BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047D21

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDX95712.1|  BnaC03g25930D                                          340   2e-115   
emb|CDP13175.1|  unnamed protein product                                339   1e-114   Coffea canephora [robusta coffee]
emb|CBI25984.3|  unnamed protein product                                339   1e-114   Vitis vinifera
ref|NP_001236384.1|  uncharacterized protein LOC100306021               338   1e-114   Glycine max [soybeans]
ref|XP_002302788.1|  hypothetical protein POPTR_0002s19210g             338   1e-114   Populus trichocarpa [western balsam poplar]
ref|XP_002892585.1|  ADP-ribosylation factor                            338   1e-114   Arabidopsis lyrata subsp. lyrata
ref|XP_008444322.1|  PREDICTED: ADP-ribosylation factor 2-like          338   1e-114   Cucumis melo [Oriental melon]
ref|XP_011087519.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    338   1e-114   
ref|NP_191788.1|  ADP-ribosylation factor A1E                           338   1e-114   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17508.1|  unknown                                                 338   2e-114   Picea sitchensis
ref|XP_009391635.1|  PREDICTED: ADP-ribosylation factor 2               338   2e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001290536.1|  uncharacterized protein LOC105052388               338   2e-114   Elaeis guineensis
gb|ADH44695.1|  ADP-ribosylation factor                                 337   2e-114   Salvia miltiorrhiza [Chinese salvia]
emb|CDX83340.1|  BnaA03g21660D                                          338   2e-114   
ref|XP_009121644.1|  PREDICTED: ADP-ribosylation factor 2               337   2e-114   Brassica rapa
gb|KHG04267.1|  ADP-ribosylation factor                                 340   2e-114   Gossypium arboreum [tree cotton]
ref|XP_008777957.1|  PREDICTED: ADP-ribosylation factor                 337   2e-114   Phoenix dactylifera
ref|XP_006291918.1|  hypothetical protein CARUB_v10018102mg             337   2e-114   Capsella rubella
ref|XP_007205794.1|  hypothetical protein PRUPE_ppa010615mg             339   3e-114   
ref|XP_004304633.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    337   3e-114   Fragaria vesca subsp. vesca
ref|XP_008812250.1|  PREDICTED: ADP-ribosylation factor 2-like          337   3e-114   Phoenix dactylifera
ref|XP_008806237.1|  PREDICTED: ADP-ribosylation factor 2-like          337   3e-114   Phoenix dactylifera
ref|XP_009399937.1|  PREDICTED: ADP-ribosylation factor 2-like          337   3e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006390885.1|  hypothetical protein EUTSA_v10019096mg             338   3e-114   
gb|AGV54515.1|  ADP ribosylation factor                                 339   4e-114   Phaseolus vulgaris [French bean]
ref|XP_010553607.1|  PREDICTED: ADP-ribosylation factor 2-B             337   4e-114   Tarenaya hassleriana [spider flower]
ref|XP_006417443.1|  hypothetical protein EUTSA_v10008885mg             337   4e-114   Eutrema salsugineum [saltwater cress]
gb|KJB11520.1|  hypothetical protein B456_001G263300                    337   4e-114   Gossypium raimondii
ref|XP_006305640.1|  hypothetical protein CARUB_v10010344mg             337   4e-114   
gb|KDP28302.1|  hypothetical protein JCGZ_14073                         337   4e-114   Jatropha curcas
gb|EYU46846.1|  hypothetical protein MIMGU_mgv1a014704mg                337   4e-114   Erythranthe guttata [common monkey flower]
ref|XP_008443527.1|  PREDICTED: ADP-ribosylation factor 1-like          337   4e-114   Cucumis melo [Oriental melon]
ref|XP_004967765.1|  PREDICTED: ADP-ribosylation factor 2-like          337   4e-114   Setaria italica
ref|NP_172533.2|  ADP-ribosylation factor A1F                           337   4e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288363.1|  PREDICTED: ADP-ribosylation factor 2-like          337   4e-114   Fragaria vesca subsp. vesca
ref|XP_003536036.1|  PREDICTED: ADP-ribosylation factor-like isof...    337   4e-114   
ref|XP_006344797.1|  PREDICTED: ADP-ribosylation factor 1-like is...    337   4e-114   Solanum tuberosum [potatoes]
ref|XP_006361664.1|  PREDICTED: ADP-ribosylation factor 2-like is...    337   5e-114   Solanum tuberosum [potatoes]
gb|KHN00225.1|  ADP-ribosylation factor 2                               337   5e-114   Glycine soja [wild soybean]
ref|XP_002318935.1|  hypothetical protein POPTR_0013s00700g             337   5e-114   Populus trichocarpa [western balsam poplar]
gb|AAD17207.1|  ADP-ribosylation factor                                 336   5e-114   Glycine max [soybeans]
ref|XP_009417875.1|  PREDICTED: ADP-ribosylation factor 1-like          336   5e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009113207.1|  PREDICTED: ADP-ribosylation factor 1-like          336   5e-114   Brassica rapa
gb|KJB24452.1|  hypothetical protein B456_004G146100                    337   5e-114   Gossypium raimondii
ref|XP_003618209.1|  ADP-ribosylation factor                            336   5e-114   Medicago truncatula
ref|XP_010248146.1|  PREDICTED: ADP-ribosylation factor                 336   6e-114   Nelumbo nucifera [Indian lotus]
ref|XP_002265983.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    336   6e-114   Vitis vinifera
ref|NP_001055892.1|  Os05g0489600                                       336   6e-114   
ref|XP_004970328.1|  PREDICTED: ADP-ribosylation factor 1-like is...    336   6e-114   Setaria italica
gb|KJB81136.1|  hypothetical protein B456_013G131000                    338   6e-114   Gossypium raimondii
ref|XP_010922923.1|  PREDICTED: ADP-ribosylation factor 2-like is...    336   6e-114   Elaeis guineensis
gb|KDP26602.1|  hypothetical protein JCGZ_17760                         336   6e-114   Jatropha curcas
ref|NP_001170436.1|  uncharacterized protein LOC100384428               336   6e-114   Zea mays [maize]
gb|EYU38402.1|  hypothetical protein MIMGU_mgv1a014684mg                336   6e-114   Erythranthe guttata [common monkey flower]
ref|NP_182239.1|  ADP-ribosylation factor 1                             336   6e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006488769.1|  PREDICTED: ADP-ribosylation factor-like            336   6e-114   Citrus sinensis [apfelsine]
ref|XP_010092942.1|  ADP-ribosylation factor 2                          337   6e-114   
ref|XP_003626009.1|  ADP-ribosylation factor-like protein               337   6e-114   
ref|XP_011040674.1|  PREDICTED: ADP-ribosylation factor-like isof...    337   6e-114   Populus euphratica
emb|CDY47221.1|  BnaC09g14700D                                          336   6e-114   Brassica napus [oilseed rape]
ref|NP_001275425.1|  ADP-ribosylation factor 2-like                     336   7e-114   Solanum tuberosum [potatoes]
dbj|BAJ87426.1|  predicted protein                                      336   7e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003618207.1|  ADP-ribosylation factor                            338   7e-114   
ref|XP_006399980.1|  hypothetical protein EUTSA_v10014797mg             336   7e-114   Eutrema salsugineum [saltwater cress]
pdb|3AQ4|A  Chain A, Molecular Insights Into Plant Cell Prolifera...    336   7e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004494449.1|  PREDICTED: ADP-ribosylation factor 2-like          336   7e-114   Cicer arietinum [garbanzo]
ref|XP_009629758.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    338   7e-114   Nicotiana tomentosiformis
ref|XP_009138731.1|  PREDICTED: ADP-ribosylation factor 1               336   7e-114   Brassica rapa
gb|ADP00406.1|  ADP-ribosylation factor                                 336   7e-114   Actinidia chinensis
gb|KJB31031.1|  hypothetical protein B456_005G181600                    336   8e-114   Gossypium raimondii
gb|KJB11518.1|  hypothetical protein B456_001G263300                    337   8e-114   Gossypium raimondii
gb|KHG28118.1|  ARF2-B: ADP-ribosylation factor 2-B                     336   8e-114   Gossypium arboreum [tree cotton]
ref|XP_010524305.1|  PREDICTED: ADP-ribosylation factor-like            336   8e-114   Tarenaya hassleriana [spider flower]
emb|CDY47137.1|  BnaA08g05460D                                          336   8e-114   Brassica napus [oilseed rape]
gb|AGH68504.1|  ADP-ribosylation factor                                 336   8e-114   Ipomoea batatas [batate]
ref|XP_011003178.1|  PREDICTED: ADP-ribosylation factor-like isof...    336   8e-114   Populus euphratica
emb|CAD12855.1|  ADP-ribosylation factor                                336   8e-114   Gossypium hirsutum [American cotton]
ref|XP_006356426.1|  PREDICTED: ADP-ribosylation factor 2-like is...    336   8e-114   Solanum tuberosum [potatoes]
ref|XP_010943658.1|  PREDICTED: ADP-ribosylation factor 2-like          336   9e-114   Elaeis guineensis
ref|NP_177206.1|  ARF GTPase family protein                             336   9e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ00866.1|  putative ADP-ribosylation factor protein                336   9e-114   Elaeis guineensis
ref|XP_002962225.1|  ARF family GTPase                                  336   1e-113   Selaginella moellendorffii
gb|KDO66124.1|  hypothetical protein CISIN_1g029675mg                   336   1e-113   Citrus sinensis [apfelsine]
ref|XP_004135253.1|  PREDICTED: ADP-ribosylation factor 2-like is...    336   1e-113   
ref|XP_006480700.1|  PREDICTED: ADP-ribosylation factor 2-like is...    336   1e-113   Citrus sinensis [apfelsine]
ref|NP_001274834.1|  ARF-like small GTPase-like protein                 335   1e-113   Solanum tuberosum [potatoes]
ref|XP_006296139.1|  hypothetical protein CARUB_v10025292mg             335   1e-113   
gb|AIX10946.1|  putative ADP-ribosylation factor                        335   1e-113   Gardenia jasminoides
ref|NP_001136508.1|  uncharacterized protein LOC100216623               335   1e-113   Zea mays [maize]
ref|XP_008389662.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    335   1e-113   Malus domestica [apple tree]
ref|XP_002876669.1|  ADP-ribosylation factor                            336   1e-113   
ref|XP_002888469.1|  ADP-ribosylation factor                            336   1e-113   
ref|XP_010941504.1|  PREDICTED: ADP-ribosylation factor                 335   1e-113   Elaeis guineensis
ref|XP_004252939.1|  PREDICTED: ADP-ribosylation factor 2               335   1e-113   Solanum lycopersicum
gb|ACJ84691.1|  unknown                                                 335   1e-113   Medicago truncatula
ref|XP_010659724.1|  PREDICTED: ADP-ribosylation factor isoform X1      335   1e-113   Vitis vinifera
gb|AFW78462.1|  hypothetical protein ZEAMMB73_418055                    336   1e-113   
gb|EPS68301.1|  hypothetical protein M569_06468                         335   1e-113   Genlisea aurea
emb|CDY09875.1|  BnaC09g42860D                                          337   1e-113   Brassica napus [oilseed rape]
ref|XP_010491587.1|  PREDICTED: ADP-ribosylation factor 1-like          335   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_011038977.1|  PREDICTED: ADP-ribosylation factor-like            335   1e-113   Populus euphratica
gb|AAT08648.1|  ADP-ribosylation factor                                 336   1e-113   Hyacinthus orientalis [common hyacinth]
ref|XP_002457613.1|  hypothetical protein SORBIDRAFT_03g010350          335   2e-113   Sorghum bicolor [broomcorn]
ref|XP_009110099.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    335   2e-113   Brassica rapa
ref|XP_001776147.1|  Arf1_5/ArfA-family small GTPase                    335   2e-113   
ref|XP_001764375.1|  Arf1_5/ArfA-family small GTPase                    335   2e-113   
ref|NP_001149117.1|  ADP-ribosylation factor                            335   2e-113   Zea mays [maize]
ref|XP_009595261.1|  PREDICTED: ADP-ribosylation factor 1-like          335   2e-113   Nicotiana tomentosiformis
ref|NP_001042668.1|  Os01g0265100                                       335   2e-113   
emb|CDX69567.1|  BnaA10g19160D                                          336   2e-113   
ref|NP_001274832.1|  ADP-ribosylation factor 1-like protein             335   2e-113   Solanum tuberosum [potatoes]
sp|O48920.3|ARF_VIGUN  RecName: Full=ADP-ribosylation factor            335   2e-113   Vigna unguiculata
gb|KDP46432.1|  hypothetical protein JCGZ_10272                         335   2e-113   Jatropha curcas
ref|XP_006288755.1|  hypothetical protein CARUB_v10002073mg             335   2e-113   Capsella rubella
ref|XP_010108788.1|  ADP-ribosylation factor                            335   2e-113   
gb|KHG04030.1|  ADP-ribosylation factor 2                               335   2e-113   Gossypium arboreum [tree cotton]
gb|EYU19417.1|  hypothetical protein MIMGU_mgv1a014679mg                335   2e-113   Erythranthe guttata [common monkey flower]
ref|NP_001044599.1|  Os01g0813400                                       335   2e-113   
ref|XP_007031496.1|  ADP-ribosylation factor A1F                        335   2e-113   Theobroma cacao [chocolate]
ref|XP_004228551.1|  PREDICTED: ADP-ribosylation factor 2-like          335   2e-113   Solanum lycopersicum
ref|XP_009612443.1|  PREDICTED: ADP-ribosylation factor                 335   2e-113   Nicotiana tomentosiformis
ref|XP_010313707.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    335   2e-113   
ref|XP_009416365.1|  PREDICTED: ADP-ribosylation factor 1               335   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009118871.1|  PREDICTED: ADP-ribosylation factor 1-like          335   2e-113   Brassica rapa
ref|XP_009389142.1|  PREDICTED: ADP-ribosylation factor 1-like          335   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACM67554.1|  ADP-ribosylation factor-like protein                    335   2e-113   Musa acuminata AAA Group [Cavendish banana]
gb|AFK42466.1|  unknown                                                 335   2e-113   Lotus japonicus
ref|XP_010094415.1|  ADP-ribosylation factor 2                          335   3e-113   
gb|KCW56002.1|  hypothetical protein EUGRSUZ_I01779                     335   3e-113   Eucalyptus grandis [rose gum]
ref|XP_010651474.1|  PREDICTED: ADP-ribosylation factor 2 isoform X2    334   3e-113   
gb|EMT17349.1|  ADP-ribosylation factor 2                               335   3e-113   
gb|KJB75878.1|  hypothetical protein B456_012G062700                    335   3e-113   Gossypium raimondii
gb|AFK39359.1|  unknown                                                 334   3e-113   Medicago truncatula
ref|XP_004158320.1|  PREDICTED: ADP-ribosylation factor 1-like          334   3e-113   
ref|NP_001280835.1|  ADP-ribosylation factor                            335   3e-113   Malus domestica [apple tree]
ref|XP_001764701.1|  Arf1_5/ArfA-family small GTPase                    334   3e-113   
gb|AAF17671.1|AC009398_20  F20B24.7                                     334   3e-113   Arabidopsis thaliana [mouse-ear cress]
gb|KGN51378.1|  hypothetical protein Csa_5G524710                       335   3e-113   Cucumis sativus [cucumbers]
emb|CDM84658.1|  unnamed protein product                                334   4e-113   Triticum aestivum [Canadian hard winter wheat]
gb|KJB15578.1|  hypothetical protein B456_002G185200                    335   4e-113   Gossypium raimondii
ref|XP_010319588.1|  PREDICTED: ADP-ribosylation factor                 334   4e-113   
ref|XP_004970327.1|  PREDICTED: ADP-ribosylation factor 1-like is...    334   4e-113   
gb|AFW78457.1|  hypothetical protein ZEAMMB73_418055                    334   4e-113   
ref|XP_002888782.1|  hypothetical protein ARALYDRAFT_476172             334   5e-113   
gb|EMS63688.1|  ADP-ribosylation factor 2                               334   5e-113   Triticum urartu
ref|XP_010660901.1|  PREDICTED: ADP-ribosylation factor isoform X1      334   5e-113   Vitis vinifera
ref|XP_009375124.1|  PREDICTED: ADP-ribosylation factor 1-like          334   5e-113   Pyrus x bretschneideri [bai li]
ref|XP_007151018.1|  hypothetical protein PHAVU_004G011900g             334   5e-113   Phaseolus vulgaris [French bean]
gb|ABD73294.1|  ADP-ribosylation factor-like protein                    334   5e-113   Panax ginseng [Asiatic ginseng]
ref|XP_006416080.1|  hypothetical protein EUTSA_v10008884mg             334   5e-113   Eutrema salsugineum [saltwater cress]
ref|XP_010679455.1|  PREDICTED: ADP-ribosylation factor 2-B-like        333   6e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009133804.1|  PREDICTED: ADP-ribosylation factor 1-like          333   6e-113   Brassica rapa
ref|XP_002871626.1|  ADP-ribosylation factor A1B                        334   6e-113   Arabidopsis lyrata subsp. lyrata
ref|XP_010232478.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    333   6e-113   Brachypodium distachyon [annual false brome]
ref|XP_009776781.1|  PREDICTED: ADP-ribosylation factor-like            333   6e-113   Nicotiana sylvestris
ref|XP_010492280.1|  PREDICTED: ADP-ribosylation factor isoform X1      333   6e-113   Camelina sativa [gold-of-pleasure]
ref|XP_003557370.1|  PREDICTED: ADP-ribosylation factor 1               333   7e-113   Brachypodium distachyon [annual false brome]
gb|ABY76246.1|  ADP-ribosylation factor                                 333   7e-113   Brassica napus [oilseed rape]
ref|XP_003591353.1|  ADP ribosylation factor                            333   7e-113   
gb|AAC98042.1|  Strong similarity to gb|M95166 ADP-ribosylation f...    333   8e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002277054.2|  PREDICTED: ADP-ribosylation factor isoform X2      333   8e-113   Vitis vinifera
ref|NP_001051676.1|  Os03g0811900                                       333   8e-113   
ref|XP_002312302.1|  ADP-ribosylation factor family protein             333   8e-113   Populus trichocarpa [western balsam poplar]
ref|XP_009395959.1|  PREDICTED: ADP-ribosylation factor 1-like          333   8e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009110098.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    333   8e-113   Brassica rapa
ref|XP_009381359.1|  PREDICTED: ADP-ribosylation factor 1-like          333   8e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17658.1|  unknown                                                 333   8e-113   Picea sitchensis
ref|NP_001059207.1|  Os07g0223400                                       333   9e-113   
sp|P51821.2|ARF1_CHLRE  RecName: Full=ADP-ribosylation factor 1         333   9e-113   Chlamydomonas reinhardtii
gb|EEE66819.1|  hypothetical protein OsJ_23579                          337   1e-112   Oryza sativa Japonica Group [Japonica rice]
gb|AAO62347.1|  ARF1-like GTP-binding protein                           333   1e-112   Gossypium hirsutum [American cotton]
sp|P51822.2|ARF1_DAUCA  RecName: Full=ADP-ribosylation factor 1         333   1e-112   Daucus carota [carrots]
ref|XP_009410044.1|  PREDICTED: ADP-ribosylation factor 1-like          333   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403841.1|  PREDICTED: ADP-ribosylation factor 1-like          333   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011462890.1|  PREDICTED: ADP-ribosylation factor-like isof...    333   1e-112   Fragaria vesca subsp. vesca
ref|NP_196971.1|  ADP-ribosylation factor A1B                           333   1e-112   
ref|XP_009115521.1|  PREDICTED: ADP-ribosylation factor 2-B             333   1e-112   
ref|XP_010551906.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    333   1e-112   Tarenaya hassleriana [spider flower]
gb|AFW67224.1|  hypothetical protein ZEAMMB73_332083                    333   2e-112   
ref|XP_002466220.1|  hypothetical protein SORBIDRAFT_01g003770          332   2e-112   Sorghum bicolor [broomcorn]
ref|XP_004981305.1|  PREDICTED: ADP-ribosylation factor-like isof...    333   2e-112   
ref|XP_002521452.1|  ADP-ribosylation factor, arf, putative             332   2e-112   Ricinus communis
gb|KJB09503.1|  hypothetical protein B456_001G146100                    332   2e-112   Gossypium raimondii
ref|XP_008443534.1|  PREDICTED: ADP-ribosylation factor 1-like is...    332   2e-112   Cucumis melo [Oriental melon]
ref|XP_009393904.1|  PREDICTED: ADP-ribosylation factor 1-like          332   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW79615.1|  hypothetical protein ZEAMMB73_444016                    333   2e-112   
ref|XP_002314987.1|  ADP-ribosylation factor family protein             332   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_003557369.1|  PREDICTED: ADP-ribosylation factor 1-like          332   2e-112   Brachypodium distachyon [annual false brome]
ref|XP_001764700.1|  predicted protein                                  332   2e-112   
ref|XP_009383762.1|  PREDICTED: ADP-ribosylation factor 1               332   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010551905.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    333   3e-112   Tarenaya hassleriana [spider flower]
gb|AAU82112.1|  ADP-ribosylation factor                                 332   3e-112   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009420958.1|  PREDICTED: ADP-ribosylation factor 1-like          332   3e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF80896.1|  unknown                                                 332   3e-112   Zea mays [maize]
ref|XP_004981306.1|  PREDICTED: ADP-ribosylation factor-like isof...    333   3e-112   
gb|AFW67226.1|  hypothetical protein ZEAMMB73_332083                    334   3e-112   
ref|XP_003618208.1|  ADP-ribosylation factor                            331   3e-112   
gb|AAO63779.1|  ADP-ribosylation factor 1                               332   3e-112   Populus tremuloides
gb|ACM67553.1|  ADP-ribosylation factor-like protein                    332   3e-112   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002318934.1|  hypothetical protein POPTR_0013s00690g             332   4e-112   
ref|XP_006419277.1|  hypothetical protein CICLE_v10006079mg             331   4e-112   
gb|ACG31280.1|  ADP-ribosylation factor 1                               332   4e-112   Zea mays [maize]
gb|ACU16903.1|  unknown                                                 332   4e-112   Glycine max [soybeans]
gb|ADB85106.1|  ADP ribosylation factor 002                             332   4e-112   Jatropha curcas
gb|EMS51203.1|  ADP-ribosylation factor 2                               333   4e-112   Triticum urartu
ref|XP_004981304.1|  PREDICTED: ADP-ribosylation factor-like isof...    333   5e-112   
gb|AAT08663.1|  ADP-ribosylation factor                                 331   5e-112   Hyacinthus orientalis [common hyacinth]
gb|AAP69821.1|  ARF                                                     331   6e-112   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001168955.1|  uncharacterized protein LOC100382775               331   6e-112   Zea mays [maize]
gb|EEE66818.1|  hypothetical protein OsJ_23578                          333   6e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005643690.1|  ADP-ribosylation factor 1                          331   7e-112   Coccomyxa subellipsoidea C-169
gb|AEX49947.1|  ADP-ribosylation factor 1                               331   7e-112   Haloxylon ammodendron
ref|XP_001776112.1|  Arf1_5/ArfA-family small GTPase                    331   7e-112   
gb|ABF74733.1|  ADP-ribosylation factor 1                               331   7e-112   Nicotiana benthamiana
ref|XP_011462888.1|  PREDICTED: ADP-ribosylation factor-like isof...    332   1e-111   Fragaria vesca subsp. vesca
ref|NP_001237492.1|  uncharacterized protein LOC100499890               330   1e-111   Glycine max [soybeans]
gb|EAY92309.1|  hypothetical protein OsI_14032                          337   1e-111   Oryza sativa Indica Group [Indian rice]
gb|EAY73411.1|  hypothetical protein OsI_01294                          332   1e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_010674549.1|  PREDICTED: ADP-ribosylation factor-like isof...    330   1e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003613219.1|  ADP-ribosylation factor                            340   2e-111   
gb|AFW79619.1|  hypothetical protein ZEAMMB73_444016                    333   2e-111   
ref|XP_001776146.1|  predicted protein                                  330   2e-111   
ref|XP_010694842.1|  PREDICTED: ADP-ribosylation factor 1-like          330   2e-111   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAB90396.1|  ADP-ribosylation factor                                337   2e-111   Oryza sativa Japonica Group [Japonica rice]
sp|O23778.3|ARF1_CATRO  RecName: Full=ADP-ribosylation factor 1         329   3e-111   Catharanthus roseus [chatas]
dbj|BAK00965.1|  predicted protein                                      329   3e-111   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001105897.1|  ADP-ribosylation factor                            329   3e-111   
ref|XP_009394868.1|  PREDICTED: ADP-ribosylation factor 1-like          329   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT22177.1|  ADP-ribosylation factor                                 332   5e-111   
gb|KIY96152.1|  ADP-ribosylation factor 1                               328   5e-111   Monoraphidium neglectum
gb|ABR25719.1|  ADP-ribosylation factor 1                               328   6e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_002973399.1|  ARF family GTPase                                  328   7e-111   Selaginella moellendorffii
ref|XP_003578999.1|  PREDICTED: ADP-ribosylation factor 1-like          328   8e-111   Brachypodium distachyon [annual false brome]
ref|XP_007147411.1|  hypothetical protein PHAVU_006G122200g             328   8e-111   Phaseolus vulgaris [French bean]
ref|XP_007224194.1|  hypothetical protein PRUPE_ppa017304mg             328   9e-111   
ref|XP_010674548.1|  PREDICTED: ADP-ribosylation factor-like isof...    328   1e-110   
gb|KIY94970.1|  ADP-ribosylation factor 1                               328   1e-110   Monoraphidium neglectum
ref|XP_009105711.1|  PREDICTED: ADP-ribosylation factor 2-B-like        327   2e-110   Brassica rapa
gb|KCW56007.1|  hypothetical protein EUGRSUZ_I01779                     327   2e-110   Eucalyptus grandis [rose gum]
ref|XP_006438364.1|  hypothetical protein CICLE_v10032807mg             328   2e-110   
ref|XP_004141190.1|  PREDICTED: ADP-ribosylation factor 1-like          334   2e-110   
ref|XP_001420856.1|  predicted protein                                  327   2e-110   Ostreococcus lucimarinus CCE9901
gb|KHG28117.1|  ADP-ribosylation factor 2                               340   2e-110   Gossypium arboreum [tree cotton]
ref|XP_003533111.1|  PREDICTED: ADP-ribosylation factor 2-B-like        327   3e-110   Glycine max [soybeans]
emb|CEF99966.1|  Small GTPase superfamily, ARF/SAR type                 327   4e-110   Ostreococcus tauri
emb|CBI39638.3|  unnamed protein product                                340   6e-110   Vitis vinifera
emb|CBI36996.3|  unnamed protein product                                325   7e-110   Vitis vinifera
ref|XP_008223454.1|  PREDICTED: ADP-ribosylation factor-like            326   8e-110   Prunus mume [ume]
ref|XP_003055413.1|  predicted protein                                  326   8e-110   Micromonas pusilla CCMP1545
gb|ACU13131.1|  unknown                                                 325   1e-109   Glycine max [soybeans]
ref|XP_001690893.1|  small ARF-related GTPase                           325   2e-109   Chlamydomonas reinhardtii
emb|CBI28549.3|  unnamed protein product                                323   3e-109   Vitis vinifera
ref|XP_010270881.1|  PREDICTED: ADP-ribosylation factor 2-like          323   5e-109   Nelumbo nucifera [Indian lotus]
emb|CDP02095.1|  unnamed protein product                                323   7e-109   Coffea canephora [robusta coffee]
gb|ABB86251.1|  ADP-ribosylation factor 1-like                          323   1e-108   Solanum tuberosum [potatoes]
ref|XP_005845590.1|  hypothetical protein CHLNCDRAFT_49011              322   2e-108   Chlorella variabilis
emb|CBI34904.3|  unnamed protein product                                321   3e-108   Vitis vinifera
ref|XP_006302886.1|  hypothetical protein CARUB_v10021017mg             321   5e-108   Capsella rubella
gb|AGT16095.1|  ADP-ribosylation factor                                 320   7e-108   Saccharum hybrid cultivar R570
emb|CDH53772.1|  adp-ribosylation factor 2-like                         320   2e-107   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010244258.1|  PREDICTED: ADP-ribosylation factor 2-like          320   2e-107   Nelumbo nucifera [Indian lotus]
sp|P51824.2|ARF1_SOLTU  RecName: Full=ADP-ribosylation factor 1         319   4e-107   Solanum tuberosum [potatoes]
ref|XP_009104952.1|  PREDICTED: ADP-ribosylation factor 2-B-like        318   5e-107   Brassica rapa
ref|XP_005830635.1|  hypothetical protein GUITHDRAFT_95331              318   6e-107   Guillardia theta CCMP2712
gb|KFH64649.1|  ADP-ribosylation factor                                 318   8e-107   Mortierella verticillata NRRL 6337
emb|CDX68343.1|  BnaA07g23830D                                          318   8e-107   
gb|KJB43807.1|  hypothetical protein B456_007G217400                    317   2e-106   Gossypium raimondii
gb|KJB43808.1|  hypothetical protein B456_007G217400                    317   2e-106   Gossypium raimondii
ref|XP_009367578.1|  PREDICTED: ADP-ribosylation factor 2-like is...    317   2e-106   Pyrus x bretschneideri [bai li]
gb|EYU46843.1|  hypothetical protein MIMGU_mgv1a020290mg                317   2e-106   Erythranthe guttata [common monkey flower]
ref|XP_009269147.1|  ADP-ribosylation factor                            316   4e-106   Wallemia ichthyophaga EXF-994
ref|XP_003611669.1|  ADP-ribosylation factor                            316   6e-106   Medicago truncatula
ref|XP_002948332.1|  small Arf-related GTPase                           316   6e-106   Volvox carteri f. nagariensis
emb|CDH50625.1|  adp-ribosylation factor                                316   7e-106   Lichtheimia corymbifera JMRC:FSU:9682
emb|CAN59803.1|  hypothetical protein VITISV_038875                     316   7e-106   Vitis vinifera
ref|XP_008391498.1|  PREDICTED: ADP-ribosylation factor 2-like          315   9e-106   
gb|KDP31993.1|  hypothetical protein JCGZ_12454                         315   9e-106   Jatropha curcas
ref|XP_002307284.1|  ADP-ribosylation factor family protein             315   1e-105   Populus trichocarpa [western balsam poplar]
ref|XP_007205981.1|  hypothetical protein PRUPE_ppa012138mg             315   1e-105   Prunus persica
ref|XP_006844021.1|  hypothetical protein AMTR_s00006p00218180          315   2e-105   
ref|XP_009367594.1|  PREDICTED: ADP-ribosylation factor 2-like is...    315   2e-105   
ref|XP_009620631.1|  PREDICTED: ADP-ribosylation factor 2-B-like        315   2e-105   
emb|CDY23500.1|  BnaC06g24690D                                          316   2e-105   
gb|KDD76860.1|  ADP-ribosylation factor                                 314   2e-105   
emb|CDP02537.1|  unnamed protein product                                314   2e-105   
gb|EXX72896.1|  Arf2p                                                   314   3e-105   
ref|XP_008238827.1|  PREDICTED: ADP-ribosylation factor 1-like          314   3e-105   
ref|XP_002524920.1|  ADP-ribosylation factor, arf, putative             313   5e-105   
emb|CDH54768.1|  adp-ribosylation factor                                313   5e-105   
emb|CDS06496.1|  Putative ADP-ribosylation factor 1                     313   5e-105   
ref|XP_007047386.1|  ADP-ribosylation factor A1F isoform 2              313   5e-105   
gb|EMS22909.1|  ADP-ribosylation factor                                 313   6e-105   
ref|XP_005760428.1|  ADP-ribosylation factor                            313   8e-105   
ref|XP_010652770.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    313   8e-105   
emb|CDR39163.1|  CYFA0S03e00342g1_1                                     313   8e-105   
ref|XP_006959545.1|  ARF/SAR                                            313   9e-105   
ref|XP_011126154.1|  hypothetical protein AOL_s00173g110                313   1e-104   
ref|XP_003975384.1|  PREDICTED: ADP-ribosylation factor 1-like 2-...    313   1e-104   
ref|XP_011115839.1|  hypothetical protein H072_10361                    313   1e-104   
ref|XP_002740964.1|  PREDICTED: ADP-ribosylation factor 1-like is...    313   1e-104   
ref|XP_010652771.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    313   1e-104   
emb|CEP19057.1|  hypothetical protein                                   312   1e-104   
gb|ACJ85257.1|  unknown                                                 313   2e-104   
ref|XP_005986307.1|  PREDICTED: ADP-ribosylation factor 2-like          312   2e-104   
gb|EIE86445.1|  ADP-ribosylation factor                                 312   2e-104   
ref|XP_002507669.1|  predicted protein                                  315   2e-104   
gb|KCW59480.1|  hypothetical protein EUGRSUZ_H02224                     313   2e-104   
gb|EAZ29027.1|  hypothetical protein OsJ_13076                          312   2e-104   
ref|XP_011276692.1|  ADP-ribosylation factor 1                          312   2e-104   
emb|CBI33772.3|  unnamed protein product                                313   2e-104   
ref|XP_009028190.1|  hypothetical protein HELRODRAFT_186077             312   2e-104   
gb|ELU04506.1|  hypothetical protein CAPTEDRAFT_151740                  312   2e-104   
ref|XP_010753411.1|  PREDICTED: ADP-ribosylation factor 1-like          312   2e-104   
ref|XP_007511913.1|  ADP-ribosylation factor                            313   2e-104   
gb|ABI64151.1|  ADP-ribosylation factor                                 310   3e-104   
ref|XP_006638193.1|  PREDICTED: ADP-ribosylation factor 1-like          311   3e-104   
ref|XP_006339849.1|  PREDICTED: ADP-ribosylation factor 2-B-like        311   3e-104   
emb|CEG74858.1|  Putative ADP-ribosylation factor                       311   3e-104   
ref|XP_006897877.1|  PREDICTED: ADP-ribosylation factor 2-like          311   3e-104   
ref|XP_007692073.1|  hypothetical protein COCMIDRAFT_106246             311   3e-104   
gb|EPB84634.1|  ADP-ribosylation factor 1                               311   4e-104   
gb|KIX04641.1|  ADP-ribosylation factor                                 311   4e-104   
ref|XP_001797240.1|  hypothetical protein SNOG_06879                    311   4e-104   
ref|XP_005998642.1|  PREDICTED: ADP-ribosylation factor 1-like          311   4e-104   
ref|XP_003856771.1|  hypothetical protein MYCGRDRAFT_102943             311   4e-104   
ref|XP_011008774.1|  PREDICTED: ADP-ribosylation factor 1-like          311   4e-104   
ref|XP_007920061.1|  hypothetical protein MYCFIDRAFT_49010              311   4e-104   
ref|XP_010872862.1|  PREDICTED: ADP-ribosylation factor 2               311   4e-104   
dbj|GAM83579.1|  hypothetical protein ANO11243_015670                   311   4e-104   
ref|XP_007747463.1|  ADP-ribosylation factor                            311   4e-104   
ref|NP_001167030.1|  ADP-ribosylation factor 1 like                     311   5e-104   
ref|XP_003448684.1|  PREDICTED: ADP-ribosylation factor 1-like          311   5e-104   
ref|XP_008296481.1|  PREDICTED: ADP-ribosylation factor 1-like          311   5e-104   
ref|XP_007413478.1|  hypothetical protein MELLADRAFT_117357             311   5e-104   
gb|KEQ60941.1|  ARF/SAR superfamily                                     311   5e-104   
ref|XP_001634219.1|  predicted protein                                  311   5e-104   
ref|XP_007758701.1|  ADP-ribosylation factor                            311   6e-104   
gb|EPB86904.1|  ADP-ribosylation factor                                 311   6e-104   
ref|XP_007725373.1|  ADP-ribosylation factor                            311   6e-104   
ref|XP_003961118.1|  PREDICTED: ADP-ribosylation factor 1-like          311   6e-104   
emb|CAF98439.1|  unnamed protein product                                311   6e-104   
gb|AAF79587.1|AC007945_7  F28C11.12                                     313   7e-104   
gb|ERE68625.1|  ADP-ribosylation factor 3-like protein                  311   7e-104   
ref|XP_006970612.1|  PREDICTED: ADP-ribosylation factor 2-like is...    311   7e-104   
ref|XP_007672425.1|  hypothetical protein BAUCODRAFT_61772              311   7e-104   
gb|EIE79751.1|  ADP-ribosylation factor                                 310   8e-104   
ref|XP_007343507.1|  ARF/SAR                                            310   8e-104   
emb|CEG67980.1|  Putative ADP-ribosylation factor 1                     310   8e-104   
gb|KIR49173.1|  ADP-ribosylation factor                                 310   8e-104   
ref|XP_010070606.1|  PREDICTED: ADP-ribosylation factor 1-like          310   9e-104   
ref|NP_031503.1|  ADP-ribosylation factor 2                             310   1e-103   
ref|XP_004655168.1|  PREDICTED: ADP-ribosylation factor 2-like          310   1e-103   
ref|XP_004896721.1|  PREDICTED: ADP-ribosylation factor 2-like          310   1e-103   
ref|XP_002719499.1|  PREDICTED: ADP-ribosylation factor 2               310   1e-103   
ref|XP_005369447.1|  PREDICTED: ADP-ribosylation factor 2-like is...    311   1e-103   
gb|KIL95193.1|  adp-ribosylation factor                                 310   1e-103   
ref|XP_003054231.1|  predicted protein                                  310   1e-103   
ref|XP_006017727.1|  PREDICTED: ADP-ribosylation factor 2-like          310   1e-103   
ref|XP_005311784.1|  PREDICTED: ADP-ribosylation factor 2               310   2e-103   
gb|EPZ32912.1|  ADP-ribosylation factor                                 310   2e-103   
ref|XP_007068709.1|  PREDICTED: ADP-ribosylation factor 2-like is...    310   2e-103   
ref|XP_005830502.1|  hypothetical protein GUITHDRAFT_163836             310   2e-103   
gb|ERE81170.1|  ADP-ribosylation factor 3-like protein                  311   2e-103   
gb|AAP36879.1|  Homo sapiens ADP-ribosylation factor 3                  310   2e-103   
ref|XP_007329319.1|  hypothetical protein AGABI1DRAFT_113290            310   2e-103   
gb|KFM11151.1|  ADP-ribosylation factor 3                               310   2e-103   
ref|NP_001650.1|  ADP-ribosylation factor 3                             310   2e-103   
ref|XP_007426142.1|  PREDICTED: ADP-ribosylation factor 3 isoform X1    310   2e-103   
ref|XP_006785706.1|  PREDICTED: ADP-ribosylation factor 3-like          310   2e-103   
gb|ACE87829.1|  ADP-ribosylation factor 3 protein                       310   2e-103   
ref|XP_008317099.1|  PREDICTED: ADP-ribosylation factor 3               310   2e-103   
ref|XP_010782740.1|  PREDICTED: ADP-ribosylation factor 3               310   2e-103   
ref|XP_001730296.1|  hypothetical protein MGL_2678                      310   2e-103   
ref|NP_001086694.1|  ADP-ribosylation factor 3                          310   2e-103   
emb|CCX06275.1|  Similar to ADP-ribosylation factor; acc. no. P0CM17    310   2e-103   
dbj|GAC95502.1|  potential ADP-ribosylation factor                      309   2e-103   
ref|XP_004287997.1|  PREDICTED: ADP-ribosylation factor 1-like          309   2e-103   
ref|XP_007882123.1|  hypothetical protein PFL1_06914                    309   2e-103   
gb|EJU06117.1|  ARF/SAR                                                 309   2e-103   
ref|XP_001494680.2|  PREDICTED: ADP-ribosylation factor 1 isoformX1     310   2e-103   
gb|KIJ56883.1|  hypothetical protein M422DRAFT_23014                    309   3e-103   
ref|XP_008086386.1|  P-loop containing nucleoside triphosphate hy...    309   3e-103   
gb|KDE06822.1|  ADP-ribosylation factor 1                               309   3e-103   
ref|NP_001133306.1|  ADP-ribosylation factor 3                          309   3e-103   
ref|XP_007293765.1|  ADP-ribosylation factor 1                          309   3e-103   
ref|NP_001003441.1|  ADP-ribosylation factor 3                          309   3e-103   
ref|XP_009084000.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    309   3e-103   
ref|NP_001080474.1|  ADP-ribosylation factor 1                          309   3e-103   
ref|XP_005599712.1|  PREDICTED: ADP-ribosylation factor 1 isoform X3    310   3e-103   
dbj|BAE31170.1|  unnamed protein product                                309   3e-103   
ref|XP_010188889.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    309   3e-103   
ref|XP_004874773.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    309   3e-103   
gb|KHN99894.1|  ADP-ribosylation factor 1                               309   3e-103   
ref|XP_003307076.1|  ADP-ribosylation factor                            309   3e-103   
gb|KFO27677.1|  ADP-ribosylation factor 2                               310   3e-103   
gb|KFW10391.1|  ADP-ribosylation factor 1                               309   3e-103   
ref|NP_001001905.1|  ADP-ribosylation factor 1                          309   3e-103   
gb|KFM81919.1|  ADP-ribosylation factor 1                               309   3e-103   
gb|KFY84038.1|  hypothetical protein V500_09663                         309   3e-103   
gb|AAV66416.1|  ADP-ribosylation factor 1                               308   3e-103   
dbj|BAE40054.1|  unnamed protein product                                309   3e-103   
ref|XP_002618500.1|  ADP-ribosylation factor 1                          309   4e-103   
ref|XP_007230008.1|  PREDICTED: ADP-ribosylation factor 1-like          309   4e-103   
gb|ELR01747.1|  ADP-ribosylation factor                                 309   4e-103   
ref|NP_001649.1|  ADP-ribosylation factor 1                             309   4e-103   
ref|XP_011428363.1|  PREDICTED: ADP-ribosylation factor 2               309   4e-103   
ref|XP_007820253.1|  RAS-like GTPase, Rho2 subfamily                    309   4e-103   
ref|NP_958912.1|  ADP-ribosylation factor 2                             308   4e-103   
emb|CCQ18631.1|  GTP-binding ADP-ribosylation factor-like protein A     308   4e-103   
pdb|1HUR|A  Chain A, Human Adp-Ribosylation Factor 1 Complexed Wi...    308   4e-103   
ref|XP_001104802.2|  PREDICTED: ADP-ribosylation factor 3-like is...    311   4e-103   
ref|XP_008411909.1|  PREDICTED: ADP-ribosylation factor 3 isoform X1    310   4e-103   
emb|CCU97464.1|  unnamed protein product                                308   4e-103   
ref|XP_008001282.1|  PREDICTED: ADP-ribosylation factor 3 isoform X1    311   4e-103   
gb|AFO83996.1|  ADP-ribosylation factor                                 308   4e-103   
gb|KHG02135.1|  ADP-ribosylation factor                                 310   4e-103   
gb|ELK36349.1|  ADP-ribosylation factor 3                               310   4e-103   
gb|KIM91090.1|  hypothetical protein PILCRDRAFT_811607                  308   5e-103   
ref|XP_007055604.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    308   5e-103   
ref|NP_001091755.1|  ADP-ribosylation factor                            308   5e-103   
ref|XP_001837013.1|  ADP-ribosylation factor Arf1                       308   5e-103   
sp|P91924.3|ARF_DUGJA  RecName: Full=ADP-ribosylation factor            308   5e-103   
gb|KFZ47631.1|  ADP-ribosylation factor 1                               308   5e-103   
ref|XP_010884394.1|  PREDICTED: ADP-ribosylation factor 1               308   5e-103   
ref|XP_007236412.1|  PREDICTED: ADP-ribosylation factor 1-like          308   5e-103   
ref|XP_572032.1|  ARF small monomeric GTPase                            308   5e-103   
ref|XP_008312304.1|  PREDICTED: ADP-ribosylation factor 1-like          308   5e-103   
ref|NP_001138692.1|  ADP-ribosylation factor 2                          308   5e-103   
emb|CEF66979.1|  ADP-ribosylation factor 1                              308   5e-103   
ref|XP_003141875.1|  ADP-ribosylation factor 1                          308   5e-103   
ref|XP_003405805.2|  PREDICTED: ADP-ribosylation factor 3 isoform X1    310   5e-103   
ref|XP_010764816.1|  PREDICTED: ADP-ribosylation factor 3-like          308   5e-103   
ref|XP_007828274.1|  ADP-ribosylation factor                            308   5e-103   
gb|KFM79737.1|  ADP-ribosylation factor 1                               308   6e-103   
ref|XP_009017039.1|  hypothetical protein HELRODRAFT_185550             308   6e-103   
ref|XP_001558462.1|  ADP-ribosylation factor                            308   7e-103   
ref|XP_002839805.1|  hypothetical protein                               308   7e-103   
ref|XP_004874772.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    310   7e-103   
ref|NP_001238245.1|  uncharacterized protein LOC100305887               308   7e-103   
ref|XP_007232528.1|  PREDICTED: ADP-ribosylation factor 1               308   7e-103   
gb|KEY71043.1|  hypothetical protein S7711_00867                        308   7e-103   
ref|XP_006962569.1|  ADP-ribosylation factor GTPase of the ras su...    308   7e-103   
ref|XP_968387.1|  PREDICTED: ADP-ribosylation factor 1                  308   7e-103   
ref|NP_958888.1|  ADP-ribosylation factor 1 like                        308   7e-103   
ref|XP_002641152.1|  C. briggsae CBR-ARF-1.2 protein                    308   7e-103   
ref|XP_005661196.1|  PREDICTED: ADP-ribosylation factor 1 isoform X4    308   7e-103   
ref|XP_005853247.1|  PREDICTED: ADP-ribosylation factor 1 isoform X4    308   7e-103   
ref|NP_001153898.1|  ADP-ribosylation factor 3                          308   8e-103   
ref|XP_003713533.1|  ADP-ribosylation factor                            308   8e-103   
ref|XP_007788559.1|  putative adp-ribosylation factor protein           308   8e-103   
ref|NP_989018.1|  ADP-ribosylation factor 5                             308   8e-103   
gb|EDM06291.1|  ADP-ribosylation factor 2, isoform CRA_c                311   8e-103   
gb|EJW75727.1|  ADP-ribosylation factor 1                               308   8e-103   
ref|XP_007169957.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    309   8e-103   
gb|AEE61840.1|  unknown                                                 308   8e-103   
ref|XP_007913163.1|  putative adp-ribosylation factor protein           308   9e-103   
ref|XP_008766092.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    308   9e-103   
gb|EQL01021.1|  Small GTPase superfamily, ARF type                      308   9e-103   
ref|NP_958860.1|  ADP-ribosylation factor 1                             308   9e-103   
ref|XP_004070501.1|  PREDICTED: ADP-ribosylation factor 3               308   9e-103   
ref|XP_850048.1|  PREDICTED: ADP-ribosylation factor 2-like isofo...    308   9e-103   
ref|XP_005678073.1|  PREDICTED: ADP-ribosylation factor 1-like          308   9e-103   
ref|XP_011502468.1|  PREDICTED: ADP-ribosylation factor 1               308   9e-103   
ref|XP_005853246.1|  PREDICTED: ADP-ribosylation factor 1 isoform X3    308   1e-102   
ref|XP_010679695.1|  PREDICTED: uncharacterized protein LOC104894998    314   1e-102   
ref|XP_005599711.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    309   1e-102   
ref|XP_005853245.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    308   1e-102   
ref|XP_392990.2|  PREDICTED: ADP-ribosylation factor 1-like isofo...    308   1e-102   
ref|XP_007156762.1|  hypothetical protein PHAVU_002G015400g             308   1e-102   
ref|XP_002413376.1|  ADP-ribosylation factor                            308   1e-102   
gb|KDQ20587.1|  hypothetical protein BOTBODRAFT_26592                   308   1e-102   
ref|XP_004028569.1|  PREDICTED: ADP-ribosylation factor 1 isoform 5     308   1e-102   
emb|CDJ89627.1|  unnamed protein product                                308   1e-102   
ref|XP_004203082.1|  Piso0_000680                                       308   1e-102   
ref|NP_476955.1|  ADP ribosylation factor at 79F, isoform B             308   1e-102   
ref|XP_001484652.1|  ADP-ribosylation factor 1                          308   1e-102   
gb|ABD65453.1|  Arf1                                                    308   1e-102   
ref|XP_006109765.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    308   1e-102   
dbj|BAN20585.1|  ADP-ribosylation factor, arf                           308   1e-102   
gb|ADE42873.1|  ADP-ribosylation factor 1                               308   1e-102   
ref|XP_003448223.2|  PREDICTED: ADP-ribosylation factor 3-like is...    310   1e-102   
gb|KIL70197.1|  hypothetical protein M378DRAFT_96593                    307   1e-102   
gb|KHJ35367.1|  putative adp-ribosylation factor                        307   1e-102   
gb|EWC44149.1|  ADP-ribosylation factor 1                               307   1e-102   
ref|XP_006760139.1|  PREDICTED: ADP-ribosylation factor 1 isoform X3    308   1e-102   
ref|XP_007846256.1|  adp-ribosylation factor                            307   1e-102   
gb|ACI33823.1|  ADP-ribosylation factor 1                               307   1e-102   
ref|XP_002619854.1|  ADP-ribosylation factor 1                          307   1e-102   
gb|KII94939.1|  hypothetical protein PLICRDRAFT_97075                   307   1e-102   
gb|EMP31237.1|  ADP-ribosylation factor 3                               314   1e-102   
ref|XP_011201936.1|  PREDICTED: ADP-ribosylation factor 1               307   1e-102   
gb|KIW06748.1|  ADP-ribosylation factor                                 307   1e-102   
ref|NP_001156017.1|  ADP-ribosylation factor 3                          307   1e-102   
ref|XP_006760138.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    308   2e-102   
ref|XP_011186694.1|  PREDICTED: ADP-ribosylation factor 1               307   2e-102   
gb|AAP80740.1|  ADP-ribosylation factor 1                               307   2e-102   
ref|XP_005341336.1|  PREDICTED: ADP-ribosylation factor 1               308   2e-102   
ref|XP_001877050.1|  predicted protein                                  307   2e-102   
gb|EPQ67144.1|  ADP-ribosylation factor GTPase of the Ras superfa...    307   2e-102   
gb|KFU83844.1|  ADP-ribosylation factor 1                               307   2e-102   



>emb|CDX95712.1| BnaC03g25930D [Brassica napus]
Length=190

 Score =   340 bits (873),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 169/181 (93%), Gaps = 6/181 (3%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA*KVE*VPSSF*TFM  182
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK      V SS  TF+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK------VSSSSSTFL  189

Query  181  Y  179
            +
Sbjct  190  F  190



>emb|CDP13175.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   339 bits (869),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>emb|CBI25984.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   339 bits (870),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  46   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  105

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  106  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  165

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  166  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  211



>ref|NP_001236384.1| uncharacterized protein LOC100306021 [Glycine max]
 ref|XP_003517709.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Glycine 
max]
 ref|XP_003519837.1| PREDICTED: ADP-ribosylation factor 2-like isoformX1 [Glycine 
max]
 ref|XP_003557055.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Glycine 
max]
 ref|XP_004135254.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004165817.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004238652.1| PREDICTED: ADP-ribosylation factor 2 [Solanum lycopersicum]
 ref|XP_006356427.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006574623.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Glycine 
max]
 ref|XP_007044675.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007153744.1| hypothetical protein PHAVU_003G061400g [Phaseolus vulgaris]
 ref|XP_007223549.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 ref|XP_008221835.1| PREDICTED: ADP-ribosylation factor 2 [Prunus mume]
 ref|XP_008389663.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Malus domestica]
 ref|XP_008340051.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Malus domestica]
 ref|XP_008446200.1| PREDICTED: ADP-ribosylation factor 2 [Cucumis melo]
 ref|XP_008776867.1| PREDICTED: ADP-ribosylation factor 2 [Phoenix dactylifera]
 ref|XP_008776868.1| PREDICTED: ADP-ribosylation factor 2 [Phoenix dactylifera]
 ref|XP_009622926.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana tomentosiformis]
 ref|XP_009629759.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009759206.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana sylvestris]
 ref|XP_009758092.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana sylvestris]
 ref|XP_010029157.1| PREDICTED: ADP-ribosylation factor 2 [Eucalyptus grandis]
 ref|XP_010552645.1| PREDICTED: ADP-ribosylation factor 2 [Tarenaya hassleriana]
 ref|XP_010904967.1| PREDICTED: ADP-ribosylation factor 2 [Elaeis guineensis]
 ref|XP_011071092.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 ref|XP_011071093.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 ref|XP_011086584.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 gb|ACJ85464.1| unknown [Medicago truncatula]
 gb|ACN39752.1| unknown [Picea sitchensis]
 gb|ACN39787.1| unknown [Picea sitchensis]
 gb|ACN41130.1| unknown [Picea sitchensis]
 gb|ACU13997.1| unknown [Glycine max]
 gb|ACU23220.1| unknown [Glycine max]
 gb|AFK34829.1| unknown [Medicago truncatula]
 gb|AFK43802.1| unknown [Lotus japonicus]
 gb|AFK44369.1| unknown [Lotus japonicus]
 gb|AFK46588.1| unknown [Medicago truncatula]
 gb|EMJ24748.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 gb|EOY00507.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|ESW25738.1| hypothetical protein PHAVU_003G061400g [Phaseolus vulgaris]
 gb|EYU22499.1| hypothetical protein MIMGU_mgv1a014705mg [Erythranthe guttata]
 gb|EYU22500.1| hypothetical protein MIMGU_mgv1a014705mg [Erythranthe guttata]
 gb|EYU28446.1| hypothetical protein MIMGU_mgv1a014709mg [Erythranthe guttata]
 gb|KCW56009.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KCW56010.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KCW56011.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KEH27753.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AES96177.2| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|KGN51799.1| hypothetical protein Csa_5G601490 [Cucumis sativus]
 gb|KHN00363.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN12112.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN25534.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN26886.1| ADP-ribosylation factor 2 [Glycine soja]
Length=181

 Score =   338 bits (867),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_002302788.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 ref|XP_002320274.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_002264654.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera]
 ref|XP_002281047.1| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
 ref|XP_002515227.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 ref|XP_002515230.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 ref|XP_003518676.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 ref|XP_003535875.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 ref|XP_003555789.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Glycine 
max]
 ref|XP_003555790.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Glycine 
max]
 ref|XP_003591352.1| ADP ribosylation factor [Medicago truncatula]
 ref|XP_003632415.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera]
 ref|XP_004135977.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 ref|XP_004169278.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 ref|XP_004302301.1| PREDICTED: ADP-ribosylation factor-like [Fragaria vesca subsp. 
vesca]
 ref|XP_004495884.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 ref|XP_006386700.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006382312.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006375425.1| hypothetical protein POPTR_0014s11180g [Populus trichocarpa]
 ref|XP_006428233.1| hypothetical protein CICLE_v10012898mg [Citrus clementina]
 ref|XP_006444563.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006444564.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006444565.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006480701.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006492378.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492379.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_007051216.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007145024.1| hypothetical protein PHAVU_007G203600g [Phaseolus vulgaris]
 ref|XP_007145120.1| hypothetical protein PHAVU_007G211700g [Phaseolus vulgaris]
 ref|XP_007163209.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 ref|XP_007163210.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 ref|XP_007205795.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 ref|XP_008246262.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
 ref|XP_008353867.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 ref|XP_008362551.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 ref|XP_008461403.1| PREDICTED: ADP-ribosylation factor-like [Cucumis melo]
 ref|XP_008461404.1| PREDICTED: ADP-ribosylation factor-like [Cucumis melo]
 ref|XP_010042229.1| PREDICTED: ADP-ribosylation factor-like [Eucalyptus grandis]
 ref|XP_010270872.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270873.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270874.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270875.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270882.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270883.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270884.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010276502.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010276503.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_011040695.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011038982.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011038983.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011003176.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011003177.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011079513.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011079514.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011092180.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011092181.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 gb|ABB03801.1| ADP ribosylation factor 002 [Daucus carota]
 gb|ABK93146.1| unknown [Populus trichocarpa]
 gb|ABK93165.1| unknown [Populus trichocarpa]
 gb|ACJ84391.1| unknown [Medicago truncatula]
 gb|EEE82061.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 gb|EEE98589.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|EEF47211.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|EEF47214.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|AEA92306.1| Arf2 [Hevea brasiliensis]
 gb|AES61603.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AFK34270.1| unknown [Medicago truncatula]
 gb|AFS50009.1| hypothetical protein [Dendrobium catenatum]
 gb|EMJ06994.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gb|EOX95373.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|ERP53222.1| hypothetical protein POPTR_0014s11180g [Populus trichocarpa]
 gb|ERP60109.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP64497.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ESR41473.1| hypothetical protein CICLE_v10012898mg [Citrus clementina]
 gb|ESR57803.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESR57804.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESR57805.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESW17018.1| hypothetical protein PHAVU_007G203600g [Phaseolus vulgaris]
 gb|ESW17114.1| hypothetical protein PHAVU_007G211700g [Phaseolus vulgaris]
 gb|ESW35203.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 gb|ESW35204.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 gb|KDO86877.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KDO86878.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KGN45043.1| hypothetical protein Csa_7G414405 [Cucumis sativus]
 gb|KHG07003.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHG09762.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHG21203.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHN00327.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN02820.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KJB22479.1| hypothetical protein B456_004G049700 [Gossypium raimondii]
 gb|KJB24450.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
 gb|KJB24451.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
 gb|KJB41774.1| hypothetical protein B456_007G120600 [Gossypium raimondii]
 gb|KJB49771.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
 gb|KJB49772.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
 gb|KJB49773.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
Length=181

 Score =   338 bits (866),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_002892585.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 ref|XP_007031214.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|EFH68844.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EOY11716.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|KHG17086.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
 gb|KHG18341.1| ADP-ribosylation factor 2-B -like protein [Gossypium arboreum]
 gb|KJB81134.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
 gb|KJB81135.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
Length=181

 Score =   338 bits (866),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_008444322.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_008444323.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_008444324.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_010551584.1| PREDICTED: ADP-ribosylation factor 2-like [Tarenaya hassleriana]
Length=181

 Score =   338 bits (866),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_011087519.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Sesamum indicum]
 ref|XP_011087520.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Sesamum indicum]
Length=192

 Score =   338 bits (867),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  27   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  86

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  87   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  146

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  147  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  192



>ref|NP_191788.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|NP_001190161.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|NP_001190162.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|XP_002880284.1| ADP-ribosylation factor A1E [Arabidopsis lyrata subsp. lyrata]
 ref|XP_009142560.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_009142561.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_010523901.1| PREDICTED: ADP-ribosylation factor 1 [Tarenaya hassleriana]
 gb|AAK49618.1|AF372902_1 AT3g62290/T17J13_250 [Arabidopsis thaliana]
 emb|CAB71889.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|AAL15358.1| AT3g62290/T17J13_250 [Arabidopsis thaliana]
 gb|AAM62611.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|ABL97964.1| ADP-ribosylation factor-like protein [Brassica rapa]
 gb|EFH56543.1| ADP-ribosylation factor A1E [Arabidopsis lyrata subsp. lyrata]
 gb|AEE80332.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 gb|AEE80333.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 gb|AEE80334.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 emb|CDY51415.1| BnaA04g26920D [Brassica napus]
 emb|CDY37791.1| BnaC04g00340D [Brassica napus]
 emb|CDY27506.1| BnaC04g51470D [Brassica napus]
 emb|CDX89139.1| BnaA04g00470D [Brassica napus]
 emb|CDX80083.1| BnaA05g00730D [Brassica napus]
Length=181

 Score =   338 bits (866),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|ABR17508.1| unknown [Picea sitchensis]
 gb|ABR17650.1| unknown [Picea sitchensis]
 gb|ABR18399.1| unknown [Picea sitchensis]
 gb|ACN39755.1| unknown [Picea sitchensis]
 gb|ACN39884.1| unknown [Picea sitchensis]
 gb|ACN40399.1| unknown [Picea sitchensis]
Length=181

 Score =   338 bits (866),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_009391635.1| PREDICTED: ADP-ribosylation factor 2 [Musa acuminata subsp. malaccensis]
Length=181

 Score =   338 bits (866),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV+EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVIEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|NP_001290536.1| uncharacterized protein LOC105052388 [Elaeis guineensis]
 ref|XP_006438365.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 ref|XP_006438366.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 ref|XP_006483876.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006483877.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006483878.1| PREDICTED: ADP-ribosylation factor 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006842402.1| hypothetical protein AMTR_s00204p00014880 [Amborella trichopoda]
 ref|XP_008792471.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008792472.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008807332.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008807333.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 gb|AEQ94161.1| ADP-ribosylation factor [Elaeis guineensis]
 gb|ERN04077.1| hypothetical protein AMTR_s00204p00014880 [Amborella trichopoda]
 gb|ESR51605.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 gb|ESR51606.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
Length=181

 Score =   338 bits (866),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|ADH44695.1| ADP-ribosylation factor [Salvia miltiorrhiza]
Length=181

 Score =   337 bits (865),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDK+R
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKVR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>emb|CDX83340.1| BnaA03g21660D [Brassica napus]
Length=191

 Score =   338 bits (866),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 168/181 (93%), Gaps = 5/181 (3%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA*KVE*VPSSF*TFM  182
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK        SS  TF+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV-----SSSSSSTFL  190

Query  181  Y  179
            +
Sbjct  191  F  191



>ref|XP_009121644.1| PREDICTED: ADP-ribosylation factor 2 [Brassica rapa]
 ref|XP_009121645.1| PREDICTED: ADP-ribosylation factor 2 [Brassica rapa]
Length=181

 Score =   337 bits (865),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KHG04267.1| ADP-ribosylation factor [Gossypium arboreum]
Length=237

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_008777957.1| PREDICTED: ADP-ribosylation factor [Phoenix dactylifera]
 ref|XP_008777958.1| PREDICTED: ADP-ribosylation factor [Phoenix dactylifera]
 ref|XP_010914673.1| PREDICTED: ADP-ribosylation factor-like [Elaeis guineensis]
 ref|XP_010914674.1| PREDICTED: ADP-ribosylation factor-like [Elaeis guineensis]
 gb|ACL67836.1| ADP ribosylation factor [Jatropha curcas]
 gb|KDP23360.1| hypothetical protein JCGZ_23193 [Jatropha curcas]
Length=181

 Score =   337 bits (865),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_006291918.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 ref|XP_006295602.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
 ref|XP_006397909.1| hypothetical protein EUTSA_v10001656mg [Eutrema salsugineum]
 ref|XP_006402389.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 ref|XP_006402390.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 ref|XP_009599611.1| PREDICTED: ADP-ribosylation factor 1 [Nicotiana tomentosiformis]
 ref|XP_009599612.1| PREDICTED: ADP-ribosylation factor 1 [Nicotiana tomentosiformis]
 ref|XP_010506745.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010507921.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010512616.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010518410.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010413292.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010468970.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010544949.1| PREDICTED: ADP-ribosylation factor 1 [Tarenaya hassleriana]
 ref|XP_011087521.1| PREDICTED: ADP-ribosylation factor 1 isoform X3 [Sesamum indicum]
 gb|AAF65512.1| ADP-ribosylation factor [Capsicum annuum]
 gb|AAR03592.1| ARF-like small GTPase [Brassica juncea]
 gb|EOA24816.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 gb|EOA28500.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
 gb|ESQ39362.1| hypothetical protein EUTSA_v10001656mg [Eutrema salsugineum]
 gb|ESQ43842.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 gb|ESQ43843.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 emb|CDX93979.1| BnaC04g21380D [Brassica napus]
Length=181

 Score =   337 bits (865),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_007205794.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gb|EMJ06993.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
Length=243

 Score =   339 bits (870),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  78   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  137

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  138  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  197

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  198  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  243



>ref|XP_004304633.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   337 bits (864),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_008812250.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008812251.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008812252.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
Length=181

 Score =   337 bits (864),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_008806237.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
Length=181

 Score =   337 bits (864),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFV+DSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVIDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_009399937.1| PREDICTED: ADP-ribosylation factor 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399938.1| PREDICTED: ADP-ribosylation factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   337 bits (864),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|XP_006390885.1| hypothetical protein EUTSA_v10019096mg [Eutrema salsugineum]
 gb|ESQ28171.1| hypothetical protein EUTSA_v10019096mg [Eutrema salsugineum]
Length=226

 Score =   338 bits (868),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  61   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  120

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  121  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  180

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  181  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  226



>gb|AGV54515.1| ADP ribosylation factor [Phaseolus vulgaris]
Length=237

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_010553607.1| PREDICTED: ADP-ribosylation factor 2-B [Tarenaya hassleriana]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_006417443.1| hypothetical protein EUTSA_v10008885mg [Eutrema salsugineum]
 ref|XP_010547797.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 ref|XP_010547805.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 ref|XP_010533952.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 gb|ESQ35796.1| hypothetical protein EUTSA_v10008885mg [Eutrema salsugineum]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>gb|KJB11520.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=183

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_006305640.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
 gb|EOA38538.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
Length=197

 Score =   337 bits (865),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  32   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  91

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  92   PLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  151

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  152  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  197



>gb|KDP28302.1| hypothetical protein JCGZ_14073 [Jatropha curcas]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIAN+A
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANRA  181



>gb|EYU46846.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46847.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46848.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46849.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_008443527.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis melo]
 ref|XP_008443528.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis melo]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_004967765.1| PREDICTED: ADP-ribosylation factor 2-like [Setaria italica]
 ref|XP_006644030.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|NP_172533.2| ADP-ribosylation factor A1F [Arabidopsis thaliana]
 ref|XP_010475938.1| PREDICTED: ADP-ribosylation factor 1-like [Camelina sativa]
 gb|AAT41759.1| At1g10630 [Arabidopsis thaliana]
 gb|AAT70455.1| At1g10630 [Arabidopsis thaliana]
 dbj|BAE98462.1| similar to ADP-ribosylation factor gb|AAD17207 [Arabidopsis thaliana]
 gb|AEE28611.1| ADP-ribosylation factor A1F [Arabidopsis thaliana]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_004288363.1| PREDICTED: ADP-ribosylation factor 2-like [Fragaria vesca subsp. 
vesca]
 ref|XP_007221509.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 ref|XP_007221510.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 ref|XP_008227807.1| PREDICTED: ADP-ribosylation factor 2 [Prunus mume]
 ref|XP_008381455.1| PREDICTED: ADP-ribosylation factor 2-like [Malus domestica]
 ref|XP_009363094.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 ref|XP_009367177.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 ref|XP_009376185.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 gb|EMJ22708.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 gb|EMJ22709.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_003536036.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Glycine max]
 ref|XP_006589106.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Glycine max]
 ref|XP_006589107.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Glycine max]
 ref|XP_006589108.1| PREDICTED: ADP-ribosylation factor-like isoform X4 [Glycine max]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIANKA  181



>ref|XP_006344797.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006344798.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_011087517.1| PREDICTED: ADP-ribosylation factor 1-like [Sesamum indicum]
Length=181

 Score =   337 bits (863),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKS  181



>ref|XP_006361664.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361665.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006361666.1| PREDICTED: ADP-ribosylation factor 2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_009604530.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009604531.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009762302.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana sylvestris]
Length=181

 Score =   337 bits (863),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKS  181



>gb|KHN00225.1| ADP-ribosylation factor 2 [Glycine soja]
Length=184

 Score =   337 bits (863),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_002318935.1| hypothetical protein POPTR_0013s00700g [Populus trichocarpa]
 ref|XP_003553934.1| PREDICTED: ADP-ribosylation factor isoform 3 [Glycine max]
 ref|XP_006382311.1| hypothetical protein POPTR_0005s00910g [Populus trichocarpa]
 ref|XP_006375716.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 ref|XP_006375717.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_009757514.1| PREDICTED: ADP-ribosylation factor [Nicotiana sylvestris]
 ref|XP_010550140.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010550141.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554051.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554052.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554053.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010672580.1| PREDICTED: ADP-ribosylation factor [Beta vulgaris subsp. vulgaris]
 ref|XP_011023829.1| PREDICTED: ADP-ribosylation factor isoform X1 [Populus euphratica]
 ref|XP_011023830.1| PREDICTED: ADP-ribosylation factor isoform X2 [Populus euphratica]
 ref|XP_011023831.1| PREDICTED: ADP-ribosylation factor isoform X3 [Populus euphratica]
 ref|XP_011023832.1| PREDICTED: ADP-ribosylation factor isoform X4 [Populus euphratica]
 ref|XP_011038984.1| PREDICTED: ADP-ribosylation factor [Populus euphratica]
 gb|ABK93177.1| unknown [Populus trichocarpa]
 gb|ABK93657.1| unknown [Populus trichocarpa]
 gb|ABK95673.1| unknown [Populus trichocarpa]
 gb|EEE94858.1| hypothetical protein POPTR_0013s00700g [Populus trichocarpa]
 gb|ERP53513.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 gb|ERP53514.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP60108.1| hypothetical protein POPTR_0005s00910g [Populus trichocarpa]
 gb|KHN23524.1| ADP-ribosylation factor [Glycine soja]
 gb|KHN27442.1| ADP-ribosylation factor [Glycine soja]
 gb|KJB11517.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
 gb|KJB11519.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
 gb|KJB11521.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=181

 Score =   337 bits (863),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>gb|AAD17207.1| ADP-ribosylation factor [Glycine max]
Length=178

 Score =   336 bits (862),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  13   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  72

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  73   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  132

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  133  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  178



>ref|XP_009417875.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   336 bits (862),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_009113207.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_009113208.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 emb|CDY53050.1| BnaA09g14150D [Brassica napus]
Length=181

 Score =   336 bits (862),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>gb|KJB24452.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
Length=184

 Score =   337 bits (863),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_003618209.1| ADP-ribosylation factor [Medicago truncatula]
 ref|XP_004142795.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004142796.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156684.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156685.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004304634.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_004489257.1| PREDICTED: ADP-ribosylation factor 1-like [Cicer arietinum]
 ref|XP_006470306.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470307.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_008230584.1| PREDICTED: ADP-ribosylation factor 1 [Prunus mume]
 ref|XP_008341441.1| PREDICTED: ADP-ribosylation factor 1 [Malus domestica]
 ref|XP_008341442.1| PREDICTED: ADP-ribosylation factor 1 [Malus domestica]
 ref|XP_008458781.1| PREDICTED: ADP-ribosylation factor 1 [Cucumis melo]
 ref|XP_009334096.1| PREDICTED: ADP-ribosylation factor 1 [Pyrus x bretschneideri]
 ref|XP_009334097.1| PREDICTED: ADP-ribosylation factor 1 [Pyrus x bretschneideri]
 ref|XP_010029154.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010029155.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010029156.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010033289.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010033290.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 gb|AAR29293.1| ADP-ribosylation factor [Medicago sativa]
 emb|CAI29265.1| ADP-ribosylation factor 1 [Medicago truncatula]
 gb|AES74427.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AEV66152.1| ADP-ribosylation factor [Arachis hypogaea]
 gb|AFK42113.1| unknown [Medicago truncatula]
 gb|AFK44737.1| unknown [Lotus japonicus]
 gb|KCW56003.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56004.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56005.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56006.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KDO66122.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
 gb|KDO66123.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
 gb|KGN59678.1| hypothetical protein Csa_3G837590 [Cucumis sativus]
Length=181

 Score =   336 bits (862),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_010248146.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIANKA  181



>ref|XP_002265983.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Vitis vinifera]
 ref|XP_002265874.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Vitis vinifera]
 ref|XP_004297476.1| PREDICTED: ADP-ribosylation factor 2 [Fragaria vesca subsp. vesca]
 ref|XP_007157443.1| hypothetical protein PHAVU_002G070500g [Phaseolus vulgaris]
 ref|XP_010682536.1| PREDICTED: ADP-ribosylation factor 2 [Beta vulgaris subsp. vulgaris]
 gb|ESW29437.1| hypothetical protein PHAVU_002G070500g [Phaseolus vulgaris]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|NP_001055892.1| Os05g0489600 [Oryza sativa Japonica Group]
 ref|XP_002441289.1| hypothetical protein SORBIDRAFT_09g023880 [Sorghum bicolor]
 ref|XP_004961688.1| PREDICTED: ADP-ribosylation factor 2-like [Setaria italica]
 ref|XP_006644888.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
 ref|XP_006654568.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
 ref|XP_010232477.1| PREDICTED: ADP-ribosylation factor 2 [Brachypodium distachyon]
 ref|XP_010232479.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Brachypodium 
distachyon]
 sp|P51823.2|ARF2_ORYSJ RecName: Full=ADP-ribosylation factor 2 [Oryza sativa Japonica 
Group]
 dbj|BAA04607.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAB41081.1| ADP-ribosylation factor [Triticum aestivum]
 emb|CAD48129.2| ADP-ribosylation factor 1-like protein [Hordeum vulgare subsp. 
vulgare]
 gb|AAT77289.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF17806.1| Os05g0489600 [Oryza sativa Japonica Group]
 gb|EAY98506.1| hypothetical protein OsI_20417 [Oryza sativa Indica Group]
 dbj|BAG88186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90235.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99847.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64179.1| hypothetical protein OsJ_19011 [Oryza sativa Japonica Group]
 gb|EES19719.1| hypothetical protein SORBIDRAFT_09g023880 [Sorghum bicolor]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_004970328.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Setaria 
italica]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KJB81136.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
Length=227

 Score =   338 bits (867),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  62   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  121

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  122  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  181

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  182  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  227



>ref|XP_010922923.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010922924.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Elaeis 
guineensis]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KDP26602.1| hypothetical protein JCGZ_17760 [Jatropha curcas]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIAN+A
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANRA  181



>ref|NP_001170436.1| uncharacterized protein LOC100384428 [Zea mays]
 ref|XP_008648189.1| PREDICTED: uncharacterized protein LOC100384428 isoform X1 [Zea 
mays]
 ref|XP_008648190.1| PREDICTED: uncharacterized protein LOC100384428 isoform X1 [Zea 
mays]
 gb|ACN36989.1| unknown [Zea mays]
 gb|AFW78458.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
 gb|AFW78459.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
 gb|AFW78460.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=184

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|EYU38402.1| hypothetical protein MIMGU_mgv1a014684mg [Erythranthe guttata]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|NP_182239.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 sp|P36397.2|ARF1_ARATH RecName: Full=ADP-ribosylation factor 1; Short=AtARF1 [Arabidopsis 
thaliana]
 gb|AAA32729.1| ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAB63817.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAL75910.1| At2g47170/T3D7.2 [Arabidopsis thaliana]
 gb|AAM15469.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAM64892.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAM98296.1| At2g47170/T3D7.2 [Arabidopsis thaliana]
 gb|AEC10810.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_006488769.1| PREDICTED: ADP-ribosylation factor-like [Citrus sinensis]
 gb|KDO72116.1| hypothetical protein CISIN_1g030193mg [Citrus sinensis]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIATKA  181



>ref|XP_010092942.1| ADP-ribosylation factor 2 [Morus notabilis]
 gb|EXB52995.1| ADP-ribosylation factor 2 [Morus notabilis]
Length=188

 Score =   337 bits (863),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_003626009.1| ADP-ribosylation factor-like protein [Medicago truncatula]
Length=206

 Score =   337 bits (864),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA*KVE*VPSSF*TFM  182
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K  K +    +  ++ 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKVNKEKIFSETLLSYS  195

Query  181  YIL  173
            +++
Sbjct  196  FVM  198



>ref|XP_011040674.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011040681.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011040689.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
Length=189

 Score =   337 bits (863),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>emb|CDY47221.1| BnaC09g14700D [Brassica napus]
Length=181

 Score =   336 bits (862),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|NP_001275425.1| ADP-ribosylation factor 2-like [Solanum tuberosum]
 gb|ABA40446.1| unknown [Solanum tuberosum]
Length=181

 Score =   336 bits (862),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQS CATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIANKA  181



>dbj|BAJ87426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   336 bits (862),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_003618207.1| ADP-ribosylation factor [Medicago truncatula]
Length=248

 Score =   338 bits (868),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  83   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  142

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  143  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  202

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  203  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  248



>ref|XP_006399980.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 ref|XP_006399981.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 ref|XP_010420114.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010420115.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010453596.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010492281.1| PREDICTED: ADP-ribosylation factor isoform X2 [Camelina sativa]
 gb|ESQ41433.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 gb|ESQ41434.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
Length=181

 Score =   336 bits (861),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance 
By Agrobacterium Protein 6b
 pdb|3AQ4|B Chain B, Molecular Insights Into Plant Cell Proliferation Disturbance 
By Agrobacterium Protein 6b
Length=184

 Score =   336 bits (862),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  19   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  78

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  79   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  138

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  139  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  184



>ref|XP_004494449.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 ref|XP_011092183.1| PREDICTED: ADP-ribosylation factor-like [Sesamum indicum]
Length=181

 Score =   336 bits (861),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|XP_009629758.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Nicotiana tomentosiformis]
Length=244

 Score =   338 bits (867),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  79   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  138

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  139  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  198

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  199  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  244



>ref|XP_009138731.1| PREDICTED: ADP-ribosylation factor 1 [Brassica rapa]
Length=181

 Score =   336 bits (861),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQ+TQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQDTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|ADP00406.1| ADP-ribosylation factor [Actinidia chinensis]
Length=181

 Score =   336 bits (861),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDA+LLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAILLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>gb|KJB31031.1| hypothetical protein B456_005G181600, partial [Gossypium raimondii]
Length=180

 Score =   336 bits (861),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|KJB11518.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=205

 Score =   337 bits (864),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  40   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  99

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  100  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  159

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  160  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  205



>gb|KHG28118.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
Length=190

 Score =   336 bits (862),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  25   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  84

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  85   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  144

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  145  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  190



>ref|XP_010524305.1| PREDICTED: ADP-ribosylation factor-like [Tarenaya hassleriana]
Length=181

 Score =   336 bits (861),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>emb|CDY47137.1| BnaA08g05460D [Brassica napus]
Length=181

 Score =   336 bits (861),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>gb|AGH68504.1| ADP-ribosylation factor, partial [Ipomoea batatas]
Length=180

 Score =   336 bits (861),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_011003178.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
Length=181

 Score =   336 bits (861),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>emb|CAD12855.1| ADP-ribosylation factor [Gossypium hirsutum]
 gb|AAO37820.1| ADP-ribosylation factor [Gossypium hirsutum]
 gb|AAO45616.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gb|AAO62348.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gb|KJB82422.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82423.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82426.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82427.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82428.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82429.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
Length=181

 Score =   336 bits (861),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|XP_006356426.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Solanum 
tuberosum]
Length=184

 Score =   336 bits (861),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_010943658.1| PREDICTED: ADP-ribosylation factor 2-like [Elaeis guineensis]
Length=181

 Score =   336 bits (861),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|NP_177206.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|NP_564195.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 ref|NP_850975.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|NP_974120.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|XP_002890586.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009127800.1| PREDICTED: ADP-ribosylation factor 2-B isoform X2 [Brassica rapa]
 ref|XP_009127801.1| PREDICTED: ADP-ribosylation factor 2-B isoform X2 [Brassica rapa]
 ref|XP_009103171.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_009103173.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_010498859.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010415728.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010415729.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010427826.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010427827.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010460136.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010471043.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010471044.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010477643.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 sp|P0DH91.1|ARF2B_ARATH RecName: Full=ADP-ribosylation factor 2-B; Short=AtARF2; AltName: 
Full=ARF1-like protein U5 [Arabidopsis thaliana]
 sp|Q9LQC8.2|ARF2A_ARATH RecName: Full=ADP-ribosylation factor 2-A; Short=AtARF2 [Arabidopsis 
thaliana]
 gb|AAG40035.1|AF324684_1 At1g23490 [Arabidopsis thaliana]
 gb|AAG40377.1|AF325025_1 At1g70490 [Arabidopsis thaliana]
 gb|AAG42921.1|AF329504_1 putative ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAG52463.1|AC010796_2 putative ADP-ribosylation factor 1; 15065-14075 [Arabidopsis 
thaliana]
 gb|AAK25874.1|AF360164_1 putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAK49591.1|AF372875_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gb|AAK49617.1|AF372901_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gb|AAL07190.1| putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAL15357.1| At1g23490/F5O8_5 [Arabidopsis thaliana]
 gb|AAM44988.1| putative ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAM64791.1| ADP-ribosylation factor 1-like [Arabidopsis thaliana]
 gb|EFH66845.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30394.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AEE35068.1| ARF GTPase family protein [Arabidopsis thaliana]
 gb|AEE35069.1| ARF GTPase family protein [Arabidopsis thaliana]
 gb|AEE35070.1| ARF GTPase family protein [Arabidopsis thaliana]
 emb|CDY54291.1| BnaC07g48320D [Brassica napus]
 emb|CDY44152.1| BnaA09g31000D [Brassica napus]
 emb|CDY25787.1| BnaA07g09950D [Brassica napus]
 emb|CDY11588.1| BnaC06g31510D [Brassica napus]
 emb|CDY09441.1| BnaC02g19830D [Brassica napus]
 emb|CDY04706.1| BnaC05g18830D [Brassica napus]
 emb|CDY03747.1| BnaA02g14900D [Brassica napus]
Length=181

 Score =   336 bits (861),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>gb|AEZ00866.1| putative ADP-ribosylation factor protein [Elaeis guineensis]
Length=181

 Score =   336 bits (861),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKN SFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNFSFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_002962225.1| ARF family GTPase [Selaginella moellendorffii]
 ref|XP_002965138.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ33976.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ37485.1| ARF family GTPase [Selaginella moellendorffii]
Length=181

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>gb|KDO66124.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
Length=189

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>ref|XP_004135253.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004165816.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis 
sativus]
Length=189

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_006480700.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
Length=183

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|NP_001274834.1| ARF-like small GTPase-like protein [Solanum tuberosum]
 ref|XP_006344796.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum tuberosum]
 ref|XP_009626500.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana tomentosiformis]
 ref|XP_009794408.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 ref|XP_009759065.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 ref|XP_010313700.1| PREDICTED: ADP-ribosylation factor 1 [Solanum lycopersicum]
 ref|XP_010313704.1| PREDICTED: ADP-ribosylation factor 1 [Solanum lycopersicum]
 ref|XP_010313716.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum lycopersicum]
 ref|XP_010313724.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum lycopersicum]
 gb|ABA40455.1| ARF-like small GTPase-like protein [Solanum tuberosum]
 gb|ABC01907.1| ARF-like small GTPase-like protein [Solanum tuberosum]
Length=181

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|XP_006296139.1| hypothetical protein CARUB_v10025292mg, partial [Capsella rubella]
 gb|EOA29037.1| hypothetical protein CARUB_v10025292mg, partial [Capsella rubella]
Length=180

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|AIX10946.1| putative ADP-ribosylation factor [Gardenia jasminoides]
Length=181

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLP+AMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPDAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|NP_001136508.1| uncharacterized protein LOC100216623 [Zea mays]
 ref|XP_008654461.1| PREDICTED: uncharacterized protein LOC100216623 isoform X1 [Zea 
mays]
 gb|ACF82071.1| unknown [Zea mays]
 gb|AFW79616.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gb|AFW79617.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gb|AFW79618.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=181

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|XP_008389662.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Malus domestica]
 ref|XP_008340050.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Malus domestica]
Length=182

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_002876669.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52928.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_002888469.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64728.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_010941504.1| PREDICTED: ADP-ribosylation factor [Elaeis guineensis]
Length=181

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFV+DSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVIDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIANKA  181



>ref|XP_004252939.1| PREDICTED: ADP-ribosylation factor 2 [Solanum lycopersicum]
Length=181

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI+NKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISNKA  181



>gb|ACJ84691.1| unknown [Medicago truncatula]
 gb|AFK35530.1| unknown [Medicago truncatula]
 gb|AES82227.2| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
Length=181

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS  181



>ref|XP_010659724.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
Length=183

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|AFW78462.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=199

 Score =   336 bits (862),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  31   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  90

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  91   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  150

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  151  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  196



>gb|EPS68301.1| hypothetical protein M569_06468, partial [Genlisea aurea]
Length=180

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV+EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVIEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>emb|CDY09875.1| BnaC09g42860D [Brassica napus]
Length=213

 Score =   337 bits (863),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_010491587.1| PREDICTED: ADP-ribosylation factor 1-like [Camelina sativa]
Length=181

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_011038977.1| PREDICTED: ADP-ribosylation factor-like [Populus euphratica]
 ref|XP_011038978.1| PREDICTED: ADP-ribosylation factor-like [Populus euphratica]
 ref|XP_011038980.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011038981.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
Length=183

 Score =   335 bits (860),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|AAT08648.1| ADP-ribosylation factor [Hyacinthus orientalis]
Length=199

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  34   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  93

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  94   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  153

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K 
Sbjct  154  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKG  199



>ref|XP_002457613.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
 gb|EES02733.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANKA  181



>ref|XP_009110099.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Brassica rapa]
 gb|ACD37536.1| putative ADP-ribosylation factor [Brassica napus]
 emb|CDY41444.1| BnaA08g20460D [Brassica napus]
 emb|CDX91717.1| BnaC08g06360D [Brassica napus]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_001776147.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ59058.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKA  181



>ref|XP_001764375.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70929.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKA  181



>ref|NP_001149117.1| ADP-ribosylation factor [Zea mays]
 ref|XP_002456522.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor]
 ref|XP_008672877.1| PREDICTED: ADP-ribosylation factor isoform X1 [Zea mays]
 gb|ACF83883.1| unknown [Zea mays]
 gb|ACF88010.1| unknown [Zea mays]
 gb|ACG34254.1| ADP-ribosylation factor [Zea mays]
 gb|ACG42128.1| ADP-ribosylation factor [Zea mays]
 gb|EES01642.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor]
 tpg|DAA57153.1| TPA: ADP-ribosylation factor [Zea mays]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKS  181



>ref|XP_009595261.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana tomentosiformis]
 ref|XP_009775097.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 dbj|BAF34209.1| ADP ribosylation factor [Nicotiana tabacum]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI+NKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISNKA  181



>ref|NP_001042668.1| Os01g0265100 [Oryza sativa Japonica Group]
 dbj|BAA90347.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAA92519.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF04582.1| Os01g0265100 [Oryza sativa Japonica Group]
 dbj|BAG90318.1| unnamed protein product [Oryza sativa Japonica Group]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANKA  181



>emb|CDX69567.1| BnaA10g19160D [Brassica napus]
Length=206

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|NP_001274832.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB16972.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB16982.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB87122.1| ADP-ribosylation factor 1-like [Solanum tuberosum]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>sp|O48920.3|ARF_VIGUN RecName: Full=ADP-ribosylation factor [Vigna unguiculata]
 gb|AAB91395.1| ADP-ribosylation factor [Vigna unguiculata]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>gb|KDP46432.1| hypothetical protein JCGZ_10272 [Jatropha curcas]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>ref|XP_006288755.1| hypothetical protein CARUB_v10002073mg [Capsella rubella]
 gb|EOA21653.1| hypothetical protein CARUB_v10002073mg [Capsella rubella]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_010108788.1| ADP-ribosylation factor [Morus notabilis]
 gb|EXC20303.1| ADP-ribosylation factor [Morus notabilis]
Length=185

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>gb|KHG04030.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KJB15573.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
 gb|KJB15574.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
 gb|KJB15577.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGL+SLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|EYU19417.1| hypothetical protein MIMGU_mgv1a014679mg [Erythranthe guttata]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|NP_001044599.1| Os01g0813400 [Oryza sativa Japonica Group]
 sp|Q06396.3|ARF1_ORYSJ RecName: Full=ADP-ribosylation factor 1; AltName: Full=13 kDa 
cold-induced protein [Oryza sativa Japonica Group]
 dbj|BAD68219.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAD82682.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF06513.1| Os01g0813400 [Oryza sativa Japonica Group]
 dbj|BAG88255.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71689.1| hypothetical protein OsI_04181 [Oryza sativa Indica Group]
 gb|EEE55569.1| hypothetical protein OsJ_03844 [Oryza sativa Japonica Group]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_007031496.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007215053.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 ref|XP_007215054.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 ref|XP_008379235.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 gb|EMJ16252.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 gb|EMJ16253.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 gb|EOY02422.1| ADP-ribosylation factor A1F [Theobroma cacao]
Length=181

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>ref|XP_004228551.1| PREDICTED: ADP-ribosylation factor 2-like [Solanum lycopersicum]
Length=181

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_009612443.1| PREDICTED: ADP-ribosylation factor [Nicotiana tomentosiformis]
Length=181

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCA SGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCAASGEGLYEGLDWLSNNIASKA  181



>ref|XP_010313707.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Solanum lycopersicum]
 ref|XP_010313711.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Solanum lycopersicum]
Length=183

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_009416365.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416366.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416367.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416368.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416369.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416370.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
Length=181

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEA+DELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_009118871.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
Length=181

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLI VVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLISVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_009389142.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389143.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389144.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389145.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 gb|KJB75876.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
 gb|KJB75877.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
Length=181

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKA  181



>gb|ACM67554.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
Length=181

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKA  181



>gb|AFK42466.1| unknown [Lotus japonicus]
Length=181

 Score =   335 bits (858),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDA GKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAVGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_010094415.1| ADP-ribosylation factor 2 [Morus notabilis]
 gb|EXB55996.1| ADP-ribosylation factor 2 [Morus notabilis]
Length=203

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|KCW56002.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=190

 Score =   335 bits (858),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>ref|XP_010651474.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Vitis vinifera]
Length=181

 Score =   334 bits (857),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|EMT17349.1| ADP-ribosylation factor 2 [Aegilops tauschii]
Length=193

 Score =   335 bits (859),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>gb|KJB75878.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
Length=191

 Score =   335 bits (858),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKA  181



>gb|AFK39359.1| unknown [Medicago truncatula]
Length=181

 Score =   334 bits (857),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLP+AMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPDAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_004158320.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus]
 ref|XP_008443537.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Cucumis 
melo]
 gb|KGN59683.1| hypothetical protein Csa_3G837640 [Cucumis sativus]
Length=181

 Score =   334 bits (857),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI +KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSKA  181



>ref|NP_001280835.1| ADP-ribosylation factor [Malus domestica]
 gb|AEX97079.1| ADP-ribosylation factor [Malus domestica]
Length=188

 Score =   335 bits (858),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_001764701.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 ref|XP_001764769.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70400.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70468.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   334 bits (857),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIANK+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKS  181



>gb|AAF17671.1|AC009398_20 F20B24.7 [Arabidopsis thaliana]
Length=186

 Score =   334 bits (857),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>gb|KGN51378.1| hypothetical protein Csa_5G524710 [Cucumis sativus]
Length=191

 Score =   335 bits (858),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>emb|CDM84658.1| unnamed protein product [Triticum aestivum]
Length=182

 Score =   334 bits (857),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|KJB15578.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=192

 Score =   335 bits (858),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 169/181 (93%), Gaps = 5/181 (3%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA*KVE*VPSSF*TFM  182
            AAEITDKLGL+SLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK  +      +F T++
Sbjct  136  AAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKVRRY-----TFKTYL  190

Query  181  Y  179
            Y
Sbjct  191  Y  191



>ref|XP_010319588.1| PREDICTED: ADP-ribosylation factor [Solanum lycopersicum]
Length=185

 Score =   334 bits (857),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD VLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDVVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_004970327.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Setaria 
italica]
Length=182

 Score =   334 bits (857),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|AFW78457.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=182

 Score =   334 bits (856),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_002888782.1| hypothetical protein ARALYDRAFT_476172 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009127797.1| PREDICTED: ADP-ribosylation factor 2-B isoform X1 [Brassica rapa]
 ref|XP_009127798.1| PREDICTED: ADP-ribosylation factor 2-B isoform X1 [Brassica rapa]
 gb|EFH65041.1| hypothetical protein ARALYDRAFT_476172 [Arabidopsis lyrata subsp. 
lyrata]
Length=182

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGK  180



>gb|EMS63688.1| ADP-ribosylation factor 2 [Triticum urartu]
Length=186

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_010660901.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
 ref|XP_010660902.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
Length=183

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD+VLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDSVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIATKA  181



>ref|XP_009375124.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009375125.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009377201.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009377202.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
Length=181

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>ref|XP_007151018.1| hypothetical protein PHAVU_004G011900g [Phaseolus vulgaris]
 gb|AGZ15424.1| ADP-ribosylation factor 1 [Phaseolus vulgaris]
 gb|ESW23012.1| hypothetical protein PHAVU_004G011900g [Phaseolus vulgaris]
Length=181

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>gb|ABD73294.1| ADP-ribosylation factor-like protein [Panax ginseng]
Length=181

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLN DELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNGDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_006416080.1| hypothetical protein EUTSA_v10008884mg [Eutrema salsugineum]
 gb|ESQ34433.1| hypothetical protein EUTSA_v10008884mg [Eutrema salsugineum]
Length=181

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_010679455.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679456.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679457.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
Length=181

 Score =   333 bits (855),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKL LHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLSLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_009133804.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
Length=181

 Score =   333 bits (855),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/166 (98%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHW IQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWDIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_002871626.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47885.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score =   334 bits (856),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>ref|XP_010232478.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Brachypodium 
distachyon]
Length=182

 Score =   333 bits (855),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_009776781.1| PREDICTED: ADP-ribosylation factor-like [Nicotiana sylvestris]
 ref|XP_009776782.1| PREDICTED: ADP-ribosylation factor-like [Nicotiana sylvestris]
Length=181

 Score =   333 bits (855),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQG+IFVVDSNDRDRV+EARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGIIFVVDSNDRDRVIEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_010492280.1| PREDICTED: ADP-ribosylation factor isoform X1 [Camelina sativa]
Length=183

 Score =   333 bits (855),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>ref|XP_003557370.1| PREDICTED: ADP-ribosylation factor 1 [Brachypodium distachyon]
Length=181

 Score =   333 bits (855),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKS  181



>gb|ABY76246.1| ADP-ribosylation factor [Brassica napus]
Length=181

 Score =   333 bits (855),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLP+AMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPDAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_003591353.1| ADP ribosylation factor [Medicago truncatula]
 gb|ADN33830.1| ADP-ribosylation factor [Cucumis melo subsp. melo]
Length=164

 Score =   333 bits (853),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  715  MRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL  536
            MRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL
Sbjct  1    MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL  60

Query  535  WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA  356
            WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA
Sbjct  61   WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA  120

Query  355  EITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            EITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  121  EITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  164



>gb|AAC98042.1| Strong similarity to gb|M95166 ADP-ribosylation factor from Arabidopsis 
thaliana. ESTs gb|Z25826, gb|R90191, gb|N65697, gb|AA713150, 
gb|T46332, gb|AA040967, gb|AA712956, gb|T46403, 
gb|T46050, gb|AI100391 and gb|Z25043 come from this gene [Arabidopsis 
thaliana]
Length=188

 Score =   333 bits (855),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGK  180



>ref|XP_002277054.2| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
 ref|XP_010660903.1| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
Length=181

 Score =   333 bits (855),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD+VLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDSVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GL+WLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIATKA  181



>ref|NP_001051676.1| Os03g0811900 [Oryza sativa Japonica Group]
 ref|XP_006650781.1| PREDICTED: ADP-ribosylation factor 1-like [Oryza brachyantha]
 gb|AAP73857.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 gb|ABF99500.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99501.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99504.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13590.1| Os03g0811900 [Oryza sativa Japonica Group]
 emb|CCI55417.1| PH01B015M02.18 [Phyllostachys edulis]
Length=181

 Score =   333 bits (855),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  181



>ref|XP_002312302.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_011019121.1| PREDICTED: ADP-ribosylation factor 1-like [Populus euphratica]
 gb|ABK94475.1| unknown [Populus trichocarpa]
 gb|EEE89669.1| ADP-ribosylation factor family protein [Populus trichocarpa]
Length=181

 Score =   333 bits (854),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_009395959.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395960.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395962.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   333 bits (854),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI +KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSKA  181



>ref|XP_009110098.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Brassica rapa]
Length=182

 Score =   333 bits (855),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGK  180



>ref|XP_009381359.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381360.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   333 bits (854),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI +KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSKA  181



>gb|ABR17658.1| unknown [Picea sitchensis]
 gb|ACN40238.1| unknown [Picea sitchensis]
Length=181

 Score =   333 bits (854),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAM 
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVAEARDELHRMLNEDELRDAVLLVFANKQDLPNAMT  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|NP_001059207.1| Os07g0223400 [Oryza sativa Japonica Group]
 ref|NP_001147310.1| ADP-ribosylation factor 1 [Zea mays]
 ref|NP_001146953.1| ADP-ribosylation factor 1 [Zea mays]
 ref|XP_002459554.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 ref|XP_004955819.1| PREDICTED: ADP-ribosylation factor 1-like [Setaria italica]
 ref|XP_006657565.1| PREDICTED: ADP-ribosylation factor 1-like [Oryza brachyantha]
 gb|AAB65432.1| ADP-ribosylation factor 1 [Oryza sativa]
 dbj|BAC06914.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAC45192.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAD31195.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAF21121.1| Os07g0223400 [Oryza sativa Japonica Group]
 gb|ACF83333.1| unknown [Zea mays]
 gb|ACG24722.1| ADP-ribosylation factor 1 [Zea mays]
 gb|ACG26712.1| ADP-ribosylation factor 1 [Zea mays]
 dbj|BAH01227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81745.1| hypothetical protein OsI_25399 [Oryza sativa Indica Group]
 gb|EEC81746.1| hypothetical protein OsI_25400 [Oryza sativa Indica Group]
 gb|ACN30622.1| unknown [Zea mays]
 gb|EER96075.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 tpg|DAA60037.1| TPA: ADP-ribosylation factor 1 [Zea mays]
Length=181

 Score =   333 bits (854),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  181



>sp|P51821.2|ARF1_CHLRE RecName: Full=ADP-ribosylation factor 1 [Chlamydomonas reinhardtii]
 gb|AAA92566.1| ADP-ribosylation factor [Chlamydomonas reinhardtii]
Length=181

 Score =   333 bits (854),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNN+ANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNLANK  180



>gb|EEE66819.1| hypothetical protein OsJ_23579 [Oryza sativa Japonica Group]
Length=279

 Score =   337 bits (863),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  114  KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  173

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  174  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  233

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+KA
Sbjct  234  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  279



>gb|AAO62347.1| ARF1-like GTP-binding protein [Gossypium hirsutum]
Length=181

 Score =   333 bits (854),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD+IR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN+DELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNKDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>sp|P51822.2|ARF1_DAUCA RecName: Full=ADP-ribosylation factor 1 [Daucus carota]
 dbj|BAA08259.1| ADP-ribosylation factor [Daucus carota]
Length=181

 Score =   333 bits (854),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEI DKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K+
Sbjct  136  AAEIIDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS  181



>ref|XP_009410044.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   333 bits (853),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>ref|XP_009403841.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   333 bits (853),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>ref|XP_011462890.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   333 bits (853),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR VEARDE+HRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRAVEARDEVHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            A EITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  ADEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|NP_196971.1| ADP-ribosylation factor A1B [Arabidopsis thaliana]
 emb|CAB87634.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|AED92061.1| ADP-ribosylation factor A1B [Arabidopsis thaliana]
Length=188

 Score =   333 bits (854),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIATK  180



>ref|XP_009115521.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_009115522.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
Length=181

 Score =   333 bits (853),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILM  LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMGGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_010551906.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Tarenaya hassleriana]
 ref|XP_010551907.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Tarenaya hassleriana]
Length=181

 Score =   333 bits (853),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI++KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKA  181



>gb|AFW67224.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=206

 Score =   333 bits (855),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATK  180



>ref|XP_002466220.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
 ref|XP_010227861.1| PREDICTED: ADP-ribosylation factor [Brachypodium distachyon]
 gb|EER93218.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
Length=181

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKS  181



>ref|XP_004981305.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Setaria italica]
Length=213

 Score =   333 bits (855),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK  180



>ref|XP_002521452.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|EEF40942.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
Length=181

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGL+SLRQRHWYIQSTCATSGEGLY GL+WLSNNIA+KA
Sbjct  136  AAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>gb|KJB09503.1| hypothetical protein B456_001G146100 [Gossypium raimondii]
Length=181

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHR LNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRTLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHS RQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKLGLHSPRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_008443534.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
 ref|XP_008443535.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
 ref|XP_008443536.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
Length=186

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI +K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSK  180



>ref|XP_009393904.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393905.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>gb|AFW79615.1| hypothetical protein ZEAMMB73_444016, partial [Zea mays]
Length=210

 Score =   333 bits (855),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANK  180



>ref|XP_002314987.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006378561.1| hypothetical protein POPTR_0010s16240g [Populus trichocarpa]
 ref|XP_011011379.1| PREDICTED: ADP-ribosylation factor 1 [Populus euphratica]
 sp|O48649.3|ARF1_SALBA RecName: Full=ADP-ribosylation factor 1 [Salix bakko]
 dbj|BAA24696.1| ADP-ribosylation factor [Salix bakko]
 gb|AAO63780.1| ADP-ribosylation factor 2 [Populus tremuloides]
 gb|ABK92843.1| unknown [Populus trichocarpa]
 gb|EEF01158.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP56358.1| hypothetical protein POPTR_0010s16240g [Populus trichocarpa]
Length=181

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI++KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKA  181



>ref|XP_003557369.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon]
Length=181

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKS  181



>ref|XP_001764700.1| predicted protein [Physcomitrella patens]
 gb|EDQ70399.1| predicted protein [Physcomitrella patens]
Length=190

 Score =   332 bits (852),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANK  180



>ref|XP_009383762.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009383763.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
Length=180

 Score =   332 bits (851),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>ref|XP_010551905.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Tarenaya hassleriana]
Length=208

 Score =   333 bits (854),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  43   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  102

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  103  PLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  162

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI++KA
Sbjct  163  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKA  208



>gb|AAU82112.1| ADP-ribosylation factor [Triticum aestivum]
Length=181

 Score =   332 bits (851),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATAGEGLYEGLDWLSSNIASKS  181



>ref|XP_009420958.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420959.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   332 bits (851),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>gb|ACF80896.1| unknown [Zea mays]
 gb|AFW67225.1| ADP-ribosylation factor [Zea mays]
Length=181

 Score =   332 bits (851),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATKS  181



>ref|XP_004981306.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Setaria italica]
Length=198

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  33   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  92

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  93   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  152

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+K+
Sbjct  153  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKS  198



>gb|AFW67226.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=241

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  68   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  127

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  128  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  187

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA K
Sbjct  188  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATK  232



>ref|XP_003618208.1| ADP-ribosylation factor [Medicago truncatula]
Length=164

 Score =   331 bits (849),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  715  MRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL  536
            MRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL
Sbjct  1    MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL  60

Query  535  WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA  356
            WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA
Sbjct  61   WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA  120

Query  355  EITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            EITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  121  EITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  164



>gb|AAO63779.1| ADP-ribosylation factor 1 [Populus tremuloides]
Length=181

 Score =   332 bits (851),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EAR+ELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVGEAREELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>gb|ACM67553.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
Length=181

 Score =   332 bits (851),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQD PNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDPPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKA  181



>ref|XP_002318934.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 gb|EEE94857.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
Length=182

 Score =   332 bits (850),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/167 (97%), Positives = 163/167 (98%), Gaps = 1/167 (1%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNE-DELRDAVLLVFANKQDLPNAM  365
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNE DELRDAVLLVFANKQDLPNAM
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEVDELRDAVLLVFANKQDLPNAM  135

Query  364  NAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            NAAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  NAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  182



>ref|XP_006419277.1| hypothetical protein CICLE_v10006079mg [Citrus clementina]
 gb|ESR32517.1| hypothetical protein CICLE_v10006079mg [Citrus clementina]
Length=164

 Score =   331 bits (848),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  715  MRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL  536
            MRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL
Sbjct  1    MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL  60

Query  535  WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA  356
            WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA
Sbjct  61   WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAA  120

Query  355  EITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            EITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA KA
Sbjct  121  EITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIATKA  164



>gb|ACG31280.1| ADP-ribosylation factor 1 [Zea mays]
Length=181

 Score =   332 bits (850),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILM  LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMFGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  181



>gb|ACU16903.1| unknown [Glycine max]
Length=204

 Score =   332 bits (852),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIA  233
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA  178



>gb|ADB85106.1| ADP ribosylation factor 002 [Jatropha curcas]
Length=181

 Score =   332 bits (850),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQD PNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDFPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHS RQRHWYIQSTCAT GEGLY GLDWLSNNIAN+A
Sbjct  136  AAEITDKLGLHSFRQRHWYIQSTCATFGEGLYEGLDWLSNNIANRA  181



>gb|EMS51203.1| ADP-ribosylation factor 2 [Triticum urartu]
Length=233

 Score =   333 bits (855),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 166/175 (95%), Gaps = 2/175 (1%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA*KVE*VPSS  197
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK  +V  VP  
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK--EVHFVPPP  188



>ref|XP_004981304.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Setaria italica]
Length=230

 Score =   333 bits (854),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  33   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  92

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  93   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  152

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+K
Sbjct  153  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK  197



>gb|AAT08663.1| ADP-ribosylation factor [Hyacinthus orientalis]
Length=181

 Score =   331 bits (849),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGL SLRQRHWYIQSTCATSGEGLY GLDWLS+NI+NK+
Sbjct  136  AAEITDKLGLQSLRQRHWYIQSTCATSGEGLYEGLDWLSSNISNKS  181



>gb|AAP69821.1| ARF [Oryza sativa Japonica Group]
Length=181

 Score =   331 bits (849),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTV DVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVRDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIANKA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANKA  181



>ref|NP_001168955.1| uncharacterized protein LOC100382775 [Zea mays]
 gb|ACN31185.1| unknown [Zea mays]
 gb|AFW84789.1| hypothetical protein ZEAMMB73_845118 [Zea mays]
Length=181

 Score =   331 bits (849),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NI++K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNISSKS  181



>gb|EEE66818.1| hypothetical protein OsJ_23578 [Oryza sativa Japonica Group]
Length=241

 Score =   333 bits (855),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  76   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  135

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  136  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  195

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+KA
Sbjct  196  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  241



>ref|XP_005643690.1| ADP-ribosylation factor 1 [Coccomyxa subellipsoidea C-169]
 gb|EIE19146.1| ADP-ribosylation factor 1 [Coccomyxa subellipsoidea C-169]
Length=181

 Score =   331 bits (848),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKG  181



>gb|AEX49947.1| ADP-ribosylation factor 1 [Haloxylon ammodendron]
Length=181

 Score =   331 bits (848),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLVFANKQDLPNAM 
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMT  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>ref|XP_001776112.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ59023.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   331 bits (848),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLP+AMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPDAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NI NK+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNITNKS  181



>gb|ABF74733.1| ADP-ribosylation factor 1 [Nicotiana benthamiana]
Length=181

 Score =   331 bits (848),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEI TTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIGTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQD PNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDPPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKS  181



>ref|XP_011462888.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=216

 Score =   332 bits (851),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  51   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  110

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR VEARDE+HRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  111  PLWRHYFQNTQGLIFVVDSNDRDRAVEARDEVHRMLNEDELRDAVLLVFANKQDLPNAMN  170

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            A EITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  171  ADEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  216



>ref|NP_001237492.1| uncharacterized protein LOC100499890 [Glycine max]
 gb|ACU14076.1| unknown [Glycine max]
Length=181

 Score =   330 bits (847),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRD VVEARDELH MLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDLVVEARDELHGMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>gb|EAY92309.1| hypothetical protein OsI_14032 [Oryza sativa Indica Group]
Length=354

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKS  181



>gb|EAY73411.1| hypothetical protein OsI_01294 [Oryza sativa Indica Group]
 gb|EAZ11343.1| hypothetical protein OsJ_01211 [Oryza sativa Japonica Group]
Length=216

 Score =   332 bits (850),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANK  180



>ref|XP_010674549.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score =   330 bits (846),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLVFANKQDLPNAM 
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMT  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGL+SLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  136  AAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_003613219.1| ADP-ribosylation factor [Medicago truncatula]
Length=454

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  289  KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  348

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  349  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  408

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  409  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  454


 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|AFW79619.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=278

 Score =   333 bits (855),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLSNNIANK 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKV  181



>ref|XP_001776146.1| predicted protein [Physcomitrella patens]
 gb|EDQ59057.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   330 bits (846),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   QEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDEL RMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELLRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS+NIANK+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKS  181



>ref|XP_010694842.1| PREDICTED: ADP-ribosylation factor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=181

 Score =   330 bits (845),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELR AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRYAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKG  181



>dbj|BAB90396.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
Length=376

 Score =   337 bits (863),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  194  KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  253

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  254  PLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  313

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  314  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  358



>sp|O23778.3|ARF1_CATRO RecName: Full=ADP-ribosylation factor 1 [Catharanthus roseus]
 gb|AAB62249.1| ADP-ribosylation factor 1 [Catharanthus roseus]
Length=181

 Score =   329 bits (844),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI Y+LKLGEIVTTIPTIGFNVETVEY+ ISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYQLKLGEIVTTIPTIGFNVETVEYQYISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDK GLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  AAEITDKHGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>dbj|BAK00965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   329 bits (844),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIAEARDELHRMLNEDELRNAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQS CATSGEGLY GLDWLSNNIA+K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS  181



>ref|NP_001105897.1| ADP-ribosylation factor [Zea mays]
 sp|P49076.2|ARF_MAIZE RecName: Full=ADP-ribosylation factor [Zea mays]
 emb|CAA56351.1| ADP-ribosylation factor [Zea mays]
Length=181

 Score =   329 bits (844),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGL+SLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA K+
Sbjct  136  AAEITDKLGLNSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATKS  181



>ref|XP_009394868.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   329 bits (843),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLR RHWYIQS CATSGEGLY GLDWLSNNI  KA
Sbjct  136  AAEITDKLGLHSLRHRHWYIQSACATSGEGLYEGLDWLSNNIVTKA  181



>gb|EMT22177.1| ADP-ribosylation factor [Aegilops tauschii]
Length=263

 Score =   332 bits (851),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  39   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  98

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  99   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  158

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCAT+GEGLY GLDWLS+NIA+K
Sbjct  159  AAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK  203



>gb|KIY96152.1| ADP-ribosylation factor 1 [Monoraphidium neglectum]
Length=181

 Score =   328 bits (842),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+ EARDEL RMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIGEARDELQRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKG  181



>gb|ABR25719.1| ADP-ribosylation factor 1 [Oryza sativa Indica Group]
Length=181

 Score =   328 bits (842),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGL SLRQRHWYIQSTCAT+GEGLY GLDWLS+N+A+KA
Sbjct  136  AAEITDKLGLLSLRQRHWYIQSTCATTGEGLYEGLDWLSSNLASKA  181



>ref|XP_002973399.1| ARF family GTPase [Selaginella moellendorffii]
 ref|XP_002976510.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ22179.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ25773.1| ARF family GTPase [Selaginella moellendorffii]
Length=181

 Score =   328 bits (842),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI  K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVTKS  181



>ref|XP_003578999.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon]
Length=181

 Score =   328 bits (841),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDR+R+ EARDELHRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRERITEARDELHRMLNEDELRNAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQS CATSGEGLY GLDWLSNNIA+K+
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS  181



>ref|XP_007147411.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris]
 gb|ESW19405.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris]
Length=184

 Score =   328 bits (841),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/165 (95%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITD+LGL+SLRQRHWYIQSTCATSGEGLY GLDWLSNNI++K
Sbjct  136  AAEITDRLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSK  180



>ref|XP_007224194.1| hypothetical protein PRUPE_ppa017304mg [Prunus persica]
 gb|EMJ25393.1| hypothetical protein PRUPE_ppa017304mg [Prunus persica]
Length=182

 Score =   328 bits (841),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDA+GKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDASGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFV+DSNDRDRVVEARDE+HRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVIDSNDRDRVVEARDEMHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKL LHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI +KA
Sbjct  136  AAEITDKLNLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNITSKA  181



>ref|XP_010674548.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLVFANKQDLPNAM 
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMT  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGL+SLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  136  AAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>gb|KIY94970.1| ADP-ribosylation factor 1 [Monoraphidium neglectum]
Length=181

 Score =   328 bits (840),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDR+ EARDEL RMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRIGEARDELQRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA++ 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASRG  181



>ref|XP_009105711.1| PREDICTED: ADP-ribosylation factor 2-B-like [Brassica rapa]
Length=181

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWL++N A K 
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLAHNNAGKG  181



>gb|KCW56007.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=179

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 161/166 (97%), Gaps = 2/166 (1%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN  ELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN--ELRDAVLLVFANKQDLPNAMN  133

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+KA
Sbjct  134  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  179



>ref|XP_006438364.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 gb|ESR51604.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
Length=195

 Score =   328 bits (840),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 163/180 (91%), Gaps = 14/180 (8%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTI--------------GFNVETVEYKNI  584
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTI              GFNVETVEYKNI
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIAIQGCNCLNVRLSTGFNVETVEYKNI  75

Query  583  SFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVL  404
            SFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVL
Sbjct  76   SFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVL  135

Query  403  LVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            LVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  136  LVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  195



>ref|XP_004141190.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus]
Length=368

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  200  KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  259

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  260  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  319

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIA+K
Sbjct  320  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  364


 Score =   332 bits (852),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI +K
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSK  180



>ref|XP_001420856.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_003082427.1| unnamed protein product [Ostreococcus tauri]
 gb|ABO99149.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=181

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAM+
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAVLLVFANKQDLPNAMS  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHW+IQSTCATSGEGLY GLDWLS+NI+ +A
Sbjct  136  AAEITDKLGLHSLRQRHWFIQSTCATSGEGLYEGLDWLSSNISQRA  181



>gb|KHG28117.1| ADP-ribosylation factor 2 [Gossypium arboreum]
Length=538

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/166 (97%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            +EMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  373  REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  432

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  433  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  492

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANK 
Sbjct  493  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  538



>ref|XP_003533111.1| PREDICTED: ADP-ribosylation factor 2-B-like [Glycine max]
 gb|KHN44681.1| ADP-ribosylation factor 2-B [Glycine soja]
Length=184

 Score =   327 bits (838),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EA+DELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVGEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITD+LGL+SLRQRHWYIQSTCATSGEGLY GLDWLSNNI+ KA
Sbjct  136  AAEITDRLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISGKA  181



>emb|CEF99966.1| Small GTPase superfamily, ARF/SAR type [Ostreococcus tauri]
Length=209

 Score =   327 bits (839),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  44   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  103

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAM+
Sbjct  104  PLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAVLLVFANKQDLPNAMS  163

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHW+IQSTCATSGEGLY GLDWLS+NI+ +A
Sbjct  164  AAEITDKLGLHSLRQRHWFIQSTCATSGEGLYEGLDWLSSNISQRA  209



>emb|CBI39638.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 163/166 (98%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  426  KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  485

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  486  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  545

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  546  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  591



>emb|CBI36996.3| unnamed protein product [Vitis vinifera]
 emb|CDP15221.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   325 bits (833),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/160 (98%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  703  MVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY  524
            MV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY
Sbjct  1    MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY  60

Query  523  FQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITD  344
            FQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITD
Sbjct  61   FQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITD  120

Query  343  KLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANKA  224
            KLGLHSLRQRHWYIQSTCATSGEGLY GLDWLSNNIANKA
Sbjct  121  KLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  160



>ref|XP_008223454.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
 ref|XP_008223455.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
Length=181

 Score =   326 bits (835),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 154/165 (93%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDA+GKTTI YKLKLGEIVTTIPTIGFNVET+EYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDASGKTTILYKLKLGEIVTTIPTIGFNVETLEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFV+DSNDRDRVVEARDE+HRMLNEDELR+AVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVIDSNDRDRVVEARDEMHRMLNEDELREAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIANK  227
            AAEITDKL LHSLRQRHWYIQSTCATSGEGLY GLDWLSNNI +K
Sbjct  136  AAEITDKLSLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNITSK  180



>ref|XP_003055413.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60665.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   326 bits (835),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAM 
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAVLLVFANKQDLPNAMT  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNIAN  230
            AAEITDKLGLHS+RQRHW+IQSTCATSGEGLY GLDWLS NIAN
Sbjct  136  AAEITDKLGLHSIRQRHWFIQSTCATSGEGLYEGLDWLSTNIAN  179



>gb|ACU13131.1| unknown [Glycine max]
Length=180

 Score =   325 bits (833),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -1

Query  721  KEMRILMVXLDAAGKTTIXYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  542
            KEMRILMV LDAAGKTTI YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR
Sbjct  16   KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIR  75

Query  541  PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  362
            PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN
Sbjct  76   PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMN  135

Query  361  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYVGLDWLSNNI  236
            AAEITDKLGLHSLRQRHWYIQSTCATSGEGLY GLDWLS  +
Sbjct  136  AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSTTL  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425