARIPGVYTGGSWEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVN  66

Query  542  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  366
             AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA P+D+GGWCN
Sbjct  67   TAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCN  126

Query  365  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  186
            PPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGA
Sbjct  127  PPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGA  186

Query  185  GDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            GDI +V VKG  T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPA+
Sbjct  187  GDIVRVSVKGGNTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSHNVAPAD  244



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   372 bits (956),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 202/230 (88%), Gaps = 1/230 (0%)
 Frame = -2

Query  698  LSLLFMLEFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTAL  519
            L +L     PG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTAL
Sbjct  15   LLILANARIPGPYTGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  74

Query  518  FNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDL  342
            FNNGLSCGACFEI+C +D R C+PG PSIFVTATNFCPPNFA P+DNGGWCNPPR HFDL
Sbjct  75   FNNGLSCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDL  134

Query  341  AMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLV  162
            AMPMFLKIA Y+AGIVPV++RR+PCRK+GGIRFT+NG +YFNLVL+TNVAGAGD+  V V
Sbjct  135  AMPMFLKIAEYKAGIVPVSYRRVPCRKRGGIRFTINGHKYFNLVLITNVAGAGDVVSVSV  194

Query  161  KGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            KG+ T W+ +SRNWGQNW++++ LVGQ+LSFRVR SDRR  T++NVAPAN
Sbjct  195  KGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPAN  244



>emb|CDY69611.1| BnaCnng64440D [Brassica napus]
Length=258

 Score =   372 bits (956),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 202/231 (87%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            LLF L     PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  14   LLFNLADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  73

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +DNGGWCNPPR HFD
Sbjct  74   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASDNGGWCNPPREHFD  133

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  
Sbjct  134  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRTS  193

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSW++ P+N
Sbjct  194  VKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWSIVPSN  244



>ref|NP_181500.1| expansin A4 [Arabidopsis thaliana]
 sp|O48818.1|EXPA4_ARATH RecName: Full=Expansin-A4; Short=AtEXPA4; AltName: Full=Alpha-expansin-4; 
Short=At-EXP4; Short=AtEx4; AltName: Full=Ath-ExpAlpha-1.6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK95263.1|AF410277_1 At2g39700/F17A14.7 [Arabidopsis thaliana]
 gb|AAB97125.1| putative expansin [Arabidopsis thaliana]
 gb|AAL32761.1| putative expansin [Arabidopsis thaliana]
 gb|AAM13337.1| putative expansin [Arabidopsis thaliana]
 gb|AEC09708.1| expansin A4 [Arabidopsis thaliana]
Length=257

 Score =   372 bits (956),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 202/231 (87%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L     PG+YSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  13   VLFSLADARIPGIYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  72

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFD
Sbjct  73   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFD  132

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  
Sbjct  133  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRAS  192

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+ P+N
Sbjct  193  VKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNMVPSN  243



>gb|KJB46593.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=293

 Score =   374 bits (959),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 182/254 (72%), Positives = 206/254 (81%), Gaps = 32/254 (13%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMG-------------------------------  591
            + PGVYS G+W+TAHATFYGG+DASGTMG                               
Sbjct  26   KIPGVYSTGSWETAHATFYGGSDASGTMGISQITLPSPPSKSHIFMTLHLIVFFFCCFLG  85

Query  590  GACGYGNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNF  414
            GACGYGNLYSQGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNF
Sbjct  86   GACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNF  145

Query  413  CPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVN  234
            CPPNFALP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GGIRFTVN
Sbjct  146  CPPNFALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKHGGIRFTVN  205

Query  233  GFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRAS  54
            GFRYFNLVL+TNVAGAGD+ KV +KG++T W+++SRNWGQNW+++A L+GQ+LSFRV  S
Sbjct  206  GFRYFNLVLITNVAGAGDLVKVSIKGTKTGWMSMSRNWGQNWQSNAVLIGQALSFRVTGS  265

Query  53   DRRQVTSWNVAPAN  12
            D+R  TSWNVAP N
Sbjct  266  DKRTSTSWNVAPPN  279



>ref|XP_002881669.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57928.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   372 bits (955),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 201/231 (87%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L     PGVYSG AWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  13   VLFSLADARIPGVYSGSAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  72

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFD
Sbjct  73   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFD  132

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  
Sbjct  133  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRAS  192

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  193  VKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNMVPSN  243



>dbj|BAE06067.1| expansin [Sagittaria pygmaea]
Length=266

 Score =   372 bits (956),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 195/223 (87%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVYSG  WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN GLSC
Sbjct  30   RVPGVYSGSEWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNQGLSC  89

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ND + C  G PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  90   GACFEIKCANDPQWCHGGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLK  149

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV +RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGDI +V VKG++T W
Sbjct  150  IAQYRAGIVPVQYRRVPCRKSGGIRFTINGHRYFNLVLITNVAGAGDIVRVSVKGTKTGW  209

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQ+LSFRV  SD R  TSWNV PAN
Sbjct  210  MPMSRNWGQNWQSNAVLVGQALSFRVTGSDHRTSTSWNVVPAN  252



>gb|AAQ08016.1| expansin [Melilotus albus]
Length=257

 Score =   372 bits (955),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/235 (77%), Positives = 204/235 (87%), Gaps = 6/235 (3%)
 Frame = -2

Query  698  LSLLFM---LEFPGVYS--GGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAA  534
            +S+LF    L   G Y   GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AA
Sbjct  9    ISILFFVLSLCLKGTYGDYGGGWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  68

Query  533  LSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPR  357
            LSTALFN+GLSCGACFE+KCSND S C PG+PSI VTATNFCPPNFA P+DNGGWCNPPR
Sbjct  69   LSTALFNSGLSCGACFELKCSNDPSWCHPGSPSILVTATNFCPPNFAQPSDNGGWCNPPR  128

Query  356  PHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDI  177
            PHFDLAMPM LKIA YRAGIVPV++RR+PCRKQGGIRF++NGFRYFNLVL+TNVAGAGDI
Sbjct  129  PHFDLAMPMLLKIAQYRAGIVPVSYRRVPCRKQGGIRFSINGFRYFNLVLITNVAGAGDI  188

Query  176  QKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             K  VKGS+T W+++SRNWGQNW++++ LVGQSLSFRV ASD+R  TS N+ P+N
Sbjct  189  VKTSVKGSKTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTASDKRTSTSLNIVPSN  243



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   372 bits (955),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 203/238 (85%), Gaps = 9/238 (4%)
 Frame = -2

Query  698  LSLLFMLEF--------PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  543
            L + FML          PGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYSQGYGVN
Sbjct  7    LYIAFMLSLFMEANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVN  66

Query  542  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  366
             AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA P+D+GGWCN
Sbjct  67   TAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCN  126

Query  365  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  186
            PPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGA
Sbjct  127  PPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGA  186

Query  185  GDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            GDI +V VKG+ T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPA+
Sbjct  187  GDIVRVSVKGANTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSHNVAPAD  244



>ref|XP_007133996.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
 gb|ESW05990.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
Length=258

 Score =   372 bits (955),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 198/223 (89%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  22   RIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC  D R C+PG PSI +TATNFCPPN ALP+DNGGWCNPPRPHFDLAMPMFLK
Sbjct  82   GACFEIKCDQDPRWCNPGRPSIIITATNFCPPNLALPSDNGGWCNPPRPHFDLAMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+ CRK GGIRF +NGFRYFNLVL++NVAGAGDI +V VKGS++ W
Sbjct  142  IAQYRAGIVPVSYRRVACRKAGGIRFMINGFRYFNLVLISNVAGAGDIVRVSVKGSKSGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             ++SRNWGQNW+++A LVGQ+LSFRV   DRR  TSWNVAP++
Sbjct  202  NSMSRNWGQNWQSNANLVGQALSFRVTGGDRRTSTSWNVAPSH  244



>gb|AAF32410.1|AF230277_1 alpha-expansin 2 [Triphysaria versicolor]
Length=262

 Score =   372 bits (955),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 197/225 (88%), Gaps = 3/225 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG+YSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGLSC
Sbjct  24   RIPGIYSGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSC  83

Query  497  GACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  327
            GACFEI+C    + + C+PG PSI VTATNFCPPNFA P+DNGGWCNPPR HFDLAMPMF
Sbjct  84   GACFEIRCDMAQDGKWCNPGTPSILVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMF  143

Query  326  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  147
            LKIA YRAGIVPVN+RRIPCRKQGGIRFT+NGFRYFNLVLVTNVAGAGDI +V +KG+ T
Sbjct  144  LKIAQYRAGIVPVNYRRIPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSIKGTNT  203

Query  146  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             W+++SRNWGQNW+++  LVGQ+LSFRV ASD R   S NVAPA+
Sbjct  204  QWVSMSRNWGQNWQSNIVLVGQALSFRVTASDHRSSASMNVAPAH  248



>ref|XP_006294843.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
 gb|EOA27741.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
Length=257

 Score =   372 bits (954),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 202/231 (87%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L     PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  13   VLFSLADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  72

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFD
Sbjct  73   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFD  132

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNL+L+TNVAGAGDI +  
Sbjct  133  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILITNVAGAGDIVRAN  192

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWN+ P+N
Sbjct  193  VKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNMVPSN  243



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   371 bits (953),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 203/238 (85%), Gaps = 9/238 (4%)
 Frame = -2

Query  698  LSLLFMLEF--------PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  543
            L + FML          PGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYSQGYGVN
Sbjct  7    LYIAFMLSLFMAANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYSQGYGVN  66

Query  542  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  366
             AALSTALFNNGLSCGACFE+KC +D R C PGNPSI VTATNFCPPNFA P+D+GGWCN
Sbjct  67   TAALSTALFNNGLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSDDGGWCN  126

Query  365  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  186
            PPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGA
Sbjct  127  PPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLITNVAGA  186

Query  185  GDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            GDI +V VKG+ T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS NVAPA+
Sbjct  187  GDIVRVSVKGANTGWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSHNVAPAD  244



>ref|XP_009419260.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   371 bits (952),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 196/223 (88%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG Y+G  WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SC
Sbjct  22   RIPGAYTGSPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C  G+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDL+MPMFLK
Sbjct  82   GACFEIKCADDLRWCHGGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLSMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK GGIRFT+NGF YFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVPCRKSGGIRFTINGFNYFNLVLITNVAGAGDIIRASVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPSN  244



>ref|XP_004981242.1| PREDICTED: expansin-A7-like [Setaria italica]
Length=262

 Score =   371 bits (952),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 195/225 (87%), Gaps = 3/225 (1%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN G SC
Sbjct  24   RIPGVYGGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGQSC  83

Query  497  GACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  327
            GACFEIKC N    R C PG+PSI VTATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPMF
Sbjct  84   GACFEIKCENQPGWRWCHPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMF  143

Query  326  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRT  147
            L IA YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGDI +  VKGS T
Sbjct  144  LHIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKGSGT  203

Query  146  PWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
             W+ +SRNWGQNW+++A LVG +LSFRV  SDRR  TSWN AP N
Sbjct  204  GWLPMSRNWGQNWQSNAILVGDALSFRVTGSDRRTSTSWNAAPRN  248



>ref|XP_009398502.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 197/223 (88%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SC
Sbjct  22   RIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ D + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDLAMP FLK
Sbjct  82   GACFEIKCAEDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK GGIRFT++GF+YFNLVL+TNVAGAGDI +V VKGSRT W
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRVSVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVG+SLSFRV  SDRR  TSWN+ P+ 
Sbjct  202  MPMSRNWGQNWQSNAVLVGESLSFRVTGSDRRTSTSWNIVPST  244



>ref|XP_009381075.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   370 bits (950),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 197/223 (88%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALF+ G SC
Sbjct  22   RIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFDEGQSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC++D R C PG+PSIF+TATNFCPPN+AL  DNGGWCNPPRPHFDL+MPMFLK
Sbjct  82   GACFEIKCADDPRWCHPGSPSIFITATNFCPPNYALAPDNGGWCNPPRPHFDLSMPMFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCR+ GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSYRRVPCRRSGGIRFTINGFQYFNLVLITNVAGAGDIVRASVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQ LSFRV  SDRR  TSWN+ P+N
Sbjct  202  MPMSRNWGQNWQSNAVLVGQPLSFRVTGSDRRTSTSWNIVPSN  244



>ref|XP_010554612.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   370 bits (950),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 198/223 (89%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
             FPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G +C
Sbjct  25   RFPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSGFTC  84

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFE+KC+ND   C  G+PSI   ATNFCPPNFALP+DNGGWCNPPR HFDLAMPMFLK
Sbjct  85   GACFELKCANDPHWCHSGSPSISTPATNFCPPNFALPSDNGGWCNPPRAHFDLAMPMFLK  144

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TNVAGAGDI +  VKG++T W
Sbjct  145  IAEYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIARASVKGTKTGW  204

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P++
Sbjct  205  MGMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRSSTSWNIVPSH  247



>ref|XP_010505648.1| PREDICTED: expansin-A4 [Camelina sativa]
Length=257

 Score =   370 bits (949),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 201/231 (87%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L     PGVYSG +WQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  13   VLFSLADARIPGVYSGSSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  72

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFD
Sbjct  73   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFD  132

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNL+L+TNVAGAGDI +  
Sbjct  133  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILITNVAGAGDIVRAN  192

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  193  VKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNMVPSN  243



>ref|XP_004302749.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=260

 Score =   370 bits (949),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 202/233 (87%), Gaps = 4/233 (2%)
 Frame = -2

Query  698  LSLLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            L+ L M+     PG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALS
Sbjct  14   LASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  73

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            TALFNNGLSCGACFEIKC +D R C+ G PSIFVTATNFCPPNFA P+DNGGWCNPPR H
Sbjct  74   TALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTH  133

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMPMFLKIA Y+AGIVPV++RR+PC K+GGIRFT+NG +YFNLVLVTNVAGAGDI  
Sbjct  134  FDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAGAGDIVS  193

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            V VKG+ T W+ +SRNWGQNW++++ LVGQ+LSFRVR SDRR  T++NVAPAN
Sbjct  194  VSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPAN  246



>gb|ABN09939.1| expansin A4 [Musa acuminata AAA Group]
Length=258

 Score =   369 bits (948),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 196/223 (88%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SC
Sbjct  22   RIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNEGQSC  81

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ D + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDLAMP FLK
Sbjct  82   GACFEIKCAEDPQWCHRGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPAFLK  141

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV+FRR+PCRK GGIRFT++GF+YFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  142  IAEYRAGIVPVSFRRVPCRKSGGIRFTIHGFKYFNLVLITNVAGAGDIVRASVKGSRTGW  201

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+ 
Sbjct  202  MPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIVPST  244



>ref|XP_010517323.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   369 bits (948),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 201/231 (87%), Gaps = 4/231 (2%)
 Frame = -2

Query  692  LLFML---EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  522
            +LF L     PGVYSG +WQ AHATFYGG+DASGTMGGACGYGNLYSQGYG N AALSTA
Sbjct  13   VLFNLADARIPGVYSGSSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTA  72

Query  521  LFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  345
            LFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+DNGGWCNPPR HFD
Sbjct  73   LFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFD  132

Query  344  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVL  165
            LAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNL+L+TNVAGAGDI +  
Sbjct  133  LAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLILITNVAGAGDIVRAN  192

Query  164  VKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSWN+ P+N
Sbjct  193  VKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNMVPSN  243



>gb|KHN30166.1| Expansin-A4 [Glycine soja]
Length=292

 Score =   370 bits (950),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 201/229 (88%), Gaps = 3/229 (1%)
 Frame = -2

Query  698  LSLLFMLE--FPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  525
            +SL++M++   PGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALST
Sbjct  12   MSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST  71

Query  524  ALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  348
            ALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCP N+ALPNDNGGWCNPPRPHF
Sbjct  72   ALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPSNYALPNDNGGWCNPPRPHF  131

Query  347  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKV  168
            DLAMPMFLKIA YRAGIVPV FRR+ CRK GGIRFT+NGFRYFNLVL++NVAGAGDI   
Sbjct  132  DLAMPMFLKIAEYRAGIVPVAFRRVACRKHGGIRFTINGFRYFNLVLISNVAGAGDIVHA  191

Query  167  LVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVA  21
             VKGSRT W+ +SRNWGQNW+++A LVGQ+LSFRV ASD  +  S  +A
Sbjct  192  YVKGSRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTASDLLEHCSIKLA  240



>ref|NP_191109.1| expansin A16 [Arabidopsis thaliana]
 sp|Q9M2S9.1|EXP16_ARATH RecName: Full=Expansin-A16; Short=AtEXPA16; AltName: Full=Alpha-expansin-16; 
Short=At-EXP16; Short=AtEx16; AltName: Full=Ath-ExpAlpha-1.7; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB75908.1| expansin-like protein [Arabidopsis thaliana]
 dbj|BAD43638.1| expansin-like protein [Arabidopsis thaliana]
 gb|AEE79393.1| expansin A16 [Arabidopsis thaliana]
Length=260

 Score =   369 bits (946),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 201/233 (86%), Gaps = 6/233 (3%)
 Frame = -2

Query  692  LLFMLEF-----PGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  528
            L  +L F     P V+SGG+WQTAHATFYGG DASGTMGGACGYGNLYSQGYG N AALS
Sbjct  14   LFLLLSFTDAGIPRVFSGGSWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALS  73

Query  527  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  351
            T+LFN+G SCGACFEIKC ND + C PGNPS+FVTATNFCPPN A P+DNGGWCNPPR H
Sbjct  74   TSLFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSH  133

Query  350  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQK  171
            FDLAMP+FLKIA YRAGIVP+++RR+ CRK GGIRFT+NG RYFNLVL+TNVAGAGDI +
Sbjct  134  FDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIAR  193

Query  170  VLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
              VKGS+T W++L+RNWGQNW+++A LVGQSLSFRV +SDRR  TSWN+AP+N
Sbjct  194  TSVKGSKTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPSN  246



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   369 bits (946),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 198/220 (90%), Gaps = 1/220 (0%)
 Frame = -2

Query  668  GVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSCGAC  489
            G  +GG W+ AHATFYGG+DASGTMGGACGYGNLYS+GYGVN AALSTALFNNGLSCGAC
Sbjct  25   GFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYSEGYGVNTAALSTALFNNGLSCGAC  84

Query  488  FEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAA  312
            FEIKC +D + C PGNPSIF+TATNFCPPN+ALPND+GGWCNPPR HFDLAMPMFL+IA 
Sbjct  85   FEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPNDDGGWCNPPRTHFDLAMPMFLQIAE  144

Query  311  YRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPWITL  132
            Y+AGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL+TNVAGAGDI +V VKG+ T W+ +
Sbjct  145  YKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLITNVAGAGDIVRVSVKGANTEWMPM  204

Query  131  SRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            SRNWGQNW+++A LVGQ+LSFRV  SDRR  TSWNVAP +
Sbjct  205  SRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTSWNVAPGH  244



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   369 bits (946),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 197/223 (88%), Gaps = 1/223 (0%)
 Frame = -2

Query  677  EFPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  498
              PG+Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G SC
Sbjct  21   RIPGLYAGGQWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNEGQSC  80

Query  497  GACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLK  321
            GACFEIKC+ D + C  G+PSIF+TATNFCPPN+ALP+D+GGWCNPPRPHFDL+MPMFLK
Sbjct  81   GACFEIKCAGDPQWCHGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLSMPMFLK  140

Query  320  IAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGDIQKVLVKGSRTPW  141
            IA YRAGIVPV++RR+PCR+ GGIRFT+NGF+YFNLVL+TNVAGAGDI +  VKGSRT W
Sbjct  141  IAEYRAGIVPVSYRRVPCRRSGGIRFTINGFKYFNLVLITNVAGAGDIVRASVKGSRTGW  200

Query  140  ITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSWNVAPAN  12
            + +SRNWGQNW+++A LVGQSLSFR+  SDRR  TSWN+ P+N
Sbjct  201  MPMSRNWGQNWQSNAVLVGQSLSFRLTGSDRRTSTSWNIVPSN  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320