BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047C12

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI17647.3|  unnamed protein product                                221   3e-67   Vitis vinifera
gb|KDO47608.1|  hypothetical protein CISIN_1g0472482mg                  211   9e-65   Citrus sinensis [apfelsine]
ref|XP_009626545.1|  PREDICTED: zinc finger CCCH domain-containin...    214   4e-64   Nicotiana tomentosiformis
ref|XP_009626544.1|  PREDICTED: zinc finger CCCH domain-containin...    214   8e-64   
ref|XP_009626543.1|  PREDICTED: zinc finger CCCH domain-containin...    214   2e-63   
ref|XP_009793876.1|  PREDICTED: zinc finger CCCH domain-containin...    215   2e-63   Nicotiana sylvestris
ref|XP_009626542.1|  PREDICTED: zinc finger CCCH domain-containin...    215   2e-63   Nicotiana tomentosiformis
ref|XP_009769505.1|  PREDICTED: zinc finger CCCH domain-containin...    213   2e-63   Nicotiana sylvestris
gb|KHN29278.1|  Zinc finger CCCH domain-containing protein ZFN-like     210   3e-63   Glycine soja [wild soybean]
ref|XP_002278934.2|  PREDICTED: zinc finger CCCH domain-containin...    215   3e-63   Vitis vinifera
ref|XP_009611380.1|  PREDICTED: zinc finger CCCH domain-containin...    214   4e-63   Nicotiana tomentosiformis
ref|XP_009611379.1|  PREDICTED: zinc finger CCCH domain-containin...    214   4e-63   Nicotiana tomentosiformis
ref|XP_009611378.1|  PREDICTED: zinc finger CCCH domain-containin...    214   5e-63   Nicotiana tomentosiformis
ref|XP_007205202.1|  hypothetical protein PRUPE_ppa005813mg             214   5e-63   Prunus persica
ref|XP_009611374.1|  PREDICTED: zinc finger CCCH domain-containin...    214   5e-63   Nicotiana tomentosiformis
ref|XP_009769504.1|  PREDICTED: zinc finger CCCH domain-containin...    212   7e-63   Nicotiana sylvestris
ref|XP_009769503.1|  PREDICTED: zinc finger CCCH domain-containin...    213   8e-63   Nicotiana sylvestris
ref|XP_009769498.1|  PREDICTED: zinc finger CCCH domain-containin...    213   1e-62   Nicotiana sylvestris
ref|XP_008218439.1|  PREDICTED: zinc finger CCCH domain-containin...    212   3e-62   Prunus mume [ume]
ref|XP_011015459.1|  PREDICTED: zinc finger CCCH domain-containin...    210   8e-62   Populus euphratica
ref|XP_011014133.1|  PREDICTED: zinc finger CCCH domain-containin...    210   2e-61   Populus euphratica
ref|XP_004302155.1|  PREDICTED: zinc finger CCCH domain-containin...    210   2e-61   Fragaria vesca subsp. vesca
ref|XP_006480414.1|  PREDICTED: zinc finger CCCH domain-containin...    209   2e-61   
ref|XP_006428577.1|  hypothetical protein CICLE_v10011741mg             208   6e-61   
ref|XP_006428579.1|  hypothetical protein CICLE_v10011741mg             208   8e-61   
ref|XP_002512627.1|  nucleic acid binding protein, putative             209   9e-61   Ricinus communis
ref|XP_011014371.1|  PREDICTED: zinc finger CCCH domain-containin...    208   1e-60   Populus euphratica
ref|XP_003534518.1|  PREDICTED: zinc finger CCCH domain-containin...    208   1e-60   Glycine max [soybeans]
ref|XP_004250094.1|  PREDICTED: zinc finger CCCH domain-containin...    207   2e-60   Solanum lycopersicum
ref|XP_006587810.1|  PREDICTED: zinc finger CCCH domain-containin...    207   2e-60   Glycine max [soybeans]
ref|XP_002325901.2|  zinc finger family protein                         207   4e-60   
ref|XP_006353234.1|  PREDICTED: zinc finger CCCH domain-containin...    206   5e-60   Solanum tuberosum [potatoes]
gb|KHN40466.1|  Zinc finger CCCH domain-containing protein ZFN-like     204   6e-60   Glycine soja [wild soybean]
ref|XP_010111067.1|  Zinc finger CCCH domain-containing protein Z...    204   2e-59   
gb|KDP23293.1|  hypothetical protein JCGZ_23126                         204   2e-59   Jatropha curcas
ref|XP_007139733.1|  hypothetical protein PHAVU_008G054800g             202   1e-58   Phaseolus vulgaris [French bean]
ref|XP_007139732.1|  hypothetical protein PHAVU_008G054800g             202   1e-58   Phaseolus vulgaris [French bean]
ref|XP_010929828.1|  PREDICTED: zinc finger CCCH domain-containin...    201   1e-58   
ref|XP_007143976.1|  hypothetical protein PHAVU_007G118500g             202   2e-58   Phaseolus vulgaris [French bean]
ref|XP_006602842.1|  PREDICTED: zinc finger CCCH domain-containin...    202   2e-58   
ref|XP_010929826.1|  PREDICTED: zinc finger CCCH domain-containin...    201   6e-58   
ref|XP_010929827.1|  PREDICTED: zinc finger CCCH domain-containin...    200   7e-58   Elaeis guineensis
ref|XP_010929825.1|  PREDICTED: zinc finger CCCH domain-containin...    201   1e-57   Elaeis guineensis
ref|XP_008812314.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    199   3e-57   Phoenix dactylifera
ref|XP_010673926.1|  PREDICTED: zinc finger CCCH domain-containin...    199   3e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673925.1|  PREDICTED: zinc finger CCCH domain-containin...    199   4e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008359920.1|  PREDICTED: zinc finger CCCH domain-containin...    197   2e-56   Malus domestica [apple tree]
ref|XP_010245962.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    197   2e-56   
ref|XP_008359919.1|  PREDICTED: zinc finger CCCH domain-containin...    197   2e-56   Malus domestica [apple tree]
ref|XP_009338000.1|  PREDICTED: zinc finger CCCH domain-containin...    197   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_009337999.1|  PREDICTED: zinc finger CCCH domain-containin...    197   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_008355849.1|  PREDICTED: zinc finger CCCH domain-containin...    196   7e-56   
gb|KJB82176.1|  hypothetical protein B456_013G179800                    193   2e-55   Gossypium raimondii
gb|KEH23393.1|  zinc finger CCCH domain protein                         193   3e-55   Medicago truncatula
ref|XP_003624157.1|  Zinc finger CCCH domain-containing protein         193   3e-55   Medicago truncatula
gb|KJB75170.1|  hypothetical protein B456_012G028600                    192   4e-55   Gossypium raimondii
gb|ABD28369.2|  Zinc finger, CCCH-type; Sugar transporter superfa...    193   4e-55   Medicago truncatula
sp|Q9SWF9.1|ZFNL_PEA  RecName: Full=Zinc finger CCCH domain-conta...    193   4e-55   Pisum sativum [garden pea]
gb|EYU39704.1|  hypothetical protein MIMGU_mgv1a0076882mg               192   5e-55   Erythranthe guttata [common monkey flower]
gb|KJB75168.1|  hypothetical protein B456_012G028600                    193   6e-55   Gossypium raimondii
gb|KJB82177.1|  hypothetical protein B456_013G179800                    193   7e-55   Gossypium raimondii
ref|XP_011084651.1|  PREDICTED: zinc finger CCCH domain-containin...    192   9e-55   
gb|KJB26822.1|  hypothetical protein B456_004G261700                    191   9e-55   Gossypium raimondii
ref|XP_009416576.1|  PREDICTED: zinc finger CCCH domain-containin...    191   9e-55   
ref|XP_006606434.1|  PREDICTED: zinc finger CCCH domain-containin...    190   1e-54   Glycine max [soybeans]
ref|XP_009416575.1|  PREDICTED: zinc finger CCCH domain-containin...    191   2e-54   
gb|KHG30243.1|  Zinc finger CCCH domain-containing protein ZFN-li...    189   2e-54   Gossypium arboreum [tree cotton]
gb|KHN14776.1|  Zinc finger CCCH domain-containing protein ZFN-like     191   3e-54   Glycine soja [wild soybean]
gb|KJB26823.1|  hypothetical protein B456_004G261700                    191   3e-54   Gossypium raimondii
gb|ACC85690.1|  zinc finger protein                                     191   3e-54   Medicago sativa [alfalfa]
ref|XP_003536159.1|  PREDICTED: zinc finger CCCH domain-containin...    191   4e-54   Glycine max [soybeans]
gb|KHN04981.1|  Zinc finger CCCH domain-containing protein ZFN-like     190   5e-54   Glycine soja [wild soybean]
ref|XP_006606433.1|  PREDICTED: zinc finger CCCH domain-containin...    190   5e-54   Glycine max [soybeans]
ref|XP_009416573.1|  PREDICTED: zinc finger CCCH domain-containin...    191   6e-54   
ref|XP_009416574.1|  PREDICTED: zinc finger CCCH domain-containin...    190   7e-54   
ref|XP_010038283.1|  PREDICTED: zinc finger CCCH domain-containin...    190   8e-54   Eucalyptus grandis [rose gum]
gb|KCW84568.1|  hypothetical protein EUGRSUZ_B01407                     189   8e-54   Eucalyptus grandis [rose gum]
ref|XP_007029392.1|  Zinc finger CCCH domain-containing protein 3...    189   1e-53   
ref|XP_009392482.1|  PREDICTED: zinc finger CCCH domain-containin...    187   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007029391.1|  Zinc finger CCCH domain-containing protein 3...    189   2e-53   Theobroma cacao [chocolate]
ref|XP_008810537.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    189   2e-53   
ref|XP_009392483.1|  PREDICTED: zinc finger CCCH domain-containin...    187   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392481.1|  PREDICTED: zinc finger CCCH domain-containin...    187   3e-53   
ref|XP_009392477.1|  PREDICTED: zinc finger CCCH domain-containin...    186   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006662931.1|  PREDICTED: zinc finger CCCH domain-containin...    185   2e-52   Oryza brachyantha
gb|ABG22481.1|  Zinc finger CCCH type domain containing protein Z...    184   5e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002450713.1|  hypothetical protein SORBIDRAFT_05g013190          185   6e-52   Sorghum bicolor [broomcorn]
ref|NP_001067878.1|  Os11g0472000                                       184   7e-52   
sp|Q2R4J4.2|C3H63_ORYSJ  RecName: Full=Zinc finger CCCH domain-co...    185   9e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52080.1|  hypothetical protein OsJ_33853                          185   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406323.1|  PREDICTED: zinc finger CCCH domain-containin...    182   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003576637.1|  PREDICTED: zinc finger CCCH domain-containin...    183   4e-51   Brachypodium distachyon [annual false brome]
ref|XP_010237293.1|  PREDICTED: zinc finger CCCH domain-containin...    183   5e-51   Brachypodium distachyon [annual false brome]
ref|XP_010927660.1|  PREDICTED: zinc finger CCCH domain-containin...    182   1e-50   
ref|XP_004979251.1|  PREDICTED: zinc finger CCCH domain-containin...    181   2e-50   Setaria italica
ref|XP_004979252.1|  PREDICTED: zinc finger CCCH domain-containin...    181   2e-50   
ref|XP_008794629.1|  PREDICTED: zinc finger CCCH domain-containin...    181   3e-50   
ref|XP_008676804.1|  PREDICTED: hypothetical protein isoform X2         180   4e-50   Zea mays [maize]
ref|NP_001141157.1|  hypothetical protein                               180   6e-50   Zea mays [maize]
ref|XP_008676803.1|  PREDICTED: hypothetical protein isoform X1         180   7e-50   Zea mays [maize]
ref|XP_011077184.1|  PREDICTED: zinc finger CCCH domain-containin...    178   1e-49   Sesamum indicum [beniseed]
ref|XP_011077187.1|  PREDICTED: zinc finger CCCH domain-containin...    178   1e-49   Sesamum indicum [beniseed]
ref|XP_008443710.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    177   6e-49   
gb|KHG12066.1|  Zinc finger CCCH domain-containing protein ZFN-li...    176   2e-48   Gossypium arboreum [tree cotton]
ref|XP_008792914.1|  PREDICTED: zinc finger CCCH domain-containin...    176   2e-48   
ref|XP_008792915.1|  PREDICTED: zinc finger CCCH domain-containin...    175   3e-48   
ref|XP_008792910.1|  PREDICTED: zinc finger CCCH domain-containin...    176   3e-48   
gb|EEC69137.1|  hypothetical protein OsI_38063                          174   5e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006663970.1|  PREDICTED: zinc finger CCCH domain-containin...    173   2e-47   Oryza brachyantha
ref|XP_006848460.1|  hypothetical protein AMTR_s00013p00248880          174   2e-47   Amborella trichopoda
ref|XP_003577562.1|  PREDICTED: zinc finger CCCH domain-containin...    173   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_006663969.1|  PREDICTED: zinc finger CCCH domain-containin...    173   2e-47   Oryza brachyantha
ref|XP_009420319.1|  PREDICTED: zinc finger CCCH domain-containin...    172   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420318.1|  PREDICTED: zinc finger CCCH domain-containin...    172   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001130819.1|  uncharacterized protein LOC100191923               172   7e-47   Zea mays [maize]
ref|XP_010525082.1|  PREDICTED: zinc finger CCCH domain-containin...    171   8e-47   Tarenaya hassleriana [spider flower]
ref|XP_010525081.1|  PREDICTED: zinc finger CCCH domain-containin...    171   8e-47   Tarenaya hassleriana [spider flower]
ref|NP_001066624.1|  Os12g0405100                                       172   9e-47   
ref|XP_004157161.1|  PREDICTED: zinc finger CCCH domain-containin...    165   2e-46   
dbj|BAG99488.1|  unnamed protein product                                164   5e-46   Oryza sativa Japonica Group [Japonica rice]
emb|CDP04213.1|  unnamed protein product                                168   8e-46   Coffea canephora [robusta coffee]
gb|EMS50271.1|  Zinc finger CCCH domain-containing protein 12           168   1e-45   Triticum urartu
gb|ACU21592.1|  Zinc finger protein                                     166   9e-45   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99149.1|  predicted protein                                      164   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_851041.1|  zinc finger nuclease 3                                164   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974790.1|  zinc finger nuclease 3                                164   1e-44   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD87736.1|  putative zinc finger protein                           162   2e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55890.1|  hypothetical protein OsJ_04549                          162   8e-44   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ86320.1|  predicted protein                                      163   1e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY76977.1|  hypothetical protein OsI_04935                          163   1e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001045201.2|  Os01g0917400                                       163   2e-43   
gb|AFW84181.1|  hypothetical protein ZEAMMB73_594165                    161   2e-43   
ref|XP_004142565.1|  PREDICTED: zinc finger CCCH domain-containin...    161   2e-43   
gb|ADN33845.1|  nucleic acid binding protein                            161   2e-43   Cucumis melo subsp. melo
gb|ACN33948.1|  unknown                                                 161   2e-43   Zea mays [maize]
ref|XP_003564925.1|  PREDICTED: zinc finger CCCH domain-containin...    162   3e-43   Brachypodium distachyon [annual false brome]
gb|ACF82040.1|  unknown                                                 161   4e-43   Zea mays [maize]
gb|KFK37691.1|  hypothetical protein AALP_AA3G016100                    160   5e-43   Arabis alpina [alpine rockcress]
ref|XP_009382899.1|  PREDICTED: zinc finger CCCH domain-containin...    162   5e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006645228.1|  PREDICTED: zinc finger CCCH domain-containin...    160   6e-43   
ref|XP_008389043.1|  PREDICTED: zinc finger CCCH domain-containin...    153   3e-42   
ref|NP_001150019.1|  zinc finger CCCH type domain-containing prot...    159   4e-42   
ref|XP_002871723.1|  hypothetical protein ARALYDRAFT_488510             157   5e-42   
ref|XP_006296584.1|  hypothetical protein CARUB_v100138730mg            156   7e-42   
ref|NP_566183.1|  zinc finger protein 1                                 156   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568332.2|  zinc finger nuclease 3                                155   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AAF26977.1|AC018363_22  zinc finger protein 1 (zfn1)                 155   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AAD33769.1|AF138743_1  zinc finger protein 1                         156   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400193.1|  hypothetical protein EUTSA_v10013743mg             155   6e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010501886.1|  PREDICTED: zinc finger CCCH domain-containin...    155   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010501847.1|  PREDICTED: zinc finger CCCH domain-containin...    155   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002882253.1|  hypothetical protein ARALYDRAFT_477525             155   8e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_004971057.1|  PREDICTED: zinc finger CCCH domain-containin...    155   1e-40   Setaria italica
gb|KFK25872.1|  hypothetical protein AALP_AA8G173100                    154   2e-40   Arabis alpina [alpine rockcress]
ref|XP_006408378.1|  hypothetical protein EUTSA_v10020900mg             152   4e-40   
ref|XP_006408377.1|  hypothetical protein EUTSA_v10020900mg             152   4e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010485612.1|  PREDICTED: zinc finger CCCH domain-containin...    153   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006408379.1|  hypothetical protein EUTSA_v10020900mg             152   5e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010463710.1|  PREDICTED: zinc finger CCCH domain-containin...    153   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010463709.1|  PREDICTED: zinc finger CCCH domain-containin...    152   5e-40   Camelina sativa [gold-of-pleasure]
gb|ACF80171.1|  unknown                                                 149   3e-39   Zea mays [maize]
ref|NP_001132883.1|  uncharacterized protein LOC100194377               150   8e-39   Zea mays [maize]
emb|CDY51531.1|  BnaA05g33310D                                          149   1e-38   Brassica napus [oilseed rape]
ref|XP_006287837.1|  hypothetical protein CARUB_v10001057mg             149   1e-38   Capsella rubella
tpg|DAA56151.1|  TPA: hypothetical protein ZEAMMB73_608000              149   1e-38   
emb|CDX74233.1|  BnaA03g28140D                                          146   9e-38   
emb|CDY28712.1|  BnaCnng05980D                                          146   1e-37   Brassica napus [oilseed rape]
ref|XP_010558591.1|  PREDICTED: zinc finger CCCH domain-containin...    145   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_004495537.1|  PREDICTED: zinc finger CCCH domain-containin...    145   2e-37   Cicer arietinum [garbanzo]
emb|CDX92015.1|  BnaC03g33170D                                          145   3e-37   
ref|XP_009147316.1|  PREDICTED: zinc finger CCCH domain-containin...    144   6e-37   Brassica rapa
ref|XP_009134713.1|  PREDICTED: zinc finger CCCH domain-containin...    142   3e-36   Brassica rapa
ref|XP_009134712.1|  PREDICTED: zinc finger CCCH domain-containin...    142   3e-36   Brassica rapa
emb|CDY53749.1|  BnaAnng12770D                                          140   2e-35   Brassica napus [oilseed rape]
ref|XP_009118604.1|  PREDICTED: zinc finger CCCH domain-containin...    139   2e-35   Brassica rapa
emb|CDY67901.1|  BnaCnng56860D                                          139   2e-35   Brassica napus [oilseed rape]
ref|XP_009118612.1|  PREDICTED: zinc finger CCCH domain-containin...    139   3e-35   Brassica rapa
ref|XP_010453818.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    140   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010492565.1|  PREDICTED: zinc finger CCCH domain-containin...    139   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_008672228.1|  PREDICTED: uncharacterized protein LOC100194...    139   7e-35   Zea mays [maize]
gb|EYU22370.1|  hypothetical protein MIMGU_mgv1a005385mg                132   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_011090931.1|  PREDICTED: zinc finger CCCH domain-containin...    129   3e-31   Sesamum indicum [beniseed]
ref|XP_006397979.1|  hypothetical protein EUTSA_v10001399mg             129   6e-31   
ref|XP_007222805.1|  hypothetical protein PRUPE_ppa005056mg             128   1e-30   Prunus persica
ref|XP_008223126.1|  PREDICTED: zinc finger CCCH domain-containin...    127   1e-30   Prunus mume [ume]
ref|XP_002276435.1|  PREDICTED: zinc finger CCCH domain-containin...    127   2e-30   Vitis vinifera
emb|CAN78551.1|  hypothetical protein VITISV_003243                     127   2e-30   Vitis vinifera
ref|XP_004987433.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-30   
gb|KCW84570.1|  hypothetical protein EUGRSUZ_B01407                     125   4e-30   Eucalyptus grandis [rose gum]
gb|KJB75169.1|  hypothetical protein B456_012G028600                    124   7e-30   Gossypium raimondii
gb|ACN40302.1|  unknown                                                 125   1e-29   Picea sitchensis
ref|XP_002880326.1|  zinc finger (CCCH-type) family protein             124   2e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_009802826.1|  PREDICTED: zinc finger CCCH domain-containin...    124   2e-29   Nicotiana sylvestris
ref|XP_009802825.1|  PREDICTED: zinc finger CCCH domain-containin...    124   2e-29   Nicotiana sylvestris
ref|XP_006294140.1|  hypothetical protein CARUB_v10023134mg             123   3e-29   Capsella rubella
ref|NP_001078077.1|  zinc finger CCCH domain-containing protein 32      123   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523985.1|  PREDICTED: zinc finger CCCH domain-containin...    123   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_010420350.1|  PREDICTED: zinc finger CCCH domain-containin...    123   4e-29   Camelina sativa [gold-of-pleasure]
gb|AAC63639.1|  unknown protein                                         124   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_182306.2|  zinc finger CCCH domain-containing protein 32         123   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420349.1|  PREDICTED: zinc finger CCCH domain-containin...    123   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006294141.1|  hypothetical protein CARUB_v10023134mg             123   5e-29   Capsella rubella
ref|XP_006829498.1|  hypothetical protein AMTR_s00074p00109750          119   5e-29   
emb|CDO98891.1|  unnamed protein product                                123   5e-29   Coffea canephora [robusta coffee]
ref|XP_011071464.1|  PREDICTED: zinc finger CCCH domain-containin...    122   7e-29   Sesamum indicum [beniseed]
ref|XP_002314462.1|  hypothetical protein POPTR_0010s02320g             122   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009631342.1|  PREDICTED: zinc finger CCCH domain-containin...    122   1e-28   Nicotiana tomentosiformis
ref|XP_010545037.1|  PREDICTED: zinc finger CCCH domain-containin...    121   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_010545038.1|  PREDICTED: zinc finger CCCH domain-containin...    121   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_009142499.1|  PREDICTED: zinc finger CCCH domain-containin...    121   2e-28   Brassica rapa
ref|XP_009142498.1|  PREDICTED: zinc finger CCCH domain-containin...    121   2e-28   Brassica rapa
emb|CDX80137.1|  BnaA05g00190D                                          121   2e-28   
ref|XP_011013662.1|  PREDICTED: zinc finger CCCH domain-containin...    120   3e-28   Populus euphratica
ref|XP_010507789.1|  PREDICTED: zinc finger CCCH domain-containin...    120   4e-28   
ref|XP_001768387.1|  predicted protein                                  119   4e-28   
ref|XP_011018690.1|  PREDICTED: zinc finger CCCH domain-containin...    120   5e-28   Populus euphratica
ref|XP_010921758.1|  PREDICTED: zinc finger CCCH domain-containin...    120   7e-28   Elaeis guineensis
ref|XP_008802110.1|  PREDICTED: zinc finger CCCH domain-containin...    119   9e-28   Phoenix dactylifera
ref|XP_009339837.1|  PREDICTED: zinc finger CCCH domain-containin...    119   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_010507842.1|  PREDICTED: zinc finger CCCH domain-containin...    119   1e-27   
ref|XP_006380188.1|  hypothetical protein POPTR_0008s22730g             119   1e-27   Populus trichocarpa [western balsam poplar]
gb|EEE54266.1|  hypothetical protein OsJ_01160                          114   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010507840.1|  PREDICTED: zinc finger CCCH domain-containin...    119   2e-27   Camelina sativa [gold-of-pleasure]
gb|EEC80695.1|  hypothetical protein OsI_23121                          115   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_008340827.1|  PREDICTED: zinc finger CCCH domain-containin...    119   2e-27   
ref|XP_010913061.1|  PREDICTED: zinc finger CCCH domain-containin...    118   2e-27   Elaeis guineensis
ref|XP_006644012.1|  PREDICTED: zinc finger CCCH domain-containin...    118   2e-27   Oryza brachyantha
ref|XP_010518502.1|  PREDICTED: zinc finger CCCH domain-containin...    118   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006419655.1|  hypothetical protein CICLE_v10004882mg             118   2e-27   Citrus clementina [clementine]
ref|XP_008796232.1|  PREDICTED: zinc finger CCCH domain-containin...    118   3e-27   Phoenix dactylifera
ref|XP_009369128.1|  PREDICTED: zinc finger CCCH domain-containin...    118   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_008796231.1|  PREDICTED: zinc finger CCCH domain-containin...    117   5e-27   Phoenix dactylifera
ref|XP_010938478.1|  PREDICTED: zinc finger CCCH domain-containin...    117   7e-27   Elaeis guineensis
ref|XP_004296815.1|  PREDICTED: zinc finger CCCH domain-containin...    117   9e-27   Fragaria vesca subsp. vesca
gb|KCW58527.1|  hypothetical protein EUGRSUZ_H01196                     116   9e-27   Eucalyptus grandis [rose gum]
tpg|DAA53995.1|  TPA: hypothetical protein ZEAMMB73_505725              113   1e-26   
ref|XP_010069978.1|  PREDICTED: zinc finger CCCH domain-containin...    116   1e-26   Eucalyptus grandis [rose gum]
ref|XP_006855486.1|  hypothetical protein AMTR_s00057p00193570          116   1e-26   Amborella trichopoda
emb|CDY53022.1|  BnaC04g00080D                                          116   1e-26   Brassica napus [oilseed rape]
ref|XP_008438828.1|  PREDICTED: zinc finger CCCH domain-containin...    116   2e-26   Cucumis melo [Oriental melon]
ref|XP_009588295.1|  PREDICTED: zinc finger CCCH domain-containin...    116   2e-26   Nicotiana tomentosiformis
ref|XP_007035523.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    115   2e-26   
gb|KHG22563.1|  hypothetical protein F383_29382                         115   3e-26   Gossypium arboreum [tree cotton]
gb|AGT16102.1|  hypothetical protein SHCRBa_134_J05_F_10                114   3e-26   Saccharum hybrid cultivar R570
gb|AGT16494.1|  zinc finger CCCH type domain-containing protein         114   5e-26   Saccharum hybrid cultivar R570
ref|XP_010270054.1|  PREDICTED: zinc finger CCCH domain-containin...    114   5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_001752915.1|  predicted protein                                  107   5e-26   
ref|XP_010270055.1|  PREDICTED: zinc finger CCCH domain-containin...    113   7e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009774842.1|  PREDICTED: zinc finger CCCH domain-containin...    114   7e-26   Nicotiana sylvestris
ref|XP_004169150.1|  PREDICTED: zinc finger CCCH domain-containin...    114   8e-26   
ref|NP_001042632.2|  Os01g0257400                                       114   8e-26   
ref|XP_001752815.1|  predicted protein                                  107   8e-26   
ref|XP_010270053.1|  PREDICTED: zinc finger CCCH domain-containin...    114   9e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009378917.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    115   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_009408337.1|  PREDICTED: zinc finger CCCH domain-containin...    114   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010252578.1|  PREDICTED: zinc finger CCCH domain-containin...    113   1e-25   
gb|KDP40004.1|  hypothetical protein JCGZ_02002                         113   1e-25   Jatropha curcas
gb|KGN57087.1|  hypothetical protein Csa_3G152140                       113   1e-25   Cucumis sativus [cucumbers]
ref|XP_009408339.1|  PREDICTED: zinc finger CCCH domain-containin...    113   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408338.1|  PREDICTED: zinc finger CCCH domain-containin...    113   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB47069.1|  hypothetical protein B456_008G009500                    113   1e-25   Gossypium raimondii
ref|XP_004134198.1|  PREDICTED: zinc finger CCCH domain-containin...    113   1e-25   Cucumis sativus [cucumbers]
ref|XP_009411695.1|  PREDICTED: zinc finger CCCH domain-containin...    113   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010558473.1|  PREDICTED: zinc finger CCCH domain-containin...    113   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_007050814.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    113   1e-25   Theobroma cacao [chocolate]
gb|AAT28673.1|  zinc finger protein                                     109   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457592.1|  hypothetical protein SORBIDRAFT_03g009920          112   2e-25   Sorghum bicolor [broomcorn]
ref|XP_002516892.1|  nucleic acid binding protein, putative             112   2e-25   Ricinus communis
gb|ABR16930.1|  unknown                                                 113   3e-25   Picea sitchensis
dbj|BAK02824.1|  predicted protein                                      112   4e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010243539.1|  PREDICTED: zinc finger CCCH domain-containin...    112   4e-25   Nelumbo nucifera [Indian lotus]
gb|ACN28458.1|  unknown                                                 111   5e-25   Zea mays [maize]
ref|XP_004240519.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    111   5e-25   
ref|NP_001147888.1|  zinc finger CCCH type domain-containing prot...    111   5e-25   
ref|XP_002520668.1|  nucleic acid binding protein, putative             112   5e-25   Ricinus communis
ref|XP_006444253.1|  hypothetical protein CICLE_v10019968mg             112   5e-25   Citrus clementina [clementine]
ref|XP_008235007.1|  PREDICTED: zinc finger CCCH domain-containin...    111   5e-25   Prunus mume [ume]
ref|XP_007200997.1|  hypothetical protein PRUPE_ppa005229mg             111   6e-25   Prunus persica
gb|KHG21967.1|  hypothetical protein F383_08187                         111   7e-25   Gossypium arboreum [tree cotton]
ref|XP_006645727.1|  PREDICTED: zinc finger CCCH domain-containin...    110   7e-25   
emb|CDM82679.1|  unnamed protein product                                111   8e-25   
ref|XP_010241841.1|  PREDICTED: zinc finger CCCH domain-containin...    111   8e-25   
emb|CDM82689.1|  unnamed protein product                                111   9e-25   
ref|XP_011077188.1|  PREDICTED: zinc finger CCCH domain-containin...    109   1e-24   
ref|XP_009776617.1|  PREDICTED: zinc finger CCCH domain-containin...    110   1e-24   
gb|EMT01168.1|  Zinc finger CCCH domain-containing protein 6            110   1e-24   
ref|XP_003529584.1|  PREDICTED: zinc finger CCCH domain-containin...    110   1e-24   
ref|XP_010652064.1|  PREDICTED: zinc finger CCCH domain-containin...    110   1e-24   
gb|EAY73369.1|  hypothetical protein OsI_01247                          109   1e-24   
gb|KHF99697.1|  hypothetical protein F383_18975                         110   1e-24   
ref|XP_009352233.1|  PREDICTED: zinc finger CCCH domain-containin...    110   1e-24   
gb|KJB72632.1|  hypothetical protein B456_011G188400                    110   2e-24   
gb|AFW79659.1|  hypothetical protein ZEAMMB73_788382                    109   2e-24   
emb|CAN74119.1|  hypothetical protein VITISV_002050                     113   2e-24   
ref|XP_009776613.1|  PREDICTED: zinc finger CCCH domain-containin...    110   2e-24   
gb|KJB12614.1|  hypothetical protein B456_002G027000                    110   2e-24   
emb|CDP03533.1|  unnamed protein product                                109   3e-24   
ref|XP_006366678.1|  PREDICTED: zinc finger CCCH domain-containin...    108   3e-24   
ref|NP_001150792.1|  zinc finger CCCH type domain-containing prot...    109   3e-24   
gb|EAZ11305.1|  hypothetical protein OsJ_01167                          108   3e-24   
gb|AFW79656.1|  zinc finger CCCH type domain-containing protein Z...    109   3e-24   
ref|XP_006366677.1|  PREDICTED: zinc finger CCCH domain-containin...    108   4e-24   
dbj|BAD81402.1|  putative floral homeotic protein HUA1                  108   4e-24   
ref|XP_008389190.1|  PREDICTED: zinc finger CCCH domain-containin...    108   4e-24   
ref|XP_009391577.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    108   4e-24   
dbj|BAG99345.1|  unnamed protein product                                108   5e-24   
ref|XP_003566542.1|  PREDICTED: zinc finger CCCH domain-containin...    108   5e-24   
ref|NP_001042637.1|  Os01g0258700                                       108   5e-24   
ref|XP_010524751.1|  PREDICTED: zinc finger CCCH domain-containin...    108   6e-24   
ref|XP_008386632.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    108   6e-24   
gb|KJB23208.1|  hypothetical protein B456_004G086700                    107   7e-24   
gb|KHG22135.1|  hypothetical protein F383_09601                         108   7e-24   
ref|XP_004309682.1|  PREDICTED: zinc finger CCCH domain-containin...    108   8e-24   
dbj|BAJ86598.1|  predicted protein                                      108   9e-24   
ref|XP_004967812.1|  PREDICTED: zinc finger CCCH domain-containin...    108   9e-24   
ref|XP_006342757.1|  PREDICTED: zinc finger CCCH domain-containin...    108   1e-23   
ref|XP_004967813.1|  PREDICTED: zinc finger CCCH domain-containin...    107   1e-23   
gb|KHG01635.1|  hypothetical protein F383_21492                         107   1e-23   
gb|EMT21637.1|  Zinc finger CCCH domain-containing protein 5            107   1e-23   
gb|KHG06790.1|  hypothetical protein F383_05075                         107   1e-23   
gb|EMS67785.1|  Zinc finger CCCH domain-containing protein 5            107   1e-23   
ref|XP_009626457.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
ref|XP_008439243.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
ref|XP_010928414.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
ref|XP_010454106.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
ref|XP_010454104.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
ref|XP_003566545.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
ref|XP_002511264.1|  nucleic acid binding protein, putative             107   2e-23   
ref|XP_010492866.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
ref|XP_010492867.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
gb|KJB23207.1|  hypothetical protein B456_004G086700                    107   3e-23   
ref|XP_010666383.1|  PREDICTED: zinc finger CCCH domain-containin...    106   3e-23   
ref|XP_008389189.1|  PREDICTED: zinc finger CCCH domain-containin...    108   3e-23   
ref|XP_010666382.1|  PREDICTED: zinc finger CCCH domain-containin...    107   3e-23   
ref|XP_010684493.1|  PREDICTED: zinc finger CCCH domain-containin...    106   3e-23   
ref|XP_009417930.1|  PREDICTED: zinc finger CCCH domain-containin...    106   3e-23   
ref|XP_010112757.1|  Zinc finger CCCH domain-containing protein 32      106   3e-23   
gb|KDP30984.1|  hypothetical protein JCGZ_11360                         106   4e-23   
ref|XP_004229205.1|  PREDICTED: zinc finger CCCH domain-containin...    106   4e-23   
ref|XP_011007757.1|  PREDICTED: zinc finger CCCH domain-containin...    106   4e-23   
gb|KDO69368.1|  hypothetical protein CISIN_1g033320mg                   100   4e-23   
gb|KDP28101.1|  hypothetical protein JCGZ_13872                         106   5e-23   
gb|KJB08671.1|  hypothetical protein B456_001G096900                    105   5e-23   
gb|KJB08672.1|  hypothetical protein B456_001G096900                    105   6e-23   
ref|XP_008799408.1|  PREDICTED: zinc finger CCCH domain-containin...    105   6e-23   
gb|KDO59559.1|  hypothetical protein CISIN_1g013033mg                   105   6e-23   
ref|XP_008799415.1|  PREDICTED: zinc finger CCCH domain-containin...    104   6e-23   
gb|KJB22540.1|  hypothetical protein B456_004G053200                    105   7e-23   
ref|XP_002320490.1|  ZINC FINGER protein 2                              105   7e-23   
gb|KHG04581.1|  hypothetical protein F383_30084                         105   7e-23   
ref|XP_010420624.1|  PREDICTED: zinc finger CCCH domain-containin...    105   8e-23   
ref|XP_010420626.1|  PREDICTED: zinc finger CCCH domain-containin...    105   8e-23   
ref|XP_004152505.1|  PREDICTED: zinc finger CCCH domain-containin...    105   8e-23   
ref|XP_004157770.1|  PREDICTED: zinc finger CCCH domain-containin...    105   8e-23   
gb|KJB08673.1|  hypothetical protein B456_001G096900                    105   8e-23   
gb|KJB08674.1|  hypothetical protein B456_001G096900                    105   9e-23   
ref|XP_006440013.1|  hypothetical protein CICLE_v10019979mg             103   9e-23   
gb|KJB08677.1|  hypothetical protein B456_001G097100                    105   9e-23   
ref|XP_010026837.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   
gb|ABR16973.1|  unknown                                                 105   1e-22   
ref|XP_003638527.1|  Zinc finger CCCH domain-containing protein         105   1e-22   
gb|KJB28621.1|  hypothetical protein B456_005G058800                    105   1e-22   
ref|XP_003608905.1|  Zinc finger CCCH domain-containing protein         103   1e-22   
ref|XP_003525622.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   
ref|XP_006476951.1|  PREDICTED: zinc finger CCCH domain-containin...    103   1e-22   
gb|KHG07834.1|  hypothetical protein F383_35307                         105   1e-22   
ref|XP_002277300.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   
ref|XP_008803515.1|  PREDICTED: zinc finger CCCH domain-containin...    104   1e-22   
ref|XP_006287665.1|  hypothetical protein CARUB_v10000876mg             105   1e-22   
ref|XP_010026830.1|  PREDICTED: zinc finger CCCH domain-containin...    105   2e-22   
ref|XP_010546927.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_008803514.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_008803513.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_010546925.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_008803512.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
gb|KDO59558.1|  hypothetical protein CISIN_1g013033mg                   103   2e-22   
ref|XP_003550189.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_004967811.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_010248777.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_006447662.1|  hypothetical protein CICLE_v10015215mg             104   2e-22   
ref|XP_003608904.1|  Zinc finger CCCH domain-containing protein         105   2e-22   
gb|KDO59557.1|  hypothetical protein CISIN_1g013033mg                   103   2e-22   
ref|XP_010248778.1|  PREDICTED: zinc finger CCCH domain-containin...    103   2e-22   
ref|XP_004508292.1|  PREDICTED: zinc finger CCCH domain-containin...    104   3e-22   
ref|XP_006440011.1|  hypothetical protein CICLE_v10019979mg             103   3e-22   
ref|XP_003518955.1|  PREDICTED: zinc finger CCCH domain-containin...    103   3e-22   
ref|XP_011040430.1|  PREDICTED: zinc finger CCCH domain-containin...    103   3e-22   
gb|KHN34381.1|  Zinc finger CCCH domain-containing protein 43           103   4e-22   
ref|XP_007155512.1|  hypothetical protein PHAVU_003G207900g             103   4e-22   
gb|KHN03741.1|  Zinc finger CCCH domain-containing protein 32           103   4e-22   
ref|XP_007049197.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    103   4e-22   
ref|XP_004501830.1|  PREDICTED: zinc finger CCCH domain-containin...    103   4e-22   
ref|XP_007154244.1|  hypothetical protein PHAVU_003G102600g             103   4e-22   
ref|XP_002318105.1|  hypothetical protein POPTR_0012s09400g             103   5e-22   
gb|KJB41978.1|  hypothetical protein B456_007G130500                    103   5e-22   
ref|XP_006359417.1|  PREDICTED: zinc finger CCCH domain-containin...    102   5e-22   
ref|XP_006359420.1|  PREDICTED: zinc finger CCCH domain-containin...    102   5e-22   
ref|XP_004515843.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-22   
gb|EYU45569.1|  hypothetical protein MIMGU_mgv1a006413mg                103   6e-22   
ref|XP_010667394.1|  PREDICTED: zinc finger CCCH domain-containin...    102   6e-22   
ref|XP_011085491.1|  PREDICTED: zinc finger CCCH domain-containin...    102   6e-22   
gb|ACF86739.1|  unknown                                                 100   6e-22   
ref|XP_004495984.1|  PREDICTED: zinc finger CCCH domain-containin...    102   6e-22   
ref|XP_006476949.1|  PREDICTED: zinc finger CCCH domain-containin...    103   6e-22   
ref|XP_006440008.1|  hypothetical protein CICLE_v10019979mg             102   6e-22   
ref|XP_006440009.1|  hypothetical protein CICLE_v10019979mg             103   6e-22   
gb|KJB08070.1|  hypothetical protein B456_001G061800                    102   6e-22   
ref|XP_007137964.1|  hypothetical protein PHAVU_009G169600g             103   7e-22   
gb|EPS71438.1|  hypothetical protein M569_03319                         102   7e-22   
gb|KHG29012.1|  hypothetical protein F383_11348                         102   7e-22   
ref|XP_009133833.1|  PREDICTED: zinc finger CCCH domain-containin...    102   7e-22   
emb|CDX95738.1|  BnaC03g26190D                                          102   7e-22   
ref|XP_010319044.1|  PREDICTED: zinc finger CCCH domain-containin...    103   7e-22   
ref|XP_004236314.1|  PREDICTED: zinc finger CCCH domain-containin...    103   8e-22   
gb|KJB10315.1|  hypothetical protein B456_001G195600                    101   9e-22   
ref|XP_009791089.1|  PREDICTED: zinc finger CCCH domain-containin...    102   9e-22   
ref|XP_004495983.1|  PREDICTED: zinc finger CCCH domain-containin...    102   9e-22   
ref|XP_011085488.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_009791086.1|  PREDICTED: zinc finger CCCH domain-containin...    103   1e-21   
ref|XP_002528968.1|  zinc finger protein, putative                      102   1e-21   
ref|XP_011085489.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_004299182.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_009791088.1|  PREDICTED: zinc finger CCCH domain-containin...    103   1e-21   
ref|XP_010943247.1|  PREDICTED: zinc finger CCCH domain-containin...    101   1e-21   
ref|XP_009791087.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
gb|KHN46585.1|  Zinc finger CCCH domain-containing protein 32           102   1e-21   
ref|XP_008239614.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_010098340.1|  Zinc finger CCCH domain-containing protein 58      102   1e-21   
ref|XP_011085490.1|  PREDICTED: zinc finger CCCH domain-containin...    101   1e-21   
ref|XP_007209937.1|  hypothetical protein PRUPE_ppa004690mg             102   1e-21   
ref|XP_006400404.1|  hypothetical protein EUTSA_v10013460mg             102   1e-21   
ref|XP_009418524.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   
ref|XP_002993272.1|  hypothetical protein SELMODRAFT_45667              100   2e-21   
ref|XP_002993790.1|  hypothetical protein SELMODRAFT_45658              100   2e-21   
gb|EYU40387.1|  hypothetical protein MIMGU_mgv1a022029mg                100   2e-21   
ref|XP_010943244.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   
gb|KHG05173.1|  hypothetical protein F383_31227                         100   3e-21   
ref|XP_009394545.1|  PREDICTED: zinc finger CCCH domain-containin...    100   3e-21   
ref|XP_006394295.1|  hypothetical protein EUTSA_v10004204mg             101   3e-21   
ref|XP_003549835.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   
gb|KHN14074.1|  Zinc finger CCCH domain-containing protein 43           101   3e-21   
gb|KHN05794.1|  Zinc finger CCCH domain-containing protein 43           102   3e-21   
ref|XP_010929994.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   
gb|KJB10313.1|  hypothetical protein B456_001G195600                    100   3e-21   
ref|XP_010929993.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   
gb|KJB10316.1|  hypothetical protein B456_001G195600                    100   4e-21   
emb|CDY08054.1|  BnaC03g34690D                                          100   4e-21   
ref|XP_003522417.1|  PREDICTED: zinc finger CCCH domain-containin...    102   4e-21   
ref|XP_002302855.1|  ZINC FINGER protein 2                              100   4e-21   
emb|CDX74105.1|  BnaA03g29420D                                          100   4e-21   
ref|XP_009385235.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-21   
ref|XP_011100472.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-21   
ref|XP_004247451.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    100   4e-21   
gb|KJB40000.1|  hypothetical protein B456_007G041600                    100   5e-21   
ref|XP_006407950.1|  hypothetical protein EUTSA_v10020686mg           99.8    5e-21   
ref|XP_006282213.1|  hypothetical protein CARUB_v10028484mg             100   5e-21   
ref|XP_011100471.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
gb|EPS74440.1|  hypothetical protein M569_00316                       99.4    6e-21   
ref|XP_010519530.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    6e-21   
ref|XP_009134895.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
emb|CDX84393.1|  BnaC03g51070D                                        99.8    6e-21   
gb|KJB39998.1|  hypothetical protein B456_007G041600                    100   7e-21   
ref|XP_006581890.1|  PREDICTED: zinc finger CCCH domain-containin...    101   7e-21   
gb|KJB39999.1|  hypothetical protein B456_007G041600                    100   7e-21   
gb|KHN31930.1|  Zinc finger CCCH domain-containing protein 43           101   7e-21   
gb|KHG13153.1|  hypothetical protein F383_04055                         100   8e-21   
ref|NP_190414.1|  zinc finger CCCH domain-containing protein 43       99.8    8e-21   
ref|NP_001150919.1|  zinc finger CCCH type domain-containing prot...    100   8e-21   
ref|XP_007037859.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    100   9e-21   
ref|NP_001150480.1|  LOC100284111                                       100   9e-21   
ref|XP_008796043.1|  PREDICTED: zinc finger CCCH domain-containin...    100   9e-21   
ref|XP_002864843.1|  zinc finger (CCCH-type) family protein           99.4    1e-20   
ref|XP_002871822.1|  hypothetical protein ARALYDRAFT_488738             100   1e-20   
ref|XP_010110220.1|  Zinc finger CCCH domain-containing protein 3     99.4    1e-20   
gb|ACN33323.1|  unknown                                               99.8    1e-20   
ref|XP_002457593.1|  hypothetical protein SORBIDRAFT_03g009930        99.8    1e-20   
gb|KHG04838.1|  hypothetical protein F383_29515                       99.8    1e-20   
gb|KJB51160.1|  hypothetical protein B456_008G204400                  99.4    1e-20   
ref|XP_010322521.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
ref|XP_010322522.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
emb|CDX70825.1|  BnaC03g09090D                                        98.6    1e-20   
ref|NP_001288815.1|  CCCH type zinc finger protein                    99.4    1e-20   
ref|XP_008367485.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
ref|XP_006347415.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
ref|XP_007144548.1|  hypothetical protein PHAVU_007G165200g           99.4    2e-20   
ref|XP_006347414.1|  PREDICTED: zinc finger CCCH domain-containin...    100   2e-20   
ref|XP_009150386.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    2e-20   
gb|KJB82178.1|  hypothetical protein B456_013G179800                  97.1    2e-20   
ref|XP_002275775.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-20   
ref|XP_002875904.1|  zinc finger (CCCH-type) family protein           98.6    2e-20   
emb|CDY41511.1|  BnaA06g22640D                                        98.2    2e-20   
gb|AGT16495.1|  zinc finger CCCH type domain-containing protein       99.0    2e-20   
gb|AAV66094.1|  At5g63260                                             98.6    2e-20   
ref|NP_201131.1|  zinc finger CCCH domain-containing protein 67       98.2    2e-20   
ref|NP_197356.2|  zinc finger CCCH domain-containing protein 58       98.6    2e-20   
ref|XP_009150385.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    2e-20   
ref|XP_010460041.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    2e-20   
ref|XP_010484051.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-20   
ref|XP_009613173.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    3e-20   
ref|NP_001190604.1|  zinc finger CCCH domain-containing protein 67    98.6    3e-20   



>emb|CBI17647.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 137/187 (73%), Gaps = 21/187 (11%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQQ T GN+Q YG SR SE  N GSQG    YR+G++P+G+YALQRENVFPERPGQPEC
Sbjct  139  ESQQQTGGNNQIYGTSRQSEQPNTGSQGTFSPYRSGSVPIGFYALQRENVFPERPGQPEC  198

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  199  QFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  258

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEGAC*GKFHGAQVTVILK  162
            CKFDHPMG+F YN+S SS+ +AP VR                        H AQ T   +
Sbjct  259  CKFDHPMGIFAYNLSASSSADAPVVRRL---------------------LHKAQATFTAR  297

Query  161  SETDAIW  141
             +TDA W
Sbjct  298  DKTDASW  304


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = -2

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
             +Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y R G CKFG +
Sbjct  13   HYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYLRTGQCKFGST  72

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKF HP    +  +S    TN P  R
Sbjct  73   CKFHHPQPS-SMMVSLRGITNWPLSR  97



>gb|KDO47608.1| hypothetical protein CISIN_1g0472482mg, partial [Citrus sinensis]
Length=201

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GNSQ YG SR +E +N GSQG   S+R+G++P+G+YALQRE+VFPERPGQPEC
Sbjct  10   ENLQQTSGNSQIYGASRQTEPSNSGSQGTMSSFRSGSVPVGFYALQRESVFPERPGQPEC  69

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  70   QFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  129

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPMG+FTYN+S SS+ +AP VR FLGSSS TG L LSSEG
Sbjct  130  CKFDHPMGIFTYNLSASSSADAP-VRRFLGSSSATGALNLSSEG  172



>ref|XP_009626545.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=350

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T GN+Q YG SRSS+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPEC
Sbjct  156  EDQQQTAGNNQVYGSSRSSDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPEC  215

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPS
Sbjct  216  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPS  275

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VFTYNIS SS+T+ P+VR  
Sbjct  276  CKFDHPMRVFTYNISASSSTDDPSVRRL  303


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQ ECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  C +Y 
Sbjct  5    YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  64

Query  371  RYGICKFGPSCKFDHP  324
            R   CKFG +CKF HP
Sbjct  65   RTAQCKFGSTCKFHHP  80



>ref|XP_009626544.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=381

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T GN+Q YG SRSS+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPEC
Sbjct  187  EDQQQTAGNNQVYGSSRSSDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPEC  246

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPS
Sbjct  247  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPS  306

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VFTYNIS SS+T+ P+VR  
Sbjct  307  CKFDHPMRVFTYNISASSSTDDPSVRRL  334


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQ ECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  C +Y 
Sbjct  36   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  95

Query  371  RYGICKFGPSCKFDHP  324
            R   CKFG +CKF HP
Sbjct  96   RTAQCKFGSTCKFHHP  111



>ref|XP_009626543.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=406

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T GN+Q YG SRSS+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPEC
Sbjct  212  EDQQQTAGNNQVYGSSRSSDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPEC  271

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPS
Sbjct  272  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPS  331

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VFTYNIS SS+T+ P+VR  
Sbjct  332  CKFDHPMRVFTYNISASSSTDDPSVRRL  359


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (49%), Gaps = 27/129 (21%)
 Frame = -2

Query  629  GSQGMNPSYRAGTL-PMGYYALQ--RENVFPERPGQPECQFYMKTGDCKFGAV-------  480
            G   ++PS R  +L  M   +++      +P R G+P+C +Y++TG C+FG+        
Sbjct  8    GPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPP  67

Query  479  -----------------CKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKF  351
                             CKFHHPR++        L+ +G PLRP E  C +Y R   CKF
Sbjct  68   NRKLYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKF  127

Query  350  GPSCKFDHP  324
            G +CKF HP
Sbjct  128  GSTCKFHHP  136



>ref|XP_009793876.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Nicotiana sylvestris]
Length=433

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ T GNSQ YG SRS +  N+GSQG+   YR  ++PMGYYALQ ENVFPERPGQPE
Sbjct  238  PEGQQQTAGNSQVYGTSRSGDAVNMGSQGVTSPYRPASVPMGYYALQGENVFPERPGQPE  297

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  298  CQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGP  357

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            SCKFDHPM VFTY+IS SS T+AP V+  LGSSSGT  LTL+SEG
Sbjct  358  SCKFDHPMTVFTYSISASSPTDAPAVQRLLGSSSGTSALTLTSEG  402


 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 63/99 (64%), Gaps = 9/99 (9%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYM  147

Query  371  RYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  282
            R G CKFG +CKF HP          G  TY   PS+TT
Sbjct  148  RTGQCKFGSTCKFHHPQPSNMMVSLRGSPTYPPVPSATT  186


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 6/106 (6%)
 Frame = -2

Query  629  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHHP  462
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F+HP
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  461  RERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
              R      +       P R G+P C +Y + G CKFG +CKF HP
Sbjct  73   PNR-KLAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFHHP  117



>ref|XP_009626542.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=427

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T GN+Q YG SRSS+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPEC
Sbjct  233  EDQQQTAGNNQVYGSSRSSDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPEC  292

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPS
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPS  352

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VFTYNIS SS+T+ P+VR  
Sbjct  353  CKFDHPMRVFTYNISASSSTDDPSVRRL  380


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQ ECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  C +Y 
Sbjct  82   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  141

Query  371  RYGICKFGPSCKFDHP  324
            R   CKFG +CKF HP
Sbjct  142  RTAQCKFGSTCKFHHP  157


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = -2

Query  629  GSQGMNPSYRAGTL-PMGYYALQ--RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            G   ++PS R  +L  M   +++      +P R G+P+C +Y++TG C+FG+ C+F+HP 
Sbjct  8    GPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPP  67

Query  458  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             R      +       P R G+  C +Y + G CKFG +CKF HP
Sbjct  68   NR-KLALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHP  111



>ref|XP_009769505.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana sylvestris]
Length=350

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T GNSQ YG SRSS+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPEC
Sbjct  156  EGQQQTAGNSQVYGSSRSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPEC  215

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPS
Sbjct  216  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPS  275

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPM VFTYNIS SS+T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  276  CKFDHPMRVFTYNISASSSTDDPSVRRLLGSSSGTGALTLTSEG  319


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQ ECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  C +Y 
Sbjct  5    YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  64

Query  371  RYGICKFGPSCKFDHP  324
            R   CKFG +CKF HP
Sbjct  65   RTAQCKFGSTCKFHHP  80



>gb|KHN29278.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=267

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+GN Q+YG SR SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPEC
Sbjct  74   DSPQQTMGNGQSYGTSRQSEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPEC  133

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  134  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  193

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMGVFTYNIS S + +AP  R  
Sbjct  194  CKFDHPMGVFTYNISASPSADAPGRRML  221



>ref|XP_002278934.2| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Vitis vinifera]
Length=441

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQQ T GN+Q YG SR SE  N GSQG    YR+G++P+G+YALQRENVFPERPGQPEC
Sbjct  247  ESQQQTGGNNQIYGTSRQSEQPNTGSQGTFSPYRSGSVPIGFYALQRENVFPERPGQPEC  306

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  307  QFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  366

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG+F YN+S SS+ +AP VR  
Sbjct  367  CKFDHPMGIFAYNLSASSSADAPVVRRL  394


 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  90   FPERMGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYL  149

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  150  RTGQCKFGSTCKFHHP  165


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG  C+F+HP  R      +       P R G+P C +Y 
Sbjct  45   YPERPGEPDCSYYIRTGLCRFGITCRFNHPPNR-KLAIATARMKGEFPERMGQPECQYYL  103

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  104  KTGTCKFGATCKFHHP  119



>ref|XP_009611380.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=433

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ T GNSQ YG SRS + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQPE
Sbjct  238  PEGQQQTAGNSQVYGTSRSGDAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQPE  297

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  298  CQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGP  357

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            SCKFDHPM VFTY+IS SS+T+AP V+  LGSSSGT  LTL+SEG
Sbjct  358  SCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTLTSEG  402


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYM  147

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 6/106 (6%)
 Frame = -2

Query  629  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHHP  462
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F+HP
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  461  RERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
              R      +       P R G+P C +Y + G CKFG +CKF HP
Sbjct  73   PNR-KLAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFHHP  117



>ref|XP_009611379.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=437

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ T GNSQ YG SRS + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQPE
Sbjct  242  PEGQQQTAGNSQVYGTSRSGDAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQPE  301

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  302  CQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGP  361

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            SCKFDHPM VFTY+IS SS+T+AP V+  LGSSSGT  LTL+SEG
Sbjct  362  SCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTLTSEG  406


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PLRP E  CA+Y 
Sbjct  92   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYM  151

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  152  RTGQCKFGSTCKFHHP  167


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = -2

Query  629  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHHP  462
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F+HP
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  461  RERlipppdsllspiglpLRP---GEPLCAFYSRYGICKFGPSCKFDHP  324
              R +    ++ +       P   G+P C +Y + G CKFG +CKF HP
Sbjct  73   PNRKLYLMQAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFHHP  121



>ref|XP_009611378.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=450

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ T GNSQ YG SRS + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQPE
Sbjct  255  PEGQQQTAGNSQVYGTSRSGDAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQPE  314

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  315  CQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGP  374

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            SCKFDHPM VFTY+IS SS+T+AP V+  LGSSSGT  LTL+SEG
Sbjct  375  SCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTLTSEG  419


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 55/93 (59%), Gaps = 17/93 (18%)
 Frame = -2

Query  551  FPERPGQPECQ-----------------FYMKTGDCKFGAVCKFHHPRERlipppdslls  423
            +PER GQPECQ                 +Y+KTG CKFGA CKFHHP+++        L+
Sbjct  88   YPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLN  147

Query  422  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  148  VLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHP  180


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 58/123 (47%), Gaps = 23/123 (19%)
 Frame = -2

Query  629  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHHP  462
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F+HP
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  461  RERlipppdsllspiglpLRPGEPLC-----------------AFYSRYGICKFGPSCKF  333
              R      +       P R G+P C                  +Y + G CKFG +CKF
Sbjct  73   PNR-KLAIATARMKGEYPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKF  131

Query  332  DHP  324
             HP
Sbjct  132  HHP  134


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +YM+TG CKFG+ CKFHHP+
Sbjct  151  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ  181



>ref|XP_007205202.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
 gb|EMJ06401.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
Length=442

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQQ  VGNSQ YG SR  E  N GSQG   SYR+G++P+G+YALQRENVFPERPGQPE
Sbjct  248  PESQQQPVGNSQIYGTSRQGEPENSGSQGTFSSYRSGSIPVGFYALQRENVFPERPGQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  308  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGP  367

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCKFDHPMG+FTYN + SS+ +AP  R
Sbjct  368  SCKFDHPMGIFTYNPNASSSADAPARR  394


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  92   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CK+ HP
Sbjct  152  RTGQCKFGSTCKYHHP  167


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERIGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_009611374.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611375.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611377.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ T GNSQ YG SRS + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQPE
Sbjct  259  PEGQQQTAGNSQVYGTSRSGDAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQPE  318

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  319  CQFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGP  378

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            SCKFDHPM VFTY+IS SS+T+AP V+  LGSSSGT  LTL+SEG
Sbjct  379  SCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTLTSEG  423


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 55/93 (59%), Gaps = 17/93 (18%)
 Frame = -2

Query  551  FPERPGQPECQ-----------------FYMKTGDCKFGAVCKFHHPRERlipppdslls  423
            +PER GQPECQ                 +Y+KTG CKFGA CKFHHP+++        L+
Sbjct  92   YPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLN  151

Query  422  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  152  VLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHP  184


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = -2

Query  629  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHHP  462
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F+HP
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  461  RERlipppdsllspiglpLRP---GEPLC-----------------AFYSRYGICKFGPS  342
              R +    ++ +       P   G+P C                  +Y + G CKFG +
Sbjct  73   PNRKLYLMQAIATARMKGEYPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGAT  132

Query  341  CKFDHP  324
            CKF HP
Sbjct  133  CKFHHP  138


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +YM+TG CKFG+ CKFHHP+
Sbjct  155  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ  185



>ref|XP_009769504.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana sylvestris]
Length=381

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T GNSQ YG SRSS+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPEC
Sbjct  187  EGQQQTAGNSQVYGSSRSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPEC  246

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPS
Sbjct  247  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPS  306

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VFTYNIS SS+T+ P+VR  
Sbjct  307  CKFDHPMRVFTYNISASSSTDDPSVRRL  334


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 59/99 (60%), Gaps = 9/99 (9%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQ ECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  C +Y 
Sbjct  36   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  95

Query  371  RYGICKFGPSCKFDHP---------MGVFTYNISPSSTT  282
            R   CKFG +CKF HP          G   Y   PSSTT
Sbjct  96   RTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTT  134



>ref|XP_009769503.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana sylvestris]
Length=406

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T GNSQ YG SRSS+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPEC
Sbjct  212  EGQQQTAGNSQVYGSSRSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPEC  271

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPS
Sbjct  272  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPS  331

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPM VFTYNIS SS+T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  332  CKFDHPMRVFTYNISASSSTDDPSVRRLLGSSSGTGALTLTSEG  375


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 62/129 (48%), Gaps = 27/129 (21%)
 Frame = -2

Query  629  GSQGMNPSYRAGTL-PMGYYALQ--RENVFPERPGQPECQFYMKTGDCKFGAV-------  480
            G   ++PS R  +L  M   +++      +P R G+ +C +Y++TG C+FG+        
Sbjct  8    GPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQFNHPP  67

Query  479  -----------------CKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKF  351
                             CKFHHPR++        L+ +G PLRP E  C +Y R   CKF
Sbjct  68   NRKLYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKF  127

Query  350  GPSCKFDHP  324
            G +CKF HP
Sbjct  128  GSTCKFHHP  136



>ref|XP_009769498.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769499.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769500.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769502.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
Length=427

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T GNSQ YG SRSS+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPEC
Sbjct  233  EGQQQTAGNSQVYGSSRSSDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPEC  292

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPS
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPS  352

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VFTYNIS SS+T+ P+VR  
Sbjct  353  CKFDHPMRVFTYNISASSSTDDPSVRRL  380


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 59/99 (60%), Gaps = 9/99 (9%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQ ECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  C +Y 
Sbjct  82   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  141

Query  371  RYGICKFGPSCKFDHP---------MGVFTYNISPSSTT  282
            R   CKFG +CKF HP          G   Y   PSSTT
Sbjct  142  RTAQCKFGSTCKFHHPEPSNMMVSSRGSPVYPPGPSSTT  180


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 4/105 (4%)
 Frame = -2

Query  629  GSQGMNPSYRAGTL-PMGYYALQ--RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            G   ++PS R  +L  M   +++      +P R G+ +C +Y++TG C+FG+ C+F+HP 
Sbjct  8    GPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQFNHPP  67

Query  458  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             R      +       P R G+  C +Y + G CKFG +CKF HP
Sbjct  68   NR-KLALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHP  111



>ref|XP_008218439.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Prunus mume]
Length=442

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQQ  VGNSQ YG SR  E  N GSQG    YR+G++P+G+YALQRENVFPERPGQPE
Sbjct  248  PESQQQPVGNSQIYGTSRQGEPENSGSQGTFSPYRSGSIPVGFYALQRENVFPERPGQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  308  CQFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGP  367

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCKFDHPMG+FTYN + SS+ +AP  R
Sbjct  368  SCKFDHPMGIFTYNPNASSSADAPARR  394


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  92   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CK+ HP
Sbjct  152  RTGQCKFGSTCKYHHP  167


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERIGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_011015459.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=412

 Score =   210 bits (535),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE+QQ T GNSQ YG SR SE  N GSQG    YR+G+ P+GYYALQRE+VFPERPGQPE
Sbjct  219  PENQQQT-GNSQIYGTSRHSESVNAGSQGTFSPYRSGSAPLGYYALQRESVFPERPGQPE  277

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  278  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGP  337

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCKFDHPMG+FTYN++ SS+ +AP  R
Sbjct  338  SCKFDHPMGIFTYNLTASSSADAPVRR  364


 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  51   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPL  110

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            +P E  CA+Y R G CKFG +CKF HP
Sbjct  111  QPNEIECAYYLRTGQCKFGSTCKFHHP  137


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  17   YPERSGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGATCKFHHP  91



>ref|XP_011014133.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=447

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE+QQ T GNSQ YG SR SE  N GSQG    YR+G+ P+GYYALQRE+VFPERPGQPE
Sbjct  254  PENQQQT-GNSQIYGTSRHSESVNAGSQGTFSPYRSGSAPLGYYALQRESVFPERPGQPE  312

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  313  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGP  372

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCKFDHPMG+FTYN++ SS+ +AP  R
Sbjct  373  SCKFDHPMGIFTYNLTASSSADAPVRR  399


 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  86   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPL  145

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            +P E  CA+Y R G CKFG +CKF HP
Sbjct  146  QPNEIECAYYLRTGQCKFGSTCKFHHP  172


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  52   YPERSGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  110

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  111  KTGTCKFGATCKFHHP  126



>ref|XP_004302155.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ TVGNSQ YG SR  E  N+GSQG    YR+G++P+G+YAL RENVFPERPGQPEC
Sbjct  249  EGQQQTVGNSQVYGTSRQREPENLGSQGAYSPYRSGSIPVGFYALPRENVFPERPGQPEC  308

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  309  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  368

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKFDHPMG+FTYN++ SS+  +P  R
Sbjct  369  CKFDHPMGIFTYNLAASSSAESPVRR  394


 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  92   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  371  RYGICKFGPSCKFDHP  324
            R G CKF  +CK+ HP
Sbjct  152  RTGQCKFASTCKYHHP  167


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  47   YPERAGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERVGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_006480414.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Citrus sinensis]
 ref|XP_006480415.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Citrus sinensis]
 ref|XP_006480416.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Citrus sinensis]
 ref|XP_006480417.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X5 [Citrus sinensis]
Length=420

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GNSQ YG SR +E +N GSQG    +R+G++P+G+YALQRE+VFPERPGQPEC
Sbjct  229  ENLQQTSGNSQIYGASRQTEPSNSGSQGTMSPFRSGSIPVGFYALQRESVFPERPGQPEC  288

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  289  QFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  348

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPMG+FTYN+S SS+ +AP VR FLGSSS TG L LSSEG
Sbjct  349  CKFDHPMGIFTYNLSASSSADAP-VRRFLGSSSATGALNLSSEG  391


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  72   YPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  131

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGSTCKFHHP  147


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  118  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ  148



>ref|XP_006428577.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428578.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480418.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X6 [Citrus sinensis]
 ref|XP_006480419.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X7 [Citrus sinensis]
 ref|XP_006480420.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X8 [Citrus sinensis]
 gb|ESR41817.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41818.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=407

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GNSQ YG SR +E +N GSQG    +R+G++P+G+YALQRE+VFPERPGQPEC
Sbjct  216  ENLQQTSGNSQIYGASRQTEPSNSGSQGTMSPFRSGSIPVGFYALQRESVFPERPGQPEC  275

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  276  QFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  335

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPMG+FTYN+S SS+ +AP VR FLGSSS TG L LSSEG
Sbjct  336  CKFDHPMGIFTYNLSASSSADAP-VRRFLGSSSATGALNLSSEG  378


 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  59   YPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  118

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGSTCKFHHP  134


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
             PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  14   LPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARIKGDYPERLGQPECQYYL  72

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  73   KTGTCKFGATCKFHHP  88


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  105  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ  135



>ref|XP_006428579.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428580.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480413.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Citrus sinensis]
 gb|ESR41819.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41820.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=439

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GNSQ YG SR +E +N GSQG    +R+G++P+G+YALQRE+VFPERPGQPEC
Sbjct  248  ENLQQTSGNSQIYGASRQTEPSNSGSQGTMSPFRSGSIPVGFYALQRESVFPERPGQPEC  307

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  308  QFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  367

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPMG+FTYN+S SS+ +AP VR FLGSSS TG L LSSEG
Sbjct  368  CKFDHPMGIFTYNLSASSSADAP-VRRFLGSSSATGALNLSSEG  410


 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  91   YPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  150

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  151  RTGQCKFGSTCKFHHP  166


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
             PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  46   LPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARIKGDYPERLGQPECQYYL  104

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  105  KTGTCKFGATCKFHHP  120


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  137  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ  167



>ref|XP_002512627.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF50079.1| nucleic acid binding protein, putative [Ricinus communis]
Length=448

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ T GNSQ YG SR SE  N GSQG     RAG++P+G+YALQR+NVFPERPGQPE
Sbjct  255  PEGQQQT-GNSQIYGTSRQSESVNTGSQGTLSPLRAGSMPVGFYALQRDNVFPERPGQPE  313

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYG+CKFGP
Sbjct  314  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGVCKFGP  373

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCKFDHPMG+FTYN+S  S+ +AP  R
Sbjct  374  SCKFDHPMGIFTYNLSAPSSADAPVRR  400


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  88   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVSLNILGYPL  147

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  148  RPNEIECAYYLRTGQCKFGSTCKFHHP  174


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  54   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  112

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  113  KTGTCKFGATCKFHHP  128


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  145  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ  175



>ref|XP_011014371.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=445

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQQ T GNSQ YG SR SE  N GSQG    YR+ ++PMG+YALQRE+VFPERPGQPE
Sbjct  252  PESQQQT-GNSQIYGTSRQSESVNAGSQGTFSPYRSDSVPMGFYALQRESVFPERPGQPE  310

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LS IGLPLRPGEPLC FYSRYGICKFGP
Sbjct  311  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPLRPGEPLCIFYSRYGICKFGP  370

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCKF HPMG+FTYN++ SS+ +AP  R
Sbjct  371  SCKFHHPMGIFTYNLTASSSADAPVRR  397


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  84   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGVSGRVSLNILGYPL  143

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R  E  CA+Y R G CKFG +CKF HP
Sbjct  144  RLNEMECAYYLRTGQCKFGSTCKFHHP  170


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG  C+F+HP  R      +       P R G+P C +Y 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  108

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  109  KTGTCKFGATCKFHHP  124



>ref|XP_003534518.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoformX2 [Glycine max]
Length=426

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+GN Q+YG SR SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPEC
Sbjct  233  DSPQQTMGNGQSYGTSRQSEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPEC  292

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  352

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMGVFTYNIS S + +AP  R  
Sbjct  353  CKFDHPMGVFTYNISASPSADAPGRRML  380


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA C+FHHPR++        ++ +G PL
Sbjct  69   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPL  128

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP EP CA+Y R G CKFG +CKF HP
Sbjct  129  RPNEPECAYYLRTGQCKFGNTCKFHHP  155


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  93

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +C+F HP
Sbjct  94   KTGTCKFGATCRFHHP  109



>ref|XP_004250094.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum lycopersicum]
Length=433

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE Q  T GN+Q YG SRSS+   +GSQ +   YR  + PMGYYALQ ENVFPERPGQPE
Sbjct  238  PEGQGQTAGNNQVYGTSRSSDPVAMGSQAVTSPYRQASGPMGYYALQEENVFPERPGQPE  297

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIPPPD LLSPIGLPLRPGEPLC FYSRYGICKFGP
Sbjct  298  CQFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGP  357

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            SCKFDHPM VFTY+I+ SS T+APTV+  LGSSSGT  L ++SEG
Sbjct  358  SCKFDHPMTVFTYSIAASSATDAPTVQRLLGSSSGTSALNMTSEG  402


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+++KTG CKFGA CKFHHP+++        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERIGQPECQYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVMGYPLRPNESECAYYM  147

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P R G+P+C +Y++TG C+FG+ C+F+HP  R      +       P R G+P C ++ 
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNR-KLAIATARMKGEYPERIGQPECQYFL  101

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  102  KTGTCKFGATCKFHHP  117



>ref|XP_006587810.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Glycine max]
Length=437

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+GN Q+YG SR SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPEC
Sbjct  244  DSPQQTMGNGQSYGTSRQSEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPEC  303

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  304  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  363

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMGVFTYNIS S + +AP  R  
Sbjct  364  CKFDHPMGVFTYNISASPSADAPGRRML  391


 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A + +  FPER GQPECQ+Y+KTG CKFGA C+FHHPR++        ++ +G PLRP E
Sbjct  84   AARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPNE  143

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
            P CA+Y R G CKFG +CKF HP
Sbjct  144  PECAYYLRTGQCKFGNTCKFHHP  166


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERli----------pppdsllspiglpLR  402
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R +              +       P R
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLLPDSFFFENYQAIAAARMKGEFPER  94

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHP  324
             G+P C +Y + G CKFG +C+F HP
Sbjct  95   IGQPECQYYLKTGTCKFGATCRFHHP  120



>ref|XP_002325901.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF00283.2| zinc finger family protein [Populus trichocarpa]
Length=445

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQQ T GNSQ YG SR +E  N GSQG    YR+ ++PMG+YALQRE+VFPERPGQPE
Sbjct  252  PESQQQT-GNSQIYGTSRQNESVNAGSQGTFSPYRSDSVPMGFYALQRESVFPERPGQPE  310

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LS IGLPLRPGEPLC FYSRYGICKFGP
Sbjct  311  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPLRPGEPLCIFYSRYGICKFGP  370

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCKF HPMG+FTYN++ SS+ +AP  R
Sbjct  371  SCKFHHPMGIFTYNLTASSSADAPVRR  397


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  84   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGVSGRVSLNILGYPL  143

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R  E  CA+Y R G CKFG +CKF HP
Sbjct  144  RLNEMECAYYLRTGQCKFGSTCKFHHP  170


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG  C+F+HP  R      +       P R G+P C +Y 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  108

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  109  KTGTCKFGATCKFHHP  124



>ref|XP_006353234.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum tuberosum]
Length=433

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE Q  T GN+Q YG SRSS+ A +GSQG+   YR  + PMGYYALQ ENVFPERPGQ E
Sbjct  238  PEGQGQTAGNNQVYGTSRSSDPATMGSQGVTSPYRQASGPMGYYALQGENVFPERPGQAE  297

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIPPPD LLSPIGLPLR GEPLC FYSRYGICKFGP
Sbjct  298  CQFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRTGEPLCIFYSRYGICKFGP  357

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            SCKFDHPM VFTY+I+ SSTT+APTV+  LGSSSGT  L ++SEG
Sbjct  358  SCKFDHPMTVFTYSIAASSTTDAPTVQRLLGSSSGTSALNMTSEG  402


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+++KTG CKFGA CKFHHP+++        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERIGQPECQYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNESECAYYM  147

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P R G+P+C +Y++TG C+FG+ C+F+HP  R      +       P R G+P C ++ 
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNR-KLAIATARMKGEYPERIGQPECQYFL  101

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  102  KTGTCKFGATCKFHHP  117



>gb|KHN40466.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=347

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+ N Q+YG SR SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPEC
Sbjct  154  DSPQQTMANGQSYGTSRQSEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPEC  213

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  214  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  273

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMGVFTYN+S S   +AP  R  
Sbjct  274  CKFDHPMGVFTYNMSASPLADAPGRRML  301


 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 16/76 (21%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R                +  EP C +Y 
Sbjct  17   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR----------------KLNEPECGYYL  60

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  61   RTGQCKFGNTCKFHHP  76



>ref|XP_010111067.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
 gb|EXC29929.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
Length=419

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ + G+SQ YG SR S+ AN GSQG    YR+G++P+G+YALQRENVFPER GQPE
Sbjct  225  PERQQPS-GSSQIYGTSRQSDPANTGSQGTLSPYRSGSIPVGFYALQRENVFPERTGQPE  283

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHPRERLIP PD LLSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  284  CQFYMKTGDCKFGAVCKFHHPRERLIPAPDCLLSPMGLPLRPGEPLCIFYSRYGICKFGP  343

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCKFDHPMG+FT N+S +S+T+ P  R
Sbjct  344  SCKFDHPMGIFTINLSATSSTDTPVRR  370


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 55/101 (54%), Gaps = 24/101 (24%)
 Frame = -2

Query  554  VFPERPGQPECQ------------------------FYMKTGDCKFGAVCKFHHPRERli  447
             +PERPG+P+C                         +Y+KTG CKFGA CKFHHPR++  
Sbjct  44   TYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLYYLKTGTCKFGATCKFHHPRDKAG  103

Query  446  pppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
                  L+ +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  104  IAGRVSLNILGYPLRPNEMECAYYLRTGQCKFGSTCKFHHP  144


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  115  YPLRPNEMECAYYLRTGQCKFGSTCKFHHPQ  145



>gb|KDP23293.1| hypothetical protein JCGZ_23126 [Jatropha curcas]
Length=442

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ T GN Q YG SR SE  N GSQG    YR+G++P+G+YALQ EN FPERPGQPE
Sbjct  249  PEGQQQT-GNGQIYGTSRQSESLNTGSQGALSPYRSGSVPVGFYALQTENAFPERPGQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYG+CKFGP
Sbjct  308  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGVCKFGP  367

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVR  264
            SCK+DHPMG+FTYN+S SS+T+ P  R
Sbjct  368  SCKYDHPMGIFTYNLSASSSTDTPVRR  394


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  82   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVSLNIMGYPL  141

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  142  RPNEIECAYYLRTGQCKFGSTCKFHHP  168


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  48   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  106

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  107  KTGTCKFGATCKFHHP  122


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  139  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ  169



>ref|XP_007139733.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11727.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=408

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+GN Q+YG +R SE  N GSQG    +R+G++P+G+YAL REN+FPERP QP+C
Sbjct  215  DSSQQTMGNGQSYGTNRQSEPTNAGSQGAYSQFRSGSVPVGFYALPRENIFPERPDQPDC  274

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  275  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  334

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKFDHPMGVFTYNIS S + +AP  R
Sbjct  335  CKFDHPMGVFTYNISASPSADAPGRR  360


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  51   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPL  110

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP EP CA+Y R G CKFG +CKF HP
Sbjct  111  RPNEPECAYYLRTGQCKFGNTCKFHHP  137


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  17   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +C+F HP
Sbjct  76   KTGTCKFGATCRFHHP  91


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG  CKFHHP+
Sbjct  108  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ  138



>ref|XP_007139732.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11726.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=426

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+GN Q+YG +R SE  N GSQG    +R+G++P+G+YAL REN+FPERP QP+C
Sbjct  233  DSSQQTMGNGQSYGTNRQSEPTNAGSQGAYSQFRSGSVPVGFYALPRENIFPERPDQPDC  292

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  352

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKFDHPMGVFTYNIS S + +AP  R
Sbjct  353  CKFDHPMGVFTYNISASPSADAPGRR  378


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  69   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPL  128

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP EP CA+Y R G CKFG +CKF HP
Sbjct  129  RPNEPECAYYLRTGQCKFGNTCKFHHP  155


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  93

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +C+F HP
Sbjct  94   KTGTCKFGATCRFHHP  109


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG  CKFHHP+
Sbjct  126  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ  156



>ref|XP_010929828.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Elaeis guineensis]
Length=380

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+SQQ T G +Q Y  +  SE +  G+QG   SYR G++PMG YALQREN+FPERP QPE
Sbjct  169  PDSQQQTPGAAQYYSTTHQSETS-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPE  227

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHPRERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  228  CQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGP  287

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG FTY IS SST + PTVR  
Sbjct  288  NCKFDHPMGTFTYGISTSSTADVPTVRRL  316


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  1    MAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  60

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  61   RPNEKECAYYIRTGQCKFGNTCKFHHP  87


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  58   YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQ  88



>ref|XP_007143976.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
 gb|ESW15970.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
Length=444

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q  + N Q YG SR  E+AN G+ G    +R+GT+P+G+YALQREN+FPERPGQPEC
Sbjct  251  DSLQQAMRNGQTYGTSRQGELANTGTHGAYSQFRSGTVPVGFYALQRENIFPERPGQPEC  310

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHP ERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPS
Sbjct  311  QFYMKTGDCKFGAVCRFHHPHERLIPAPDCVLSPMGLPLRPGEPLCVFYSRYGICKFGPS  370

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPMG+FTYNIS S + +AP+ +H L SSSGT  L+LSSEG
Sbjct  371  CKFDHPMGIFTYNISASPSADAPS-KHLLRSSSGTAALSLSSEG  413


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PLRP EP C +Y 
Sbjct  94   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQTGIAGRVSLNTLGYPLRPNEPECTYYL  153

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  154  RTGQCKFGNTCKFHHP  169


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
             +PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y
Sbjct  48   AYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMIGEFPERIGQPECQYY  106

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKF HP
Sbjct  107  LKTGTCKFGATCKFHHP  123


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG  CKFHHP+
Sbjct  140  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  170



>ref|XP_006602842.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=426

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+ N Q+YG SR SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPEC
Sbjct  233  DSPQQTMANGQSYGTSRQSEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPEC  292

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHP ER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  293  QFYMKTGDCKFGAVCRFHHPHERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  352

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKFDHPMGVFTYN+S S   +AP  R
Sbjct  353  CKFDHPMGVFTYNMSASPLADAPGRR  378


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA C+FHHPR++        L+ +G PL
Sbjct  69   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPL  128

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP EP C +Y R G CKFG +CKF HP
Sbjct  129  RPNEPECGYYLRTGQCKFGNTCKFHHP  155


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  93

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +C+F HP
Sbjct  94   KTGTCKFGATCRFHHP  109



>ref|XP_010929826.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Elaeis guineensis]
Length=439

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+SQQ T G +Q Y  +  SE +  G+QG   SYR G++PMG YALQREN+FPERP QPE
Sbjct  228  PDSQQQTPGAAQYYSTTHQSETS-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPE  286

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHPRERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  287  CQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGP  346

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG FTY IS SST + PTVR  
Sbjct  347  NCKFDHPMGTFTYGISTSSTADVPTVRRL  375


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 54/100 (54%), Gaps = 24/100 (24%)
 Frame = -2

Query  551  FPERPGQPEC------------------------QFYMKTGDCKFGAVCKFHHPRERlip  444
            +PERPG+ +C                         +Y+KTG CKFGA CKFHHP+++   
Sbjct  47   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLYYLKTGTCKFGATCKFHHPKDKAGI  106

Query  443  ppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
                 L+ +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  107  AGRVQLNILGYPLRPNEKECAYYIRTGQCKFGNTCKFHHP  146


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  117  YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQ  147



>ref|XP_010929827.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Elaeis guineensis]
Length=430

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+SQQ T G +Q Y  +  SE +  G+QG   SYR G++PMG YALQREN+FPERP QPE
Sbjct  219  PDSQQQTPGAAQYYSTTHQSETS-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPE  277

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHPRERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  278  CQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGP  337

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG FTY IS SST + PTVR  
Sbjct  338  NCKFDHPMGTFTYGISTSSTADVPTVRRL  366


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  51   LAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  110

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  111  RPNEKECAYYIRTGQCKFGNTCKFHHP  137


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+ +C +Y++TG C+FG  CKF+HP  R      +     G P R G+P C +Y 
Sbjct  17   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNR-RLAIAAARIKGGYPERVGQPECQYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGATCKFHHP  91



>ref|XP_010929825.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Elaeis guineensis]
Length=460

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 122/149 (82%), Gaps = 1/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+SQQ T G +Q Y  +  SE +  G+QG   SYR G++PMG YALQREN+FPERP QPE
Sbjct  249  PDSQQQTPGAAQYYSTTHQSETS-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHPRERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  308  CQFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGP  367

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG FTY IS SST + PTVR  
Sbjct  368  NCKFDHPMGTFTYGISTSSTADVPTVRRL  396


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  81   LAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  140

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEKECAYYIRTGQCKFGNTCKFHHP  167


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+ +C +Y++TG C+FG  CKF+HP  R      +     G P R G+P C +Y 
Sbjct  47   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNR-RLAIAAARIKGGYPERVGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  138  YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQ  168



>ref|XP_008812314.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=457

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+SQQ T G  Q YG SR SE    G+QG   SYR G++PMG YALQREN+FPERP QPE
Sbjct  249  PDSQQQTPGAGQYYGTSRQSETG-AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHPRERL+P P+  LSP+GLPLRPGEPLC FY+RYGICKFGP
Sbjct  308  CQFYMKTGDCKFGAVCKFHHPRERLVPVPNCSLSPLGLPLRPGEPLCVFYARYGICKFGP  367

Query  344  SCKFDHPMGVFTYNISPSSTTNAP  273
            +CKFDHPMG FTY IS SST +AP
Sbjct  368  NCKFDHPMGTFTYGISTSSTADAP  391


 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  81   LAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  140

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEKECAYYLRTGQCKFGNTCKFHHP  167


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG  CKF+HP  R      +     G P R G+P C +Y 
Sbjct  47   YPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNR-KLAIAAARIKGGYPERVGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  138  YPLRPNEKECAYYLRTGQCKFGNTCKFHHPQ  168



>ref|XP_010673926.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T GNS  YG +R SE     SQG   SYR+G++P+GYYALQR+NVFPERPGQPEC
Sbjct  264  DGQQQTPGNSPGYGTARQSESPVSASQGAYSSYRSGSVPVGYYALQRDNVFPERPGQPEC  323

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFGAVC+FHHPRERLIP PD LLS +GLPLRPGEPLC FYSRYGICKFGP+
Sbjct  324  QYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGEPLCIFYSRYGICKFGPN  383

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG+F YN+SP++T  +   R+ 
Sbjct  384  CKFDHPMGIFAYNVSPTATDASAMRRYL  411


 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKF+HP+++        L+ +G PLRP EP CA+Y 
Sbjct  113  FPERTGQPECQYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPNEPECAYYL  172

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  173  RTGQCKFGSTCKFHHP  188


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+ +C FY++TG C+FG+ C+F+HP  R      +       P R G+P C +Y 
Sbjct  68   YPEREGEADCSFYLRTGLCRFGSTCRFNHPPNR-KLALATARMKGEFPERTGQPECQYYL  126

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF+HP
Sbjct  127  KTGTCKFGATCKFNHP  142


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG+ CKFHHP+
Sbjct  159  YPLRPNEPECAYYLRTGQCKFGSTCKFHHPQ  189



>ref|XP_010673925.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=459

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T GNS  YG +R SE     SQG   SYR+G++P+GYYALQR+NVFPERPGQPEC
Sbjct  266  DGQQQTPGNSPGYGTARQSESPVSASQGAYSSYRSGSVPVGYYALQRDNVFPERPGQPEC  325

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFGAVC+FHHPRERLIP PD LLS +GLPLRPGEPLC FYSRYGICKFGP+
Sbjct  326  QYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGEPLCIFYSRYGICKFGPN  385

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG+F YN+SP++T  +   R+ 
Sbjct  386  CKFDHPMGIFAYNVSPTATDASAMRRYL  413


 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKF+HP+++        L+ +G PLRP EP CA+Y 
Sbjct  113  FPERTGQPECQYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPNEPECAYYL  172

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  173  RTGQCKFGSTCKFHHP  188


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+ +C FY++TG C+FG+ C+F+HP  R      +       P R G+P C +Y 
Sbjct  68   YPEREGEADCSFYLRTGLCRFGSTCRFNHPPNR-KLALATARMKGEFPERTGQPECQYYL  126

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF+HP
Sbjct  127  KTGTCKFGATCKFNHP  142


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG+ CKFHHP+
Sbjct  159  YPLRPNEPECAYYLRTGQCKFGSTCKFHHPQ  189



>ref|XP_008359920.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Malus domestica]
Length=443

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQQ T GNSQ YG SR  E  N GSQG    YR+G++P+G+YALQRENVFPERPGQPEC
Sbjct  249  ESQQQTAGNSQMYGTSRQGEPENSGSQGGFSPYRSGSIPVGFYALQRENVFPERPGQPEC  308

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHP ERLIP PD +LSPIGLPLRPGEP+C FYSRYGICKFGPS
Sbjct  309  QFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGEPMCIFYSRYGICKFGPS  368

Query  341  CKFDHPMGVFTYNI  300
            CKFDHPMG+FTY +
Sbjct  369  CKFDHPMGIFTYGL  382


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPL  140

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEIECAYYLRTGQCKFGGTCKFHHP  167


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  138  YPLRPNEIECAYYLRTGQCKFGGTCKFHHPQ  168



>ref|XP_010245962.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Nelumbo nucifera]
Length=457

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  686  TVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMK  507
            TV +SQ YG SR S+  +VG QG  PSYR+G++P+G YALQRE+VFPERP QPECQFYMK
Sbjct  254  TVVSSQFYGTSRQSDTTSVGVQGTFPSYRSGSVPVGLYALQRESVFPERPDQPECQFYMK  313

Query  506  TGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH  327
            TGDCKFGAVC+FHHPRERLIP P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDH
Sbjct  314  TGDCKFGAVCRFHHPRERLIPVPNCVLSPLGLPLRPGEPLCIFYSRYGICKFGPNCKFDH  373

Query  326  PMGVFTYNISPSSTTNAPTVR  264
            PMG FTY++S  S+T+ P +R
Sbjct  374  PMGPFTYSLSAFSSTDVPVIR  394


 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A +    +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  79   LAVVAARMIGSYPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVPLNILGYPL  138

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  139  RPNERECAYYLRTGQCKFGNTCKFHHP  165


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+ +C +Y++TG C+FG  C+F+HP  R      +       P R G+P C +Y 
Sbjct  45   YPERPGELDCAYYVRTGLCRFGMTCRFNHPPNR-KLAVVAARMIGSYPERIGQPECQYYL  103

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  104  KTGTCKFGATCKFHHP  119



>ref|XP_008359919.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Malus domestica]
Length=444

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQQ T GNSQ YG SR  E  N GSQG    YR+G++P+G+YALQRENVFPERPGQPEC
Sbjct  250  ESQQQTAGNSQMYGTSRQGEPENSGSQGGFSPYRSGSIPVGFYALQRENVFPERPGQPEC  309

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHP ERLIP PD +LSPIGLPLRPGEP+C FYSRYGICKFGPS
Sbjct  310  QFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGEPMCIFYSRYGICKFGPS  369

Query  341  CKFDHPMGVFTYNI  300
            CKFDHPMG+FTY +
Sbjct  370  CKFDHPMGIFTYGL  383


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPL  140

Query  404  RP-GEPLCAFYSRYGICKFGPSCKFDHP  324
            RP  E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPQNEIECAYYLRTGQCKFGGTCKFHHP  168


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_009338000.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQQ T GNSQ YG S   E  N GSQG    Y +G++P+G+YALQRENVFPERPGQPE
Sbjct  248  PESQQQTAGNSQMYGTSHQGEPENSGSQGGFSPYSSGSIPVGFYALQRENVFPERPGQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  308  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGP  367

Query  344  SCKFDHPMGVFTYNI  300
            SCKF+HPMG+FT N+
Sbjct  368  SCKFNHPMGIFTLNL  382


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGMAGRVALNILGYPL  140

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEVECAYYLRTGQCKFGSTCKFHHP  167


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
             +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y
Sbjct  46   AYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYY  104

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKF HP
Sbjct  105  LKTGTCKFGATCKFHHP  121



>ref|XP_009337999.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Pyrus x bretschneideri]
Length=443

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQQ T GNSQ YG S   E  N GSQG    Y +G++P+G+YALQRENVFPERPGQPE
Sbjct  249  PESQQQTAGNSQMYGTSHQGEPENSGSQGGFSPYSSGSIPVGFYALQRENVFPERPGQPE  308

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  309  CQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGP  368

Query  344  SCKFDHPMGVFTYNI  300
            SCKF+HPMG+FT N+
Sbjct  369  SCKFNHPMGIFTLNL  383


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGMAGRVALNILGYPL  140

Query  404  RP-GEPLCAFYSRYGICKFGPSCKFDHP  324
            RP  E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPQNEVECAYYLRTGQCKFGSTCKFHHP  168


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
             +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y
Sbjct  46   AYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYY  104

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKF HP
Sbjct  105  LKTGTCKFGATCKFHHP  121



>ref|XP_008355849.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=442

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PE QQ T GNSQ YG S+  E  N GSQG    Y +G++P+G+YALQRENVFPERPGQPE
Sbjct  248  PEGQQQTAGNSQMYGTSQQGEPENSGSQGGFSPYGSGSIPVGFYALQRENVFPERPGQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFG VC+FHHPRERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  308  CQFYMKTGDCKFGGVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGP  367

Query  344  SCKFDHPMGVFTYNI  300
            SCKF+HPMG+FTYN+
Sbjct  368  SCKFNHPMGIFTYNL  382


 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGXVALNILGYPL  140

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  264
            RP E  CA+Y R G CKFG +CKF HP       +S   +T  PTV+
Sbjct  141  RPNEVECAYYLRTGQCKFGSTCKFHHPQPT-NMMVSVGGSTVYPTVQ  186


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  47   YPERAGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>gb|KJB82176.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=407

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T  N Q +G SR +E A  GSQ      R+ ++P+G YALQRENVFPERPG+PEC
Sbjct  214  ENLQQTNVNHQIHGTSRQNESATAGSQASFSELRSSSVPVGVYALQRENVFPERPGEPEC  273

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  274  QFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  333

Query  341  CKFDHPMGVFTYNISPSSTTNAPT  270
            CKF+HPMG+FTYN SPSS ++AP 
Sbjct  334  CKFNHPMGIFTYNYSPSSPSDAPV  357


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 55/105 (52%), Gaps = 16/105 (15%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEP------  390
            +PERPG+P+C +Y++TG C+FGA C F+HP  R      +       P R G+P      
Sbjct  52   YPERPGEPDCSYYIRTGLCRFGATCHFNHPPNR-KLAIAAARMKGEFPERVGQPECQNET  110

Query  389  LCAFYSRYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  282
             CA+Y R G CKFG +CKF HP          G   Y   PS TT
Sbjct  111  ECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPIYQTVPSPTT  155


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 6/48 (13%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQ------FYMKTGDCKFGAVCKFHHPR  459
            +   A + +  FPER GQPECQ      +Y++TG CKFG+ CKFHHP+
Sbjct  86   LAIAAARMKGEFPERVGQPECQNETECAYYLRTGQCKFGSTCKFHHPQ  133



>gb|KEH23393.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=408

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+ N Q YG S   +  N G QG+   YR+G++P+G+YALQREN+FPERP QPEC
Sbjct  215  DSPQQTMRNDQTYGTSHQGDPENAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPEC  274

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPS
Sbjct  275  QFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPS  334

Query  341  CKFDHPMGVFTYNISPSSTTNA  276
            CKFDHPMG+FTYN+S S    A
Sbjct  335  CKFDHPMGIFTYNVSASPLAEA  356


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA C+FHHP+++        L+ +G PLRP E  CA+Y 
Sbjct  62   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  121

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  122  RTGQCKFGNTCKFHHP  137


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  17   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +C+F HP
Sbjct  76   KTGTCKFGATCRFHHP  91


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  108  YPLRPNESECAYYLRTGQCKFGNTCKFHHPQ  138



>ref|XP_003624157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES80375.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=418

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+ N Q YG S   +  N G QG+   YR+G++P+G+YALQREN+FPERP QPEC
Sbjct  225  DSPQQTMRNDQTYGTSHQGDPENAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPEC  284

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPS
Sbjct  285  QFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPS  344

Query  341  CKFDHPMGVFTYNISPSSTTNA  276
            CKFDHPMG+FTYN+S S    A
Sbjct  345  CKFDHPMGIFTYNVSASPLAEA  366


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA C+FHHP+++        L+ +G PLRP E  CA+Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  131

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQYYL  85

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +C+F HP
Sbjct  86   KTGTCKFGATCRFHHP  101


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  118  YPLRPNESECAYYLRTGQCKFGNTCKFHHPQ  148



>gb|KJB75170.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=401

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GN+Q YG SR +E A+ GSQ +   +R+G+ P+G+YALQRENVFPERPG+ EC
Sbjct  208  ENLQQTNGNNQIYGTSRPNESASAGSQALFSQFRSGSAPVGFYALQRENVFPERPGELEC  267

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  268  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPLRPGEPLCIFYSRYGICKFGPS  327

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKF+HPMGVFT+N S SS   AP  R
Sbjct  328  CKFNHPMGVFTFNYSASSPFEAPVHR  353


 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  51   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYL  110

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  111  RTGQCKFGSTCKFHHP  126


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  6    YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAITTARMKGEFPERVGQPECQYYL  64

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  65   KTGTCKFGATCKFHHP  80



>gb|ABD28369.2| Zinc finger, CCCH-type; Sugar transporter superfamily [Medicago 
truncatula]
Length=428

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+ N Q YG S   +  N G QG+   YR+G++P+G+YALQREN+FPERP QPEC
Sbjct  235  DSPQQTMRNDQTYGTSHQGDPENAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPEC  294

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPS
Sbjct  295  QFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPS  354

Query  341  CKFDHPMGVFTYNISPSSTTNA  276
            CKFDHPMG+FTYN+S S    A
Sbjct  355  CKFDHPMGIFTYNVSASPLAEA  376


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 10/86 (12%)
 Frame = -2

Query  551  FPERPGQPECQ----------FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            FPER GQPECQ          +Y+KTG CKFGA C+FHHP+++        L+ +G PLR
Sbjct  72   FPERLGQPECQASVNECCIMHYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLR  131

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHP  324
            P E  CA+Y R G CKFG +CKF HP
Sbjct  132  PNESECAYYLRTGQCKFGNTCKFHHP  157


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 11/86 (13%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA---  381
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C    
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQASV  85

Query  380  -------FYSRYGICKFGPSCKFDHP  324
                   +Y + G CKFG +C+F HP
Sbjct  86   NECCIMHYYLKTGTCKFGATCRFHHP  111


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  128  YPLRPNESECAYYLRTGQCKFGNTCKFHHPQ  158



>sp|Q9SWF9.1|ZFNL_PEA RecName: Full=Zinc finger CCCH domain-containing protein ZFN-like 
[Pisum sativum]
 gb|AAD45720.1| zinc finger protein [Pisum sativum]
Length=417

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES Q T+ N Q YG S   E+ N G QG    YR+G++P+G+YALQR+N+FPERP QPEC
Sbjct  225  ESPQQTMRNDQTYGTSHQGELENAGLQGAYSQYRSGSVPVGFYALQRDNIFPERPDQPEC  284

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  285  QFYMKTGDCKFGAVCRFHHPRERQIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  344

Query  341  CKFDHPMGVFTYNIS  297
            CKFDHPMG+FTYN++
Sbjct  345  CKFDHPMGIFTYNVA  359


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA C+FHHP+++        L+ +G PLRP E   A+Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESERAYYL  131

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQYYL  85

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +C+F HP
Sbjct  86   KTGTCKFGATCRFHHP  101



>gb|EYU39704.1| hypothetical protein MIMGU_mgv1a0076882mg [Erythranthe guttata]
Length=398

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQQ T GN Q+ G S+     N GSQ     + +G++PMGYYA QR+NVFPERPGQPEC
Sbjct  210  ESQQPTTGNGQSDGASQQGGSRNTGSQ-----FHSGSVPMGYYAFQRDNVFPERPGQPEC  264

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFG VCKFHHPRERL+P PD +LSPIGLPLR GEPLC FYSRYGICKFGPS
Sbjct  265  QFYMKTGDCKFGTVCKFHHPRERLMPVPDCVLSPIGLPLRTGEPLCVFYSRYGICKFGPS  324

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VF YN + S +T++P +RHF
Sbjct  325  CKFDHPMRVFAYNAAASPSTDSPAIRHF  352


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQ ECQ+Y+KTG CKFGA CKF HPRE+        L+ +G P+R  E  CA+Y 
Sbjct  59   YPERMGQSECQYYLKTGTCKFGATCKFDHPREKAGIAGRVALNVLGYPIRANEMECAYYM  118

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  119  RNGQCKFGSTCKFHHP  134


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
            ++P R  +P+C +Y++TG C+FGA C+F+HP  R      +       P R G+  C +Y
Sbjct  13   LYPVREDEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATAKMKGEYPERMGQSECQYY  71

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKFDHP
Sbjct  72   LKTGTCKFGATCKFDHP  88



>gb|KJB75168.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=444

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GN+Q YG SR +E A+ GSQ +   +R+G+ P+G+YALQRENVFPERPG+ EC
Sbjct  251  ENLQQTNGNNQIYGTSRPNESASAGSQALFSQFRSGSAPVGFYALQRENVFPERPGELEC  310

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  311  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPLRPGEPLCIFYSRYGICKFGPS  370

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKF+HPMGVFT+N S SS   AP  R
Sbjct  371  CKFNHPMGVFTFNYSASSPFEAPVHR  396


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  94   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYL  153

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  154  RTGQCKFGSTCKFHHP  169


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  49   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAITTARMKGEFPERVGQPECQYYL  107

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  108  KTGTCKFGATCKFHHP  123



>gb|KJB82177.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=447

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T  N Q +G SR +E A  GSQ      R+ ++P+G YALQRENVFPERPG+PEC
Sbjct  254  ENLQQTNVNHQIHGTSRQNESATAGSQASFSELRSSSVPVGVYALQRENVFPERPGEPEC  313

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  314  QFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  373

Query  341  CKFDHPMGVFTYNISPSSTTNAPT  270
            CKF+HPMG+FTYN SPSS ++AP 
Sbjct  374  CKFNHPMGIFTYNYSPSSPSDAPV  397


 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  86   LAIAAARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPL  145

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  282
            RP E  CA+Y R G CKFG +CKF HP          G   Y   PS TT
Sbjct  146  RPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPIYQTVPSPTT  195


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C F+HP  R      +       P R G+P C +Y 
Sbjct  52   YPERPGEPDCSYYIRTGLCRFGATCHFNHPPNR-KLAIAAARMKGEFPERVGQPECQYYL  110

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  111  KTGTCKFGATCKFHHP  126



>ref|XP_011084651.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Sesamum indicum]
Length=425

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+Q    GNSQ  G S  +E  + G+Q     + +G+LPMGYYA QR+NVFPERPGQPEC
Sbjct  237  ENQHPAAGNSQKDGGSLQNETGDAGTQ-----FHSGSLPMGYYAFQRDNVFPERPGQPEC  291

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  292  QFYMKTGDCKFGAVCKFHHPRERLIPVPDCILSPIGLPLRPGEPLCVFYSRYGICKFGPS  351

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VF YN   SS+T++P +R F
Sbjct  352  CKFDHPMTVFGYNAGASSSTDSPAIRRF  379


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQ ECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  86   YPERIGQSECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNEIECAYYM  145

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  146  RNGQCKFGSTCKFHHP  161


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P R G+P+C +Y++TG C+FG+ C+F+HP  R      +       P R G+  C +Y 
Sbjct  41   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNR-KLAIATARMKGEYPERIGQSECQYYL  99

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  100  KTGTCKFGATCKFHHP  115


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +YM+ G CKFG+ CKFHHP+
Sbjct  132  YPLRPNEIECAYYMRNGQCKFGSTCKFHHPQ  162



>gb|KJB26822.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=370

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GN+Q YG S  +E    GSQ     +R+G++P+G+YAL RENVFPERPGQPEC
Sbjct  177  ENLQQTNGNNQIYGTSNQNESVTGGSQASFSQFRSGSVPIGFYALPRENVFPERPGQPEC  236

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+ P PD LLSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  237  QFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGPS  296

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKF+HPMG+FTYN S SS + AP V H 
Sbjct  297  CKFNHPMGIFTYNYSISSPSGAP-VHHL  323


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G P RP E
Sbjct  16   AARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNE  75

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
              CA+Y R G CKFG +CKF HP
Sbjct  76   TECAYYLRTGQCKFGSTCKFHHP  98


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  69   YPFRPNETECAYYLRTGQCKFGSTCKFHHPQ  99



>ref|XP_009416576.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=368

 Score =   191 bits (484),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQ+ T G +Q YG S+  E + +G+QG  PSYR G+ PMG YA+  EN+FPERPGQPE
Sbjct  174  PESQR-TTGTAQFYGPSQQGETS-IGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPE  231

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHP+ERL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP
Sbjct  232  CQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGP  291

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG F Y +S SS T  PT  H 
Sbjct  292  NCKFDHPMGTFAYGVSASSATGVPTAWHL  320


 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA+CKFHHP+E+        L+ +G PLR  E  CA+Y 
Sbjct  18   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  77

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  78   RTGECKFGGTCKFHHP  93



>ref|XP_006606434.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Glycine max]
Length=356

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q  + N Q Y  S   E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPEC
Sbjct  162  DSPQQAMRNGQTYETSHQGELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPEC  221

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFY+KTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPS
Sbjct  222  QFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPS  281

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPM +F+YNI+ S + +AP+ RH LGSSSGT  L LSSEG
Sbjct  282  CKFDHPMEIFSYNITTSPSADAPS-RHLLGSSSGTAALNLSSEG  324


 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PLRP EP C +Y 
Sbjct  5    FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  64

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  65   RTGQCKFGNTCKFHHP  80


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG  CKFHHP+
Sbjct  51   YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  81



>ref|XP_009416575.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=393

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQ+ T G +Q YG S+  E + +G+QG  PSYR G+ PMG YA+  EN+FPERPGQPE
Sbjct  199  PESQR-TTGTAQFYGPSQQGETS-IGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPE  256

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHP+ERL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP
Sbjct  257  CQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGP  316

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG F Y +S SS T  PT  H 
Sbjct  317  NCKFDHPMGTFAYGVSASSATGVPTAWHL  345


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = -2

Query  638  ANVGSQGMNPSYRAGTLPMGYYALQRENV------FPERPGQPECQFYMKTGDCKFGAVC  477
            A   ++G + S + GT     +   RE+       +PERPG+P+C +Y++TG C+FG  C
Sbjct  12   ARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRTGLCRFGRTC  71

Query  476  KFHHPRERlipppdsllspigl-pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            KF+HP  R++    +     G  P R G+P C +Y + G CKFG  CKF HP
Sbjct  72   KFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHP  123


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRER  453
            +PER GQPECQ+Y+KTG CKFGA+CKFHHP+E+
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEK  126



>gb|KHG30243.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=347

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GN+Q YG S  +E    GSQ     +R+G++P+G+YAL RENVFPERPGQPEC
Sbjct  154  ENLQQTNGNNQIYGTSNQNESVTGGSQASFSQFRSGSVPIGFYALPRENVFPERPGQPEC  213

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+ P PD LLSPIGLPLRPGEPLC FYSRYGICKFG S
Sbjct  214  QFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGSS  273

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKF+HPMG+FTYN S SS + AP V HF
Sbjct  274  CKFNHPMGIFTYNYSISSPSGAP-VHHF  300


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            ++Y+KTG CKFGA CKFHHPRE+        L+ +G P RP E  CA+Y R G CKFG +
Sbjct  10   RYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNETECAYYLRTGQCKFGST  69

Query  341  CKFDHP  324
            CKF HP
Sbjct  70   CKFHHP  75


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  46   YPFRPNETECAYYLRTGQCKFGSTCKFHHPQ  76



>gb|KHN14776.1| Zinc finger CCCH domain-containing protein ZFN-like, partial 
[Glycine soja]
Length=405

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 3/164 (2%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q  + N Q YG SR  E+A  GSQG    +R+GT+P+G+Y LQREN+FPERPGQPEC
Sbjct  214  DSPQQAMRNGQTYGTSRQGELA--GSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPEC  271

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHP+ERL+P P+ +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  272  QFYMKTGDCKFGAVCRFHHPQERLVPAPNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  331

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPM +F++NIS S + +AP+ RH LGSSSGT  L LSSEG
Sbjct  332  CKFDHPMEIFSHNISASPSADAPS-RHLLGSSSGTAALNLSSEG  374


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ   +T  CKFGA CKFHHP+++        L+ +G PLRP EP C +Y 
Sbjct  66   FPERIGQPECQACTRT--CKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  123

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  124  RTGQCKFGNTCKFHHP  139


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG  CKFHHP+
Sbjct  110  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  140



>gb|KJB26823.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=449

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GN+Q YG S  +E    GSQ     +R+G++P+G+YAL RENVFPERPGQPEC
Sbjct  256  ENLQQTNGNNQIYGTSNQNESVTGGSQASFSQFRSGSVPIGFYALPRENVFPERPGQPEC  315

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER+ P PD LLSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  316  QFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGPS  375

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKF+HPMG+FTYN S SS + AP V H L SSSGT  L LSSEG
Sbjct  376  CKFNHPMGIFTYNYSISSPSGAP-VHHLLESSSGTSGLNLSSEG  418


 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G P 
Sbjct  91   LAIAAARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPF  150

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  151  RPNETECAYYLRTGQCKFGSTCKFHHP  177


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  57   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERVGQPECQYYL  115

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  116  KTGTCKFGATCKFHHP  131


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  148  YPFRPNETECAYYLRTGQCKFGSTCKFHHPQ  178



>gb|ACC85690.1| zinc finger protein [Medicago sativa]
 gb|AFP86282.1| zinc finger protein [Medicago sativa]
Length=418

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q T+ N Q YG S   +  N G  G+   YR+G++P+G+YALQREN+FPERP QPEC
Sbjct  225  DSPQQTMRNDQTYGTSHQGDPENAGLPGVYSQYRSGSVPVGFYALQRENIFPERPDQPEC  284

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPS
Sbjct  285  QFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPS  344

Query  341  CKFDHPMGVFTYNISPSSTTNA  276
            CKFDHPMG+FTYN+S S    A
Sbjct  345  CKFDHPMGIFTYNVSASPLAEA  366


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA C+FHHP+++        L+ +G PLRP E  CA+Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  131

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE PG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQYYL  85

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +C+F HP
Sbjct  86   KTGTCKFGATCRFHHP  101


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  118  YPLRPNESECAYYLRTGQCKFGNTCKFHHPQ  148



>ref|XP_003536159.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Glycine max]
Length=421

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 3/164 (2%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q  + N Q YG SR  E+A  GSQG    +R+GT+P+G+Y LQREN+FPERPGQPEC
Sbjct  230  DSPQQAMRNGQTYGTSRQGELA--GSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPEC  287

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHP+ERL+P P+ +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  288  QFYMKTGDCKFGAVCRFHHPQERLVPAPNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  347

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPM +F++NIS S + +AP+ RH LGSSSGT  L LSSEG
Sbjct  348  CKFDHPMEIFSHNISASPSADAPS-RHLLGSSSGTAALNLSSEG  390


 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PLRP EP C +Y 
Sbjct  80   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  139

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  140  RTGQCKFGNTCKFHHP  155


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +YM+TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  35   YPERPGEPDCSYYMRTGLCRFGATCRFNHPPNR-KLAIATARMIGEFPERIGQPECQYYL  93

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  94   KTGTCKFGATCKFHHP  109


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG  CKFHHP+
Sbjct  126  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  156



>gb|KHN04981.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=428

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q  + N Q Y  S   E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPEC
Sbjct  234  DSPQQAMRNGQTYETSHQGELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPEC  293

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFY+KTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPS
Sbjct  294  QFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPS  353

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPM +F+YNI+ S + +AP+ RH LGSSSGT  L LSSEG
Sbjct  354  CKFDHPMEIFSYNITASPSADAPS-RHLLGSSSGTAALNLSSEG  396


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ   +T  CKFGA CKFHHP+++        L+ +G PLRP EP C +Y 
Sbjct  79   FPERIGQPECQARTRT--CKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  136

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  137  RTGQCKFGNTCKFHHP  152


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG  CKFHHP+
Sbjct  123  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  153



>ref|XP_006606433.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=430

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +S Q  + N Q Y  S   E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPEC
Sbjct  236  DSPQQAMRNGQTYETSHQGELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPEC  295

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFY+KTGDCKFGAVC+FHHPRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPS
Sbjct  296  QFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPS  355

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHFlgsssgtgtltlsSEG  210
            CKFDHPM +F+YNI+ S + +AP+ RH LGSSSGT  L LSSEG
Sbjct  356  CKFDHPMEIFSYNITTSPSADAPS-RHLLGSSSGTAALNLSSEG  398


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PLRP EP C +Y 
Sbjct  79   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  138

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  139  RTGQCKFGNTCKFHHP  154


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  34   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-RLAIATARMIGEFPERIGQPECQYYL  92

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  93   KTGTCKFGATCKFHHP  108


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP +PEC +Y++TG CKFG  CKFHHP+
Sbjct  125  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  155



>ref|XP_009416573.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQ+ T G +Q YG S+  E + +G+QG  PSYR G+ PMG YA+  EN+FPERPGQPE
Sbjct  250  PESQR-TTGTAQFYGPSQQGETS-IGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHP+ERL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP
Sbjct  308  CQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGP  367

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG F Y +S SS T  PT  H 
Sbjct  368  NCKFDHPMGTFAYGVSASSATGVPTAWHL  396


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA+CKFHHP+E+        L+ +G PLR  E  CA+Y 
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  153

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  154  RTGECKFGGTCKFHHP  169


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = -2

Query  638  ANVGSQGMNPSYRAGTLPMGYYALQRENV------FPERPGQPECQFYMKTGDCKFGAVC  477
            A   ++G + S + GT     +   RE+       +PERPG+P+C +Y++TG C+FG  C
Sbjct  12   ARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRTGLCRFGRTC  71

Query  476  KFHHPRERlipppdsllspigl-pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            KF+HP  R++    +     G  P R G+P C +Y + G CKFG  CKF HP
Sbjct  72   KFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHP  123



>ref|XP_009416574.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=442

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQ+ T G +Q YG S+  E + +G+QG  PSYR G+ PMG YA+  EN+FPERPGQPE
Sbjct  248  PESQR-TTGTAQFYGPSQQGETS-IGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPE  305

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHP+ERL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP
Sbjct  306  CQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGP  365

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG F Y +S SS T  PT  H 
Sbjct  366  NCKFDHPMGTFAYGVSASSATGVPTAWHL  394


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA+CKFHHP+E+        L+ +G PLR  E  CA+Y 
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  153

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  154  RTGECKFGGTCKFHHP  169


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = -2

Query  638  ANVGSQGMNPSYRAGTLPMGYYALQRENV------FPERPGQPECQFYMKTGDCKFGAVC  477
            A   ++G + S + GT     +   RE+       +PERPG+P+C +Y++TG C+FG  C
Sbjct  12   ARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRTGLCRFGRTC  71

Query  476  KFHHPRERlipppdsllspigl-pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            KF+HP  R++    +     G  P R G+P C +Y + G CKFG  CKF HP
Sbjct  72   KFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHP  123



>ref|XP_010038283.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Eucalyptus grandis]
 gb|KCW84569.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=429

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +SQ + +G SQ +G S  S+  N GS G   SY++G++P+G+YALQR+N+FPERPGQPEC
Sbjct  243  DSQLIMMGQSQIFGSSGQSDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPEC  302

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+P PD LLSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  303  QFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPS  362

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG+   N+S SS + AP  R  
Sbjct  363  CKFDHPMGILN-NLSASSPSGAPVRRML  389


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G P RP E  CA+Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP +R      +       P R G+P C +Y 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDR-KLAIANARMKGEYPERVGQPECQYYL  100

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  101  KTGTCKFGATCKFHHP  116


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQ  163



>gb|KCW84568.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=419

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +SQ + +G SQ +G S  S+  N GS G   SY++G++P+G+YALQR+N+FPERPGQPEC
Sbjct  233  DSQLIMMGQSQIFGSSGQSDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPEC  292

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRERL+P PD LLSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPS  352

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG+   N+S SS + AP  R  
Sbjct  353  CKFDHPMGILN-NLSASSPSGAPVRRML  379


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G P RP E  CA+Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP +R      +       P R G+P C +Y 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDR-KLAIANARMKGEYPERVGQPECQYYL  100

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  101  KTGTCKFGATCKFHHP  116


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQ  163



>ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
 gb|EOY09894.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
Length=411

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+   T GN+Q YG +  +E A  GSQ     +R+G++P+G+YALQRENVFPERPGQPEC
Sbjct  219  ENLLQTNGNNQ-YGTTHQNESATAGSQASFSQFRSGSVPVGFYALQRENVFPERPGQPEC  277

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFG VC+FHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  278  QFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  337

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKF+HPMG+FTYN S SS ++AP  R
Sbjct  338  CKFNHPMGIFTYNYSTSSPSDAPVHR  363


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  51   LAIAAARMKGEFPERAGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPL  110

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  282
            RP EP CA+Y R G CKFG +CKF HP          G   Y   PS TT
Sbjct  111  RPNEPECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVRGSPIYQTVPSPTT  160



>ref|XP_009392482.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=362

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P SQQ T G +Q Y  S+  E  N+G+QG   SYR G++ MG YA+ REN+FPERPGQPE
Sbjct  169  PGSQQ-TAGVAQFYSPSQQGET-NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPE  226

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  227  CQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGP  286

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG  TY +S SS  + PTV+H 
Sbjct  287  NCKFDHPMGPVTYGLSESSMADVPTVQHL  315


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG+ CKFHHP+E+      + L+ +G PLRP E  CA+Y 
Sbjct  13   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  72

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CK+ HP
Sbjct  73   RTGECKFGSTCKYHHP  88


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG+CKFG+ CK+HHP+
Sbjct  59   YPLRPNEQECAYYIRTGECKFGSTCKYHHPQ  89



>ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
 gb|EOY09893.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
Length=451

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+   T GN+Q YG +  +E A  GSQ     +R+G++P+G+YALQRENVFPERPGQPEC
Sbjct  259  ENLLQTNGNNQ-YGTTHQNESATAGSQASFSQFRSGSVPVGFYALQRENVFPERPGQPEC  317

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFG VC+FHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  318  QFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  377

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKF+HPMG+FTYN S SS ++AP  R
Sbjct  378  CKFNHPMGIFTYNYSTSSPSDAPVHR  403


 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PL
Sbjct  91   LAIAAARMKGEFPERAGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPL  150

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  282
            RP EP CA+Y R G CKFG +CKF HP          G   Y   PS TT
Sbjct  151  RPNEPECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVRGSPIYQTVPSPTT  200



>ref|XP_008810537.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=472

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 121/153 (79%), Gaps = 5/153 (3%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMN----PSYRAGTLPMGYYALQRENVFPERP  537
            P+SQQ  +G ++ Y  SR SE +  G+QG       SYR G++PMG YALQREN+FPERP
Sbjct  249  PKSQQEILGVAEYYSTSRQSETS-AGAQGTLGDRFSSYRLGSIPMGVYALQRENIFPERP  307

Query  536  GQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGIC  357
             QPECQFYMKTGDCKFG  C+FHHPRERL+P P+ +LSP+GLPLRPGEPLC FYSRYGIC
Sbjct  308  DQPECQFYMKTGDCKFGPACRFHHPRERLMPVPNCILSPLGLPLRPGEPLCIFYSRYGIC  367

Query  356  KFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            KFGP+CKFDHPMG F Y ++ SST + PT+RH 
Sbjct  368  KFGPNCKFDHPMGTFAYGLATSSTADVPTIRHL  400


 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        LS +G PLRP E  CA+Y 
Sbjct  92   YPERVGQPECQYYLKTGSCKFGATCKFHHPKDKAGIVGRVKLSILGYPLRPNEKECAYYL  151

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  152  RTGQCKFGNTCKFHHP  167


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +YM+TG C+FG  CKF+HP  R      +       P R G+P C +Y 
Sbjct  47   YPERPGEPDCAYYMRTGLCRFGMTCKFNHPPNR-KMAIAAARIRGAYPERVGQPECQYYL  105

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  106  KTGSCKFGATCKFHHP  121


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  138  YPLRPNEKECAYYLRTGQCKFGNTCKFHHPQ  168



>ref|XP_009392483.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=359

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P SQQ T G +Q Y  S+  E  N+G+QG   SYR G++ MG YA+ REN+FPERPGQPE
Sbjct  166  PGSQQ-TAGVAQFYSPSQQGET-NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPE  223

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  224  CQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGP  283

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG  TY +S SS  + PTV+H 
Sbjct  284  NCKFDHPMGPVTYGLSESSMADVPTVQHL  312


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P+RPG+P+C +Y++TG C+FG  CKF+HP+ R +    +     G P R G+P C +Y 
Sbjct  17   YPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNR-MLAIAAARIRGGYPERVGQPECQYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGSTCKFHHP  91


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRER  453
            +PER GQPECQ+Y+KTG CKFG+ CKFHHP+E+
Sbjct  62   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEK  94



>ref|XP_009392481.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=371

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P SQQ T G +Q Y  S+  E  N+G+QG   SYR G++ MG YA+ REN+FPERPGQPE
Sbjct  178  PGSQQ-TAGVAQFYSPSQQGET-NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPE  235

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  236  CQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGP  295

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG  TY +S SS  + PTV+H 
Sbjct  296  NCKFDHPMGPVTYGLSESSMADVPTVQHL  324


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG+ CKFHHP+E+      + L+ +G PLRP E  CA+Y 
Sbjct  22   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  81

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CK+ HP
Sbjct  82   RTGECKFGSTCKYHHP  97


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG+CKFG+ CK+HHP+
Sbjct  68   YPLRPNEQECAYYIRTGECKFGSTCKYHHPQ  98



>ref|XP_009392477.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392478.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392479.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392480.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P SQQ T G +Q Y  S+  E  N+G+QG   SYR G++ MG YA+ REN+FPERPGQPE
Sbjct  218  PGSQQ-TAGVAQFYSPSQQGET-NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPE  275

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVC+FHHPRERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  276  CQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGP  335

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDHPMG  TY +S SS  + PTV+H 
Sbjct  336  NCKFDHPMGPVTYGLSESSMADVPTVQHL  364


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG+ CKFHHP+E+      + L+ +G PLRP E  CA+Y 
Sbjct  62   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  121

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CK+ HP
Sbjct  122  RTGECKFGSTCKYHHP  137


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P+RPG+P+C +Y++TG C+FG  CKF+HP+ R +    +     G P R G+P C +Y 
Sbjct  17   YPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNR-MLAIAAARIRGGYPERVGQPECQYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGSTCKFHHP  91


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG+CKFG+ CK+HHP+
Sbjct  108  YPLRPNEQECAYYIRTGECKFGSTCKYHHPQ  138



>ref|XP_006662931.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Oryza brachyantha]
Length=407

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR SE   +G QGM  SY+AG++P+G Y +QRE++FPERP QPEC
Sbjct  218  DDQQRTAGGAQYYTSSRHSETPTMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPEC  277

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHP+ER++P P+  LS +GLPLRPGEP+C FYSRYGICKFGP+
Sbjct  278  QFYMKTGDCKFGAVCKFHHPKERIVPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  337

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG   Y ++ S T +  T R  
Sbjct  338  CKFDHPMGTVMYGLATSPTGDMSTARRM  365


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  49   MAVAAARMKGEYPQRIGQPECQYYLKTGACKFGATCKFHHPREKAAMATRVQLNALGYPL  108

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  109  RPNEKECAYYLRTGQCKFGSTCKFHHP  135


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  15   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  73

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  74   KTGACKFGATCKFHHP  89


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  106  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQ  136



>gb|ABG22481.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EEC68139.1| hypothetical protein OsI_36059 [Oryza sativa Indica Group]
Length=406

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPEC
Sbjct  218  DDQQRTAGGAQYYTGSRHSETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPEC  277

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHP+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+
Sbjct  278  QFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  337

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG   Y ++ S T +    R  
Sbjct  338  CKFDHPMGTVMYGLATSPTGDVSARRML  365


 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  49   MAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPL  108

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  109  RPNEKECAYYLRTGQCKFGSTCKFHHP  135


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  15   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  73

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  74   KTGTCKFGATCKFHHP  89


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  106  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQ  136



>ref|XP_002450713.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
 gb|EES09701.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
Length=446

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR S  A +G QGM  SY+AG++P+G YA+QRENVFPERP QPEC
Sbjct  257  DDQQRTPGAAQYYTGSRQSGTAGIGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPEC  316

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+
Sbjct  317  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  376

Query  341  CKFDHPMGVFTYNISPSSTTNAPT  270
            CKFDHPMG   Y  + S T+ APT
Sbjct  377  CKFDHPMGSAMYGHASSPTSEAPT  400


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  88   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  147

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R  E  CA+Y R G CKFG +CKF HP
Sbjct  148  RANEKECAYYLRTGQCKFGSTCKFHHP  174


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  54   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  112

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  113  KTGTCKFGATCKFHHP  128



>ref|NP_001067878.1| Os11g0472000 [Oryza sativa Japonica Group]
 dbj|BAF28241.1| Os11g0472000, partial [Oryza sativa Japonica Group]
Length=414

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPEC
Sbjct  226  DDQQRTAGGAQYYTGSRHSETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPEC  285

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHP+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+
Sbjct  286  QFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  345

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG   Y ++ S T +    R  
Sbjct  346  CKFDHPMGTVMYGLATSPTGDVSARRML  373


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  57   MAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPL  116

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  117  RPNEKECAYYLRTGQCKFGSTCKFHHP  143


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  23   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  81

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  82   KTGTCKFGATCKFHHP  97


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  114  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQ  144



>sp|Q2R4J4.2|C3H63_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 63; 
Short=OsC3H63 [Oryza sativa Japonica Group]
 gb|ABA93650.2| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|AGT38442.1| zinc finger protein [Oryza sativa Japonica Group]
Length=444

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPEC
Sbjct  256  DDQQRTAGGAQYYTGSRHSETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPEC  315

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHP+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+
Sbjct  316  QFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  375

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG   Y ++ S T +    R  
Sbjct  376  CKFDHPMGTVMYGLATSPTGDVSARRML  403


 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  87   MAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPL  146

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  147  RPNEKECAYYLRTGQCKFGSTCKFHHP  173


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  53   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  111

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  112  KTGTCKFGATCKFHHP  127


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  144  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQ  174



>gb|EEE52080.1| hypothetical protein OsJ_33853 [Oryza sativa Japonica Group]
Length=529

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPEC
Sbjct  341  DDQQRTAGGAQYYTGSRHSETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPEC  400

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHP+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+
Sbjct  401  QFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  460

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVR  264
            CKFDHPMG   Y ++ S T +    R
Sbjct  461  CKFDHPMGTVMYGLATSPTGDVSARR  486


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  172  MAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPL  231

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  232  RPNEKECAYYLRTGQCKFGSTCKFHHP  258


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  138  YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  196

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  197  KTGTCKFGATCKFHHP  212


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  229  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQ  259



>ref|XP_009406323.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PESQQ T+G +Q Y   +  E +  G+ G  PSYR G +P+G YA+ REN+FPERPGQPE
Sbjct  218  PESQQ-TIGTAQFYSAPQQGETS-TGAHGKFPSYRPGPVPVGMYAVPRENIFPERPGQPE  275

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHPRERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP
Sbjct  276  CQFYMKTGDCKFGAVCKFHHPRERLVPVPNCVLSPLGLPLRPGEPLCDFYSRYGICKFGP  335

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            +CK+DHP+  +TY +S SS    PT  H 
Sbjct  336  NCKYDHPIRTYTYGLSASSMAEVPTAWHL  364


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  62   YPERVGQPECQYYLKTGTCKFGATCKFHHPREKAGISEQVQLNILGYPLRPNEKECAYYL  121

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  122  RTGECKFGSTCKFHHP  137


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG  CKF+HP  R +    +     G P R G+P C +Y 
Sbjct  17   YPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNR-MLAVAATSIRGGYPERVGQPECQYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGATCKFHHP  91


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG+CKFG+ CKFHHP+
Sbjct  108  YPLRPNEKECAYYLRTGECKFGSTCKFHHPQ  138



>ref|XP_003576637.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Brachypodium distachyon]
Length=442

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+ QQ T G +  Y  SR SE   +G  GM PSY+AG++P+G YA+Q +NVFPERP QPE
Sbjct  251  PDDQQRTPGTTHYYSGSRQSETTGMGDHGMFPSYQAGSVPLGVYAVQGDNVFPERPDQPE  310

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKF+HP+ER+IP P+  LSP+GLPLRPGEP+C FYSRYGICKFGP
Sbjct  311  CQFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGP  370

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRH  261
            +CKFDHPMG   Y    S T++ PT+ +
Sbjct  371  NCKFDHPMGTVMYGSVTSPTSDVPTLHY  398


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A +    +P R GQPECQ+Y+KTG CKFGA CKFHHPRE+      + L+ +G PLRP E
Sbjct  87   AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNE  146

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
              CA+Y R G CKF  +CKF HP
Sbjct  147  KECAYYLRTGQCKFASTCKFHHP  169


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP  R      +       P R G+P C +Y 
Sbjct  49   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  107

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  108  KTGTCKFGATCKFHHP  123



>ref|XP_010237293.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Brachypodium distachyon]
Length=445

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+ QQ T G +  Y  SR SE   +G  GM PSY+AG++P+G YA+Q +NVFPERP QPE
Sbjct  254  PDDQQRTPGTTHYYSGSRQSETTGMGDHGMFPSYQAGSVPLGVYAVQGDNVFPERPDQPE  313

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKF+HP+ER+IP P+  LSP+GLPLRPGEP+C FYSRYGICKFGP
Sbjct  314  CQFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGP  373

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRH  261
            +CKFDHPMG   Y    S T++ PT+ +
Sbjct  374  NCKFDHPMGTVMYGSVTSPTSDVPTLHY  401


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A +    +P R GQPECQ+Y+KTG CKFGA CKFHHPRE+      + L+ +G PL
Sbjct  86   LAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPL  145

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKF  +CKF HP
Sbjct  146  RPNEKECAYYLRTGQCKFASTCKFHHP  172


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP  R      +       P R G+P C +Y 
Sbjct  52   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  110

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  111  KTGTCKFGATCKFHHP  126



>ref|XP_010927660.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927662.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927663.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=467

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 116/147 (79%), Gaps = 5/147 (3%)
 Frame = -2

Query  686  TVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMK  507
            T G  Q YG SR SE + VG QG   SYR+ + PMG YALQR+NVFPERP QPECQFYMK
Sbjct  261  TPGTVQMYGSSRPSETS-VGVQGTMSSYRSSSTPMGQYALQRDNVFPERPDQPECQFYMK  319

Query  506  TGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH  327
            TGDCKFGA CKFHHP+ERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDH
Sbjct  320  TGDCKFGAACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDH  379

Query  326  ----PMGVFTYNISPSSTTNAPTVRHF  258
                PMG+F Y++S S + +AP VR  
Sbjct  380  PMATPMGIFAYSLSTSLSADAPVVRRL  406


 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHP+++      + L+ +G P+RP E  CA+Y 
Sbjct  98   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNNLGYPIRPNEKECAYYL  157

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  158  RTGQCKFGNTCKFHHP  173


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
            ++PERPG+P+C +Y++TG C++G  C+++HP +R      +     G P R G+P C +Y
Sbjct  52   LYPERPGEPDCAYYLRTGLCRYGLTCRYNHPPDR-KLAIAAARIRGGYPERVGQPECQYY  110

Query  374  SRYGICKFGPSCKFDHP---MGVF  312
             + G CKFG +CKF HP    G+F
Sbjct  111  LKTGTCKFGATCKFHHPKDKAGIF  134


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  144  YPIRPNEKECAYYLRTGQCKFGNTCKFHHPQ  174



>ref|XP_004979251.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X1 [Setaria italica]
Length=450

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR S    +G QGM  SY+AG++P+G YA+QRENVFPERP QPEC
Sbjct  261  DDQQQTPGAAQYYTGSRQSGTPGMGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPEC  320

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER+IP P+  LS +GLPLRPGEP+C+FYSRYG+CKFGP+
Sbjct  321  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPN  380

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHP+G   +  + S T   PT R  
Sbjct  381  CKFDHPLGTVMFGHASSPTGEVPTSRRM  408


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G P 
Sbjct  92   LAVAAARMKGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPF  151

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  152  RPNEKECAYYLRTGQCKFGSTCKFHHP  178


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  58   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRSGQPECQYYL  116

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  117  KTGTCKFGATCKFHHP  132


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  149  YPFRPNEKECAYYLRTGQCKFGSTCKFHHPQ  179



>ref|XP_004979252.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X2 [Setaria italica]
Length=448

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR S    +G QGM  SY+AG++P+G YA+QRENVFPERP QPEC
Sbjct  259  DDQQQTPGAAQYYTGSRQSGTPGMGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPEC  318

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER+IP P+  LS +GLPLRPGEP+C+FYSRYG+CKFGP+
Sbjct  319  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPN  378

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHP+G   +  + S T   PT R  
Sbjct  379  CKFDHPLGTVMFGHASSPTGEVPTSRRM  406


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G P 
Sbjct  90   LAVAAARMKGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPF  149

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  150  RPNEKECAYYLRTGQCKFGSTCKFHHP  176


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  56   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRSGQPECQYYL  114

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  115  KTGTCKFGATCKFHHP  130


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  147  YPFRPNEKECAYYLRTGQCKFGSTCKFHHPQ  177



>ref|XP_008794629.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794630.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794631.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
Length=467

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 117/147 (80%), Gaps = 5/147 (3%)
 Frame = -2

Query  686  TVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMK  507
            T G  Q YG SR SE + +G QG   SYR+ + PMG YALQR++VFPERP QPECQFYMK
Sbjct  261  TPGTVQMYGSSRPSETS-MGVQGTISSYRSSSTPMGQYALQRDSVFPERPDQPECQFYMK  319

Query  506  TGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH  327
            TGDCKFGA CKFHHP+ERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDH
Sbjct  320  TGDCKFGAACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDH  379

Query  326  ----PMGVFTYNISPSSTTNAPTVRHF  258
                PMG+F Y++S SS+ +AP VR  
Sbjct  380  PMATPMGIFAYSLSTSSSADAPVVRRL  406


 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHP+++      + L+ +G P+RP E  CA+Y 
Sbjct  98   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNVLGYPIRPNEKECAYYL  157

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  158  RTGQCKFGNTCKFHHP  173


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 4/84 (5%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
            ++PERPG P+C +Y++TG C++G  C+++HP +R      +     G P R G+P C +Y
Sbjct  52   LYPERPGVPDCAYYLRTGLCRYGLTCRYNHPPDR-KLAIAAARIRGGYPERVGQPECQYY  110

Query  374  SRYGICKFGPSCKFDHP---MGVF  312
             + G CKFG +CKF HP    G+F
Sbjct  111  LKTGTCKFGATCKFHHPKDKAGIF  134


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  144  YPIRPNEKECAYYLRTGQCKFGNTCKFHHPQ  174



>ref|XP_008676804.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW60817.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=407

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T G +Q Y  SR S   ++G QGM  SY+AG++P+G YA+QREN+FPERP QPEC
Sbjct  218  EDQQRTPGAAQYYTGSRQSGT-SIGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPEC  276

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+
Sbjct  277  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  336

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG   Y  +PS  + AP  R  
Sbjct  337  CKFDHPMGNAMYGQAPSPASEAPAPRRM  364


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  49   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  108

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDH  327
            RP E  CA+Y R G CKFG +CKF H
Sbjct  109  RPNEKECAYYLRTGQCKFGSTCKFHH  134


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  15   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  73

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  74   KTGTCKFGATCKFHHP  89



>ref|NP_001141157.1| hypothetical protein [Zea mays]
 gb|ACF85576.1| unknown [Zea mays]
 gb|ACN34349.1| unknown [Zea mays]
 gb|AFT82654.1| C3H11 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW60815.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=443

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T G +Q Y  SR S   ++G QGM  SY+AG++P+G YA+QREN+FPERP QPEC
Sbjct  254  EDQQRTPGAAQYYTGSRQSGT-SIGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPEC  312

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+
Sbjct  313  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  372

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG   Y  +PS  + AP  R  
Sbjct  373  CKFDHPMGNAMYGQAPSPASEAPAPRRM  400


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  85   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  144

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDH  327
            RP E  CA+Y R G CKFG +CKF H
Sbjct  145  RPNEKECAYYLRTGQCKFGSTCKFHH  170


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  51   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  109

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  110  KTGTCKFGATCKFHHP  125



>ref|XP_008676803.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28340.1| unknown [Zea mays]
 gb|AFW60816.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=441

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E QQ T G +Q Y  SR S   ++G QGM  SY+AG++P+G YA+QREN+FPERP QPEC
Sbjct  252  EDQQRTPGAAQYYTGSRQSGT-SIGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPEC  310

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+
Sbjct  311  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  370

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG   Y  +PS  + AP  R  
Sbjct  371  CKFDHPMGNAMYGQAPSPASEAPAPRRM  398


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  83   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  142

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDH  327
            RP E  CA+Y R G CKFG +CKF H
Sbjct  143  RPNEKECAYYLRTGQCKFGSTCKFHH  168


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  49   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  107

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  108  KTGTCKFGATCKFHHP  123



>ref|XP_011077184.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077185.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077186.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
Length=417

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 117/148 (79%), Gaps = 8/148 (5%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+QQ   GN Q  G S   E  NVGSQ     + + TLP+GYYA +R+NVFPERPGQP+C
Sbjct  232  ENQQ---GNIQNDGTSYQVEGLNVGSQ-----FGSNTLPIGYYAFKRDNVFPERPGQPQC  283

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  284  QFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  343

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VF +N + S++T+   VR F
Sbjct  344  CKFDHPMRVFAHNAAASASTDGNAVRDF  371


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = -2

Query  593  TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspig  414
            TL +    ++ E  +PER GQPECQ+Y+KTG CKFGA CKFHHPR+ L       L+ +G
Sbjct  70   TLAIATARMKSE--YPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLG  127

Query  413  lpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             PLRP E  CA+Y R G+CKFG +CKF HP
Sbjct  128  YPLRPNEINCAYYIRNGLCKFGRTCKFHHP  157


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 12/108 (11%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P R G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  37   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNR-TLAIATARMKSEYPERIGQPECQYYL  95

Query  371  RYGICKFGPSCKFDHP-----------MGVFTYNISPSSTTNAPTVRH  261
            + G CKFG +CKF HP           + V  Y + P+    A  +R+
Sbjct  96   KTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYIRN  143



>ref|XP_011077187.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Sesamum indicum]
Length=407

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 117/148 (79%), Gaps = 8/148 (5%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+QQ   GN Q  G S   E  NVGSQ     + + TLP+GYYA +R+NVFPERPGQP+C
Sbjct  222  ENQQ---GNIQNDGTSYQVEGLNVGSQ-----FGSNTLPIGYYAFKRDNVFPERPGQPQC  273

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  274  QFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  333

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM VF +N + S++T+   VR F
Sbjct  334  CKFDHPMRVFAHNAAASASTDGNAVRDF  361


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = -2

Query  593  TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspig  414
            TL +    ++ E  +PER GQPECQ+Y+KTG CKFGA CKFHHPR+ L       L+ +G
Sbjct  60   TLAIATARMKSE--YPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLG  117

Query  413  lpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             PLRP E  CA+Y R G+CKFG +CKF HP
Sbjct  118  YPLRPNEINCAYYIRNGLCKFGRTCKFHHP  147


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 12/108 (11%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P R G+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  27   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNR-TLAIATARMKSEYPERIGQPECQYYL  85

Query  371  RYGICKFGPSCKFDHP-----------MGVFTYNISPSSTTNAPTVRH  261
            + G CKFG +CKF HP           + V  Y + P+    A  +R+
Sbjct  86   KTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYIRN  133



>ref|XP_008443710.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Cucumis melo]
Length=437

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES Q TVG+SQ Y     SE  +  +     S        G+  LQRENVFPERPGQPEC
Sbjct  245  ESPQQTVGHSQIYEAXYQSEXVDAAASVAVSSLICSNCSFGFLPLQRENVFPERPGQPEC  304

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVC+FHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  305  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  364

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG+FTYN+S +S+ NAP V+H 
Sbjct  365  CKFDHPMGIFTYNLSAASSANAP-VQHL  391


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  89   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  148

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  149  RTGQCKFGNTCKFHHP  164


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 67/135 (50%), Gaps = 15/135 (11%)
 Frame = -2

Query  626  SQGMNPSYRAGTL---PMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  456
            S  + PS R   L    +G   +     +P RPG+P+C +Y++TG C+FGA C+F+HP  
Sbjct  16   SSALAPSLREDALWQMNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPN  75

Query  455  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP-----------MGVFT  309
            R      +       P R G+P C +Y + G CKFG +CKF HP           + +  
Sbjct  76   R-ELAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILG  134

Query  308  YNISPSSTTNAPTVR  264
            Y + PS T  A  +R
Sbjct  135  YPLRPSETECAYYLR  149


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  135  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQ  165



>gb|KHG12066.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=433

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  665  YGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFG  486
            +G SR +E A  GSQ      R+G++P+G YALQRENVFPERPG+PECQFYMKTGDCKFG
Sbjct  252  HGTSRQNESATAGSQASFSELRSGSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFG  311

Query  485  AVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  306
            AVCKFHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTY
Sbjct  312  AVCKFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTY  371

Query  305  NISPSSTTNAPT  270
            + SPSS ++AP 
Sbjct  372  SYSPSSPSDAPV  383


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQ------FYMKTGDCKFGAVCKFHHPRERlipppdslls  423
            +   A + +  FPER GQPECQ      +Y+KTG CKFGA CKFHHPR++        L+
Sbjct  86   LAIAAARMKGEFPERVGQPECQACTYSSYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLN  145

Query  422  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  146  ILGYPLRPNETECAYYLRTGQCKFGSTCKFHHP  178


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 18/113 (16%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLC----  384
            +PERPG+P+C +Y++TG C+FGA C F+HP  R      +       P R G+P C    
Sbjct  52   YPERPGEPDCSYYIRTGLCRFGATCHFNHPPNR-KLAIAAARMKGEFPERVGQPECQACT  110

Query  383  --AFYSRYGICKFGPSCKFDHP-----------MGVFTYNISPSSTTNAPTVR  264
              ++Y + G CKFG +CKF HP           + +  Y + P+ T  A  +R
Sbjct  111  YSSYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNETECAYYLR  163


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  149  YPLRPNETECAYYLRTGQCKFGSTCKFHHPQ  179



>ref|XP_008792914.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Phoenix dactylifera]
Length=452

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  501
            G  Q +G SR SE +  G+QG+  SYR+ ++ MG +ALQ++NVFPER  QPECQFYMKTG
Sbjct  242  GTVQIHGSSRPSETS-AGAQGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTG  300

Query  500  DCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP-  324
            DCKFGA CKFHHP+ERLI  P+ LLSP GLPLRPGEPLC FYSRYGICKFGP+CKFDHP 
Sbjct  301  DCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPV  360

Query  323  ---MGVFTYNISPSSTTNAPTVRHF  258
               MG+F Y++S S++ + P VRH 
Sbjct  361  VTSMGIFAYSLSTSASADIPIVRHL  385


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 55/100 (55%), Gaps = 24/100 (24%)
 Frame = -2

Query  551  FPERPGQPECQ------------------------FYMKTGDCKFGAVCKFHHPRERlip  444
            +P+R G+P+C                         +Y+KTG CKFGA CKFHHP+++   
Sbjct  53   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLYYLKTGTCKFGATCKFHHPKDKAGI  112

Query  443  ppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
               + L+ +G P+RP E  CA+Y R G CKFG +CKF HP
Sbjct  113  LGRAELNILGYPIRPNEEECAYYLRTGQCKFGNTCKFHHP  152


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  123  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQ  153



>ref|XP_008792915.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Phoenix dactylifera]
Length=434

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  501
            G  Q +G SR SE +  G+QG+  SYR+ ++ MG +ALQ++NVFPER  QPECQFYMKTG
Sbjct  224  GTVQIHGSSRPSETS-AGAQGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTG  282

Query  500  DCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP-  324
            DCKFGA CKFHHP+ERLI  P+ LLSP GLPLRPGEPLC FYSRYGICKFGP+CKFDHP 
Sbjct  283  DCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPV  342

Query  323  ---MGVFTYNISPSSTTNAPTVRHF  258
               MG+F Y++S S++ + P VRH 
Sbjct  343  VTSMGIFAYSLSTSASADIPIVRHL  367


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +PE  GQPECQ+Y+KTG CKFGA CKFHHP+++      + L+ +G P+
Sbjct  48   LAIAAARLKGGYPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPI  107

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  108  RPNEEECAYYLRTGQCKFGNTCKFHHP  134


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P+R G+P+C +Y++TG C++G  C+++HP  R +    + L      +  G+P C +Y 
Sbjct  14   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKGGYPEIV-GQPECQYYL  72

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  73   KTGTCKFGATCKFHHP  88


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  105  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQ  135



>ref|XP_008792910.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792911.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792912.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
Length=473

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  501
            G  Q +G SR SE +  G+QG+  SYR+ ++ MG +ALQ++NVFPER  QPECQFYMKTG
Sbjct  263  GTVQIHGSSRPSETS-AGAQGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTG  321

Query  500  DCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP-  324
            DCKFGA CKFHHP+ERLI  P+ LLSP GLPLRPGEPLC FYSRYGICKFGP+CKFDHP 
Sbjct  322  DCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPV  381

Query  323  ---MGVFTYNISPSSTTNAPTVRHF  258
               MG+F Y++S S++ + P VRH 
Sbjct  382  VTSMGIFAYSLSTSASADIPIVRHL  406


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +PE  GQPECQ+Y+KTG CKFGA CKFHHP+++      + L+ +G P+
Sbjct  87   LAIAAARLKGGYPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPI  146

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  147  RPNEEECAYYLRTGQCKFGNTCKFHHP  173


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P+R G+P+C +Y++TG C++G  C+++HP  R +    + L      +  G+P C +Y 
Sbjct  53   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKGGYPEIV-GQPECQYYL  111

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  112  KTGTCKFGATCKFHHP  127


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  144  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQ  174



>gb|EEC69137.1| hypothetical protein OsI_38063 [Oryza sativa Indica Group]
Length=395

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+ QQ T   +Q YG SR SE   +G  GM  SY+ G++P+G Y +Q EN+FPERP QPE
Sbjct  206  PDDQQRTPVTTQYYG-SRQSETGGMGDHGMYQSYQGGSVPVGVYTVQGENIFPERPDQPE  264

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHP+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP
Sbjct  265  CQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGP  324

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRH  261
            +CKFDHPMG   Y  + S T +  ++ +
Sbjct  325  NCKFDHPMGTLMYGSATSPTGDVSSMHY  352


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A +    +P R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G P+RP E
Sbjct  101  AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNE  160

Query  392  PLCAFYSRYGICKFGPSC  339
              CA+Y R G CKF  +C
Sbjct  161  KECAYYLRTGQCKFASTC  178


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP  R      +       P R G+P C +Y 
Sbjct  63   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  121

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  122  KTGTCKFGATCKFHHP  137



>ref|XP_006663970.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Oryza brachyantha]
Length=409

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+ QQ T   +Q YG SR SE A +G  GM  SY+  ++P+G Y +Q EN+FPERP QPE
Sbjct  220  PDDQQRTPVTTQYYG-SRQSETAGMGDHGMFQSYQGSSVPIGVYTVQGENIFPERPDQPE  278

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHP+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP
Sbjct  279  CQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGP  338

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRH  261
            +CKFDHPMG   Y  + S T +  ++ +
Sbjct  339  NCKFDHPMGTLMYGSATSPTGDVSSLHY  366


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A +    +P R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G P+RP E
Sbjct  56   AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPMRPNE  115

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
              CA+Y R G CKF  +CKF HP
Sbjct  116  KECAYYLRTGQCKFASTCKFHHP  138


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP  R      +       P R G+P C +Y 
Sbjct  18   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  76

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  77   KTGTCKFGATCKFHHP  92



>ref|XP_006848460.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
 gb|ERN10041.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
Length=467

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  501
            G  Q+YG  R +E     S G  P +R+ ++PMG + LQRENVFPERP QPECQFYMKTG
Sbjct  269  GTGQSYGTPRQTETGGASSPGAFP-FRSSSVPMGLFPLQRENVFPERPDQPECQFYMKTG  327

Query  500  DCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPM  321
            DCKFGA+CKFHHPRERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPM
Sbjct  328  DCKFGAMCKFHHPRERLLPVPNCMLSPMGLPLRPGEPLCIFYSRYGICKFGPTCKFDHPM  387

Query  320  GVFTYNISPSSTTNAPTVR  264
            G F YN+S +S+ + P  R
Sbjct  388  GPFAYNLS-TSSADVPVRR  405


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHPR++       LL+ +G PL
Sbjct  94   LAVAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVLLNILGYPL  153

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  154  RPNEKECAYYLRTGQCKFGSTCKFHHP  180


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+ +C +Y++TG C+FG  C+F+HP  R      +     G P R G+P C +Y 
Sbjct  60   YPERPGEIDCAYYIRTGLCRFGMTCRFNHPPNR-KLAVAAARIKGGYPERVGQPECQYYL  118

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  119  KTGTCKFGATCKFHHP  134


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  151  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQ  181



>ref|XP_003577562.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Brachypodium distachyon]
Length=445

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + Q  + G +Q Y  SR SE   +   GM  SY+ G++P G YA+QRE +FP+RP QPEC
Sbjct  256  DDQGRSSGAAQYYTGSRQSETQGMSDHGMISSYQHGSVPAGLYAVQREYIFPDRPDQPEC  315

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHP+ER+IP P   LSP+GLPLR GEP+C FYSRYGICKFGP+
Sbjct  316  QFYMKTGDCKFGAVCKFHHPKERIIPSPSCALSPLGLPLRSGEPICTFYSRYGICKFGPN  375

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMG   Y ++ S T   PT RH 
Sbjct  376  CKFDHPMGTVMYGLATSPTGEVPTGRHM  403


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  87   MAVAAARMKGEYPQRIGQPECQYYLKTGMCKFGATCKFHHPREKAAMATRVQLNVLGYPL  146

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  C++Y R G CKFG +CKF+HP
Sbjct  147  RPNEKECSYYLRTGQCKFGSTCKFNHP  173


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = -2

Query  608  SYRAGTLPMGYYAL---QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlippp  438
            S+R     M + +L       ++PER G+P+C +YM+TG C+FG  CKF+HP +R     
Sbjct  31   SHRVDGEAMWHMSLGESMEAGLYPERVGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAV  89

Query  437  dsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             +       P R G+P C +Y + G+CKFG +CKF HP
Sbjct  90   AAARMKGEYPQRIGQPECQYYLKTGMCKFGATCKFHHP  127



>ref|XP_006663969.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Oryza brachyantha]
Length=448

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+ QQ T   +Q YG SR SE A +G  GM  SY+  ++P+G Y +Q EN+FPERP QPE
Sbjct  259  PDDQQRTPVTTQYYG-SRQSETAGMGDHGMFQSYQGSSVPIGVYTVQGENIFPERPDQPE  317

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHP+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP
Sbjct  318  CQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGP  377

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTVRH  261
            +CKFDHPMG   Y  + S T +  ++ +
Sbjct  378  NCKFDHPMGTLMYGSATSPTGDVSSLHY  405


 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A +    +P R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G P+
Sbjct  91   LAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPM  150

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKF  +CKF HP
Sbjct  151  RPNEKECAYYLRTGQCKFASTCKFHHP  177


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP  R      +       P R G+P C +Y 
Sbjct  57   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  115

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  116  KTGTCKFGATCKFHHP  131



>ref|XP_009420319.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=429

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 114/152 (75%), Gaps = 5/152 (3%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQ      +Q YG SR +E    G QG  PSYR+  +P+G Y L RENVFPERP QPEC
Sbjct  260  ESQLHLPRTTQFYGTSRQNETI-AGVQGTIPSYRSSAIPLGQYVLARENVFPERPDQPEC  318

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGA CKFHHPRERL+PPP+ LLSP+GLPLRPGEPLC FYSRYGICKFGP 
Sbjct  319  QFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPH  378

Query  341  CKFDHPM----GVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM    GV+ Y++  SS+ +A   R+ 
Sbjct  379  CKFDHPMATPIGVYAYSLPTSSSADALVSRNL  410


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  FPER GQPECQ+Y++TG CKFGA CKFHHPR++        L+ +G P+
Sbjct  93   MAIAAARIKGGFPERVGQPECQYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPI  152

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R  E  CA+Y R G+CKFG +CKF HP
Sbjct  153  RLNETECAYYMRNGVCKFGSTCKFHHP  179


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG  C+++HP  R      +     G P R G+P C +Y 
Sbjct  59   YPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNR-QMAIAAARIKGGFPERVGQPECQYYL  117

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  118  RTGTCKFGATCKFHHP  133



>ref|XP_009420318.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 114/152 (75%), Gaps = 5/152 (3%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQ      +Q YG SR +E    G QG  PSYR+  +P+G Y L RENVFPERP QPEC
Sbjct  262  ESQLHLPRTTQFYGTSRQNETI-AGVQGTIPSYRSSAIPLGQYVLARENVFPERPDQPEC  320

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGA CKFHHPRERL+PPP+ LLSP+GLPLRPGEPLC FYSRYGICKFGP 
Sbjct  321  QFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPH  380

Query  341  CKFDHPM----GVFTYNISPSSTTNAPTVRHF  258
            CKFDHPM    GV+ Y++  SS+ +A   R+ 
Sbjct  381  CKFDHPMATPIGVYAYSLPTSSSADALVSRNL  412


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  FPER GQPECQ+Y++TG CKFGA CKFHHPR++        L+ +G P+
Sbjct  95   MAIAAARIKGGFPERVGQPECQYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPI  154

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R  E  CA+Y R G+CKFG +CKF HP
Sbjct  155  RLNETECAYYMRNGVCKFGSTCKFHHP  181


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG  C+++HP  R      +     G P R G+P C +Y 
Sbjct  61   YPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNR-QMAIAAARIKGGFPERVGQPECQYYL  119

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  120  RTGTCKFGATCKFHHP  135



>ref|NP_001130819.1| uncharacterized protein LOC100191923 [Zea mays]
 gb|ACF79183.1| unknown [Zea mays]
 gb|ACG29102.1| zinc finger CCCH type domain-containing protein ZFN-like [Zea 
mays]
 gb|ACN25540.1| unknown [Zea mays]
 gb|ACN28916.1| unknown [Zea mays]
 gb|ACR36098.1| unknown [Zea mays]
 gb|AFT82657.1| C3H19 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA38868.1| TPA: putative Zinc finger CCCH type domain-containing protein 
ZFN [Zea mays]
Length=443

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +Q Y  SR S    +G +GM  SY+AG++P+G YA+Q ENVFPERP QPEC
Sbjct  254  DDQQRTPGAAQYYTGSRQSGTPGIGDRGMFSSYQAGSVPVGLYAVQTENVFPERPDQPEC  313

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFG+VCKFHHPRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+
Sbjct  314  QFYMKTGDCKFGSVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  373

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKF HPMG   Y  + S T+ A T R  
Sbjct  374  CKFHHPMGNPMYGHASSPTSEAQTSRRM  401


 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PL
Sbjct  85   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  144

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R  E  CA+Y R G CKFG +CKF HP
Sbjct  145  RLNEKECAYYLRTGQCKFGSTCKFHHP  171


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G P+C +YM+TG C+FG  CKF+HP +R      +       P R G+P C +Y 
Sbjct  51   YPERVGDPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  109

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  110  KTGTCKFGATCKFHHP  125



>ref|XP_010525082.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q   GN   YG    +E  + GS G    + +G+  +G YAL RENVFPERPGQPECQ
Sbjct  229  SPQQVTGNDHNYGNLMQNEAKDTGSPGSFSGFHSGSAQLGIYALPRENVFPERPGQPECQ  288

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            FYMKTGDCKFGAVCKFHHPR+R IPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSC
Sbjct  289  FYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSC  348

Query  338  KFDHPMGVFTYN--ISPSSTTNAPT-VRHF  258
            KFDHPM VFTYN   + SS+ N  T  RH 
Sbjct  349  KFDHPMRVFTYNNINNASSSMNQETPFRHL  378


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +PER GQPECQ+Y+KTG CKFG  CKFHHPR +        L+ +G P+
Sbjct  66   LAIAAARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPI  125

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  C++Y R G CKFG +CKF+HP
Sbjct  126  RPNEVECSYYLRTGHCKFGSTCKFNHP  152


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
             +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y
Sbjct  31   TYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-NLAIAAARMKGEYPERIGQPECQYY  89

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKF HP
Sbjct  90   LKTGTCKFGVTCKFHHP  106



>ref|XP_010525081.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q   GN   YG    +E  + GS G    + +G+  +G YAL RENVFPERPGQPECQ
Sbjct  240  SPQQVTGNDHNYGNLMQNEAKDTGSPGSFSGFHSGSAQLGIYALPRENVFPERPGQPECQ  299

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            FYMKTGDCKFGAVCKFHHPR+R IPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSC
Sbjct  300  FYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSC  359

Query  338  KFDHPMGVFTYN--ISPSSTTNAPT-VRHF  258
            KFDHPM VFTYN   + SS+ N  T  RH 
Sbjct  360  KFDHPMRVFTYNNINNASSSMNQETPFRHL  389


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +PER GQPECQ+Y+KTG CKFG  CKFHHPR +        L+ +G P+
Sbjct  77   LAIAAARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPI  136

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  C++Y R G CKFG +CKF+HP
Sbjct  137  RPNEVECSYYLRTGHCKFGSTCKFNHP  163


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
             +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y
Sbjct  42   TYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-NLAIAAARMKGEYPERIGQPECQYY  100

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKF HP
Sbjct  101  LKTGTCKFGVTCKFHHP  117



>ref|NP_001066624.1| Os12g0405100 [Oryza sativa Japonica Group]
 sp|Q2QT65.1|C3H66_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 66; 
Short=OsC3H66 [Oryza sativa Japonica Group]
 gb|ABA97542.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29643.1| Os12g0405100 [Oryza sativa Japonica Group]
 dbj|BAG99287.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53085.1| hypothetical protein OsJ_35844 [Oryza sativa Japonica Group]
Length=454

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+ QQ T   +Q YG SR SE   +G  GM  SY+ G++P+G Y +Q EN+FPERP QPE
Sbjct  265  PDDQQRTPVTTQYYG-SRQSETGGMGDHGMYQSYQGGSVPVGVYTVQGENIFPERPDQPE  323

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFGAVCKFHHP+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP
Sbjct  324  CQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGP  383

Query  344  SCKFDHPMGVFTYNISPS  291
            +CKFDHPMG   Y  + S
Sbjct  384  NCKFDHPMGTLMYGSATS  401


 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A +    +P R GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G P+RP E
Sbjct  101  AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNE  160

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
              CA+Y R G CKF  +CKF HP
Sbjct  161  KECAYYLRTGQCKFASTCKFHHP  183


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +YM+TG C+FG  CKF+HP  R      +       P R G+P C +Y 
Sbjct  63   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  121

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  122  KTGTCKFGATCKFHHP  137



>ref|XP_004157161.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
Length=220

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -2

Query  563  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLC  384
            RENVFPERPGQPECQFYMKTGDCKFGAVC+FHHPRER++P PD +LSPIGLPLRPGEPLC
Sbjct  74   RENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLC  133

Query  383  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
             FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP V+H 
Sbjct  134  IFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAP-VQHL  174



>dbj|BAG99488.1| unnamed protein product [Oryza sativa Japonica Group]
Length=237

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 113/153 (74%), Gaps = 9/153 (6%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES+  + G  Q YG S+  + A+ G+QGM   YR+ + P+  YALQRENVFPERP QPEC
Sbjct  78   ESRLQSPGAQQTYGTSQQVD-ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPEC  136

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFGAVCKFHHPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +
Sbjct  137  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  196

Query  341  CKFDH-----PMGVFTYNISPSSTTNAPTVRHF  258
            CKFDH     PMGV+ Y    S++TN P VR  
Sbjct  197  CKFDHPTMAPPMGVYAYG---SASTNVPMVRRL  226



>emb|CDP04213.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 106/148 (72%), Gaps = 30/148 (20%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQQ T GN Q +G+                             LQRE VFPERPGQPEC
Sbjct  240  ESQQQTAGNDQTHGM-----------------------------LQRETVFPERPGQPEC  270

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKFHHPRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPS
Sbjct  271  QFYMKTGDCKFGAVCKFHHPRERILPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  330

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            CKFDHPMGVFTYN+S SS+T  PTVR  
Sbjct  331  CKFDHPMGVFTYNVS-SSSTEPPTVRRL  357


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPREKAGIAGRVTLNALGYPLRPNEIECAYYL  147

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  148  RTGHCKFGSTCKFHHP  163


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
             +P R G+P+C +Y++TG C++GA C+F+HP  R      +       P R G+P C +Y
Sbjct  42   TYPVREGEPDCSYYIRTGLCRYGATCRFNHPPNR-KLAIATARMRGEYPERMGQPECQYY  100

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKF HP
Sbjct  101  LKTGTCKFGATCKFHHP  117


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  134  YPLRPNEIECAYYLRTGHCKFGSTCKFHHPQ  164



>gb|EMS50271.1| Zinc finger CCCH domain-containing protein 12 [Triticum urartu]
Length=406

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 113/153 (74%), Gaps = 5/153 (3%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PES+  + G  Q YG SR  E A+ G+QGM  SYR+ + P   YALQRENVFPERP QPE
Sbjct  244  PESRLQSPGAQQYYGTSRQGE-ASAGNQGMQSSYRSSSFPAPQYALQRENVFPERPDQPE  302

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            C +Y+KTGDCKFGAVCKFHHPR R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG 
Sbjct  303  CIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGV  362

Query  344  SCKFDH----PMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDH    PMGV+ Y  S S++ NAP  R  
Sbjct  363  NCKFDHPMAAPMGVYAYGYSASASPNAPMARRL  395


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  86   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNERECAYYL  145

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF+HP
Sbjct  146  KTGQCKYGNTCKFNHP  161


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = -2

Query  683  VGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKT  504
            V N+   G +   ++ ++  +GM        + M   A  +   +P RPG+P+C +Y++T
Sbjct  2    VINTGVRGQTHHQKIQDMKVEGM-----WQQMAMSSGATMQSGPYPVRPGEPDCTYYLRT  56

Query  503  GDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            G C+FG  C+F+HP++R      S       P R G+P C +Y + G CKFGP+CKF HP
Sbjct  57   GLCRFGMSCRFNHPQDR-NTAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTCKFHHP  115



>gb|ACU21592.1| Zinc finger protein [Triticum aestivum]
 emb|CDM85631.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PES+  + G  Q YG SR  E A+ G+QGM   YR+ + P   YALQRENVFPERP QPE
Sbjct  273  PESRLQSPGAQQYYGTSRQGE-ASAGNQGMQSPYRSSSFPAPQYALQRENVFPERPDQPE  331

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            C +Y+KTGDCKFGAVCKFHHPR R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG 
Sbjct  332  CIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGV  391

Query  344  SCKFDH----PMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDH    PMGV+ Y  S S++ NAP  R  
Sbjct  392  NCKFDHPMAAPMGVYAYGYSASASPNAPMARRL  424


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  115  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNERECAYYL  174

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF+HP
Sbjct  175  KTGQCKYGNTCKFNHP  190


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  590  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspigl  411
            + M   A  +   +P RPG+P+C +Y++TG C+FG  C+F+HP++R      S       
Sbjct  57   MAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NTAIASARMKGEY  115

Query  410  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  116  PERVGQPECQYYLKTGTCKFGPTCKFHHP  144



>dbj|BAJ99149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            PES+  + G  Q YG SR  E  + G+QGM   YR+ + P+  YALQRENVFPERP QPE
Sbjct  221  PESRLQSPGAQQYYGTSRQGE-GSAGNQGMQSPYRSSSFPVPQYALQRENVFPERPDQPE  279

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            C +Y+KTGDCKFGAVCKFHHPR R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG 
Sbjct  280  CIYYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGV  339

Query  344  SCKFDH----PMGVFTYNISPSSTTNAPTVRHF  258
            +CKFDH    PMGV+ Y  S S++ NAP  R  
Sbjct  340  NCKFDHPMAAPMGVYAYGYSASASPNAPMARRL  372


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  63   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNALGYPLRPNERECAYYL  122

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF+HP
Sbjct  123  KTGQCKYGNTCKFNHP  138


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P RPG+P+C +Y++TG C+FG  C+F+HP++R      S       P R G+P C +Y 
Sbjct  18   YPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NTAIASARMKGEYPERVGQPECQYYL  76

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>ref|NP_851041.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 sp|Q8L7N8.2|C3H57_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 57; 
Short=AtC3H57; AltName: Full=Zinc finger type domain-containing 
protein ZFN3 [Arabidopsis thaliana]
 gb|AED92308.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=375

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 113/153 (74%), Gaps = 19/153 (12%)
 Frame = -2

Query  668  AYGLSRSSEVAN-----------VGSQG--MNPSYRAG-TLPMGYYALQRENVFPERPGQ  531
            +Y  SR+S VAN            GSQG   +  + +G ++P+G+YAL RENVFPERPGQ
Sbjct  187  SYSWSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQ  246

Query  530  PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKF  351
            PECQFYMKTGDCKFG VCKFHHPR+R  PPPD +LS +GLPLRPGEPLC FYSRYGICKF
Sbjct  247  PECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYGICKF  306

Query  350  GPSCKFDHPMGVFTYNI-----SPSSTTNAPTV  267
            GPSCKFDHPM VFTYN      SPSS+ +  T 
Sbjct  307  GPSCKFDHPMRVFTYNNNTASPSPSSSLHQETA  339


 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FY+KTG CKFG  CKFHHPR +        ++ +  PLRP E  C+++ 
Sbjct  84   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFL  143

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  144  RIGQCKFGGTCKFNHP  159


 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PER G+P+C +Y++TG C+FG+ C+F+HP +R      +       P R G+P C 
Sbjct  36   DGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR-KLVIATARIKGEYPERIGQPECE  94

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  95   FYLKTGTCKFGVTCKFHHP  113



>ref|NP_974790.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAM61197.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92307.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=354

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 113/153 (74%), Gaps = 19/153 (12%)
 Frame = -2

Query  668  AYGLSRSSEVAN-----------VGSQG--MNPSYRAG-TLPMGYYALQRENVFPERPGQ  531
            +Y  SR+S VAN            GSQG   +  + +G ++P+G+YAL RENVFPERPGQ
Sbjct  166  SYSWSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQ  225

Query  530  PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKF  351
            PECQFYMKTGDCKFG VCKFHHPR+R  PPPD +LS +GLPLRPGEPLC FYSRYGICKF
Sbjct  226  PECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYGICKF  285

Query  350  GPSCKFDHPMGVFTYNI-----SPSSTTNAPTV  267
            GPSCKFDHPM VFTYN      SPSS+ +  T 
Sbjct  286  GPSCKFDHPMRVFTYNNNTASPSPSSSLHQETA  318


 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FY+KTG CKFG  CKFHHPR +        ++ +  PLRP E  C+++ 
Sbjct  63   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFL  122

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  123  RIGQCKFGGTCKFNHP  138


 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PER G+P+C +Y++TG C+FG+ C+F+HP +R      +       P R G+P C 
Sbjct  15   DGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR-KLVIATARIKGEYPERIGQPECE  73

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  74   FYLKTGTCKFGVTCKFHHP  92



>dbj|BAD87736.1| putative zinc finger protein [Oryza sativa Japonica Group]
Length=322

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 113/153 (74%), Gaps = 9/153 (6%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES+  + G  Q YG S+  + A+ G+QGM   YR+ + P+  YALQRENVFPERP QPEC
Sbjct  163  ESRLQSPGAQQTYGTSQQVD-ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPEC  221

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFGAVCKFHHPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +
Sbjct  222  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  281

Query  341  CKFDH-----PMGVFTYNISPSSTTNAPTVRHF  258
            CKFDH     PMGV+ Y    S++TN P VR  
Sbjct  282  CKFDHPTMAPPMGVYAYG---SASTNVPMVRRL  311


 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  5    YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  64

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF HP
Sbjct  65   KTGQCKYGNTCKFHHP  80



>gb|EEE55890.1| hypothetical protein OsJ_04549 [Oryza sativa Japonica Group]
Length=380

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 113/153 (74%), Gaps = 9/153 (6%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES+  + G  Q YG S+  + A+ G+QGM   YR+ + P+  YALQRENVFPERP QPEC
Sbjct  221  ESRLQSPGAQQTYGTSQQVD-ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPEC  279

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFGAVCKFHHPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +
Sbjct  280  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  339

Query  341  CKFDH-----PMGVFTYNISPSSTTNAPTVRHF  258
            CKFDH     PMGV+ Y    S++TN P VR  
Sbjct  340  CKFDHPTMAPPMGVYAYG---SASTNVPMVRRL  369


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  63   YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  122

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF HP
Sbjct  123  KTGQCKYGNTCKFHHP  138


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FG  C+F+HP++R      S       P R G+P C +Y 
Sbjct  18   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NLAIASARMKGEYPERMGQPECQYYL  76

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>dbj|BAJ86320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            + QQ T G +  YG +   E   +G  GM  S++AG+ P+G YA+Q EN FPERP QPEC
Sbjct  254  DGQQRTPGTAHYYG-THQRETTGMGEHGMFTSHKAGSAPLGVYAVQGENTFPERPEQPEC  312

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFGAVCKF+HP++R++P P+  LSP+GLPLRPGEP+C FYSRYGICKFGP+
Sbjct  313  QFYMKTGDCKFGAVCKFNHPKKRMVPAPNCALSPLGLPLRPGEPICTFYSRYGICKFGPN  372

Query  341  CKFDHPMGVFTYNISPSSTTNAPTVRH  261
            CKFDHPMG   Y    S T + P + +
Sbjct  373  CKFDHPMGTILYGSPTSPTGDVPPLHY  399


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +   A + +  +P R GQPECQ+Y+KTG CKFGA CKFHHPRE+      + L+ +G PL
Sbjct  85   LAVAAARMKGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIAISAQLNVLGYPL  144

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP------MGVFTYNISPSSTTNAP  273
            R  E  C +Y R G CKF  +CKF HP      + + +   SP  +T +P
Sbjct  145  RLNEKECVYYLRTGQCKFASTCKFHHPQPSSTMVAIRSSICSPGQSTTSP  194


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 59/118 (50%), Gaps = 7/118 (6%)
 Frame = -2

Query  677  NSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGD  498
            +S   GL+  S   + G      +   G L M          +PER G+ +C +YM+TG 
Sbjct  15   SSSPTGLTIGSHYGSTGEATWQMTLGCGGLSM------EPGPYPERIGERDCSYYMRTGF  68

Query  497  CKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            C+FG  CKF+HP +R      +       P R G+P C +Y + G CKFG +CKF HP
Sbjct  69   CRFGVTCKFNHPADR-KLAVAAARMKGEYPYRVGQPECQYYLKTGTCKFGATCKFHHP  125



>gb|EAY76977.1| hypothetical protein OsI_04935 [Oryza sativa Indica Group]
Length=440

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 113/153 (74%), Gaps = 9/153 (6%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES+  + G  Q YG S+  + A+ G+QGM   YR+ + P+  YALQRENVFPERP QPEC
Sbjct  281  ESRLQSPGAQQTYGTSQQVD-ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPEC  339

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFGAVCKFHHPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +
Sbjct  340  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  399

Query  341  CKFDH-----PMGVFTYNISPSSTTNAPTVRHF  258
            CKFDH     PMGV+ Y    S++TN P VR  
Sbjct  400  CKFDHPTMAPPMGVYAYG---SASTNVPMVRRL  429


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  122  YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  181

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF HP
Sbjct  182  KTGQCKYGNTCKFHHP  197


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FG  C+F+HP++R      S       P R G+P C +Y 
Sbjct  77   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NLAIASARMKGEYPERMGQPECQYYL  135

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>ref|NP_001045201.2| Os01g0917400 [Oryza sativa Japonica Group]
 sp|Q5JLB5.2|C3H12_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 12; 
Short=OsC3H12; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 2 [Oryza sativa Japonica Group]
 dbj|BAD87735.1| putative zinc finger protein [Oryza sativa Japonica Group]
 dbj|BAG93826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07115.2| Os01g0917400 [Oryza sativa Japonica Group]
 gb|AEM43044.1| CCCH-type zinc finger protein [Oryza sativa Indica Group]
Length=439

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 113/153 (74%), Gaps = 9/153 (6%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES+  + G  Q YG S+  + A+ G+QGM   YR+ + P+  YALQRENVFPERP QPEC
Sbjct  280  ESRLQSPGAQQTYGTSQQVD-ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPEC  338

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFGAVCKFHHPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +
Sbjct  339  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  398

Query  341  CKFDH-----PMGVFTYNISPSSTTNAPTVRHF  258
            CKFDH     PMGV+ Y    S++TN P VR  
Sbjct  399  CKFDHPTMAPPMGVYAYG---SASTNVPMVRRL  428


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  122  YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  181

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF HP
Sbjct  182  KTGQCKYGNTCKFHHP  197


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P+C +Y++TG C+FG  C+F+HP++R      S       P R G+P C +Y 
Sbjct  77   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NLAIASARMKGEYPERMGQPECQYYL  135

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>gb|AFW84181.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=375

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 113/156 (72%), Gaps = 11/156 (7%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+
Sbjct  210  QLQSPGAQQTYGSSQQGE-ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQY  268

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CK
Sbjct  269  YMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCK  328

Query  335  FDH-----PMGVFTYNISPS-----STTNAPTVRHF  258
            FDH     PMGV+ Y  S S     ++TNAP  RH 
Sbjct  329  FDHPTMAAPMGVYAYGFSGSASVAPASTNAPMTRHL  364


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  590  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspigl  411
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F+HP +R      S       
Sbjct  53   MAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  111

Query  410  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  112  PERVGQPECQYYLKTGTCKFGPTCKFHHP  140


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRER  453
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREK  143



>ref|XP_004142565.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
 gb|KGN66679.1| hypothetical protein Csa_1G659020 [Cucumis sativus]
Length=367

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -2

Query  563  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLC  384
            RENVFPERPGQPECQFYMKTGDCKFGAVC+FHHPRER++P PD +LSPIGLPLRPGEPLC
Sbjct  221  RENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLC  280

Query  383  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
             FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP V+H 
Sbjct  281  IFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAP-VQHL  321


 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  59   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  118

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGNTCKFHHP  134


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +G   +     +P RPG+P+C +Y++TG C+FGA C+F+HP  R      +       P 
Sbjct  3    LGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNR-ELAIATARMKGEFPE  61

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP-----------MGVFTYNISPSSTTNAPTVR  264
            R G+P C +Y + G CKFG +CKF HP           + +  Y + PS T  A  +R
Sbjct  62   RIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLR  119



>gb|ADN33845.1| nucleic acid binding protein [Cucumis melo subsp. melo]
Length=367

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -2

Query  563  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLC  384
            RENVFPERPGQPECQFYMKTGDCKFGAVC+FHHPRER++P PD +LSPIGLPLRPGEPLC
Sbjct  221  RENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLC  280

Query  383  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
             FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP V+H 
Sbjct  281  IFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAP-VQHL  321


 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  59   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  118

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGNTCKFHHP  134


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +G   +     +P RPG+P+C +Y++TG C+FGA C+F+HP  R      +       P 
Sbjct  3    LGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNR-ELAIATARMKGEFPE  61

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP-----------MGVFTYNISPSSTTNAPTVR  264
            R G+P C +Y + G CKFG +CKF HP           + +  Y + PS T  A  +R
Sbjct  62   RIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLR  119



>gb|ACN33948.1| unknown [Zea mays]
 gb|AFW84182.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=377

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 113/156 (72%), Gaps = 11/156 (7%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+
Sbjct  212  QLQSPGAQQTYGSSQQGE-ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQY  270

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CK
Sbjct  271  YMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCK  330

Query  335  FDH-----PMGVFTYNISPS-----STTNAPTVRHF  258
            FDH     PMGV+ Y  S S     ++TNAP  RH 
Sbjct  331  FDHPTMAAPMGVYAYGFSGSASVAPASTNAPMTRHL  366


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PL P E  CA+Y 
Sbjct  61   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  120

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            + G CK+  +CKF HP     +N+ PSS
Sbjct  121  KTGQCKYANTCKFHHPE---LFNVVPSS  145


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  590  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspigl  411
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F+HP +R      S       
Sbjct  3    MAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  61

Query  410  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  62   PERVGQPECQYYLKTGTCKFGPTCKFHHP  90



>ref|XP_003564925.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Brachypodium distachyon]
Length=442

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 112/150 (75%), Gaps = 5/150 (3%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES+  + G  Q YG  R  E A+ G+QGM   YR  + P+  YALQRENVFPERP QPEC
Sbjct  281  ESRLQSPGAQQNYGTYRQGE-ASSGNQGMLSPYRPSSFPVPQYALQRENVFPERPDQPEC  339

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
             +Y+KTGDCKFGAVCKFHHPR R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +
Sbjct  340  IYYIKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGIN  399

Query  341  CKFDH----PMGVFTYNISPSSTTNAPTVR  264
            CKFDH    PMGV+ Y  S S++TNAP  R
Sbjct  400  CKFDHPMASPMGVYAYGFSASASTNAPMAR  429


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLR  E  CA+Y 
Sbjct  122  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRLNEKECAYYL  181

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF+HP
Sbjct  182  KTGQCKYGNTCKFNHP  197


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG  C+F+HP +R      S       P R G+P C +Y 
Sbjct  77   YPERPGEPDCTYYLRTGLCRFGISCRFNHPPDR-NLAIASARMKGEYPERVGQPECQYYL  135

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>gb|ACF82040.1| unknown [Zea mays]
 gb|AFT82648.1| C3H49 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW84180.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 113/156 (72%), Gaps = 11/156 (7%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+
Sbjct  262  QLQSPGAQQTYGSSQQGE-ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQY  320

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CK
Sbjct  321  YMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCK  380

Query  335  FDH-----PMGVFTYNISPS-----STTNAPTVRHF  258
            FDH     PMGV+ Y  S S     ++TNAP  RH 
Sbjct  381  FDHPTMAAPMGVYAYGFSGSASVAPASTNAPMTRHL  416


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PL P E  CA+Y 
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  170

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            + G CK+  +CKF HP     +N+ PSS
Sbjct  171  KTGQCKYANTCKFHHPE---LFNVVPSS  195


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  590  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspigl  411
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F+HP +R      S       
Sbjct  53   MAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  111

Query  410  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  112  PERVGQPECQYYLKTGTCKFGPTCKFHHP  140



>gb|KFK37691.1| hypothetical protein AALP_AA3G016100 [Arabis alpina]
Length=389

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQ--GMNPSYRAGT-LPMG-YYALQRENVFPERPGQPECQFY  513
            GN Q Y   + SE    GSQ  G    Y AG+ +P+G +YAL RENVFPERPGQPECQFY
Sbjct  222  GNDQNYRNLQQSETNEPGSQSQGSYSGYNAGSSVPVGGFYALPRENVFPERPGQPECQFY  281

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            MKTGDCKFG VCKFHHPR+R  P PD LLS IGLPLRPGEPLC FY+RYGICKFGPSCKF
Sbjct  282  MKTGDCKFGTVCKFHHPRDRQAPSPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKF  341

Query  332  DHPMGVFTYNISPSST  285
            DHPM VF Y+ + S T
Sbjct  342  DHPMRVFAYDNTGSET  357


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLRP E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRPNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  37   YPERQGEPNCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_009382899.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 5/152 (3%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ESQ      +  YG SR SE    G QGM  SYR+G +P+G Y L R+NVFP RPGQPEC
Sbjct  261  ESQLHMPQTTPFYGTSRQSET-TTGVQGMIHSYRSGAIPLGQYVLARDNVFPVRPGQPEC  319

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            +FY+KTGDCK+GA CKFHHPRERLIP PD +LSP+GLPLRP EP+C FYSRYGICKFG  
Sbjct  320  EFYLKTGDCKYGAACKFHHPRERLIPIPDCVLSPLGLPLRPEEPICIFYSRYGICKFGTH  379

Query  341  CKFDH----PMGVFTYNISPSSTTNAPTVRHF  258
            CKFDH    PMG++ Y+++ SS  +    R+ 
Sbjct  380  CKFDHPMAAPMGIYAYSLATSSLADVAVARNL  411


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +PER GQPEC+FY++TG CKFGA CKFHHPR++        L+ +G PL
Sbjct  93   MAIAAARIKGGYPERVGQPECEFYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNVLGYPL  152

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y + G CKFG +CKF HP
Sbjct  153  RPDEAECAYYMKNGECKFGNTCKFHHP  179


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPERP +P+C +Y++TG C+FG  C+++HP  R      +     G P R G+P C FY 
Sbjct  59   FPERPREPDCTYYLRTGLCRFGITCRYNHPPNR-QMAIAAARIKGGYPERVGQPECEFYL  117

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  118  RTGTCKFGATCKFHHP  133


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +YMK G+CKFG  CKFHHP+
Sbjct  150  YPLRPDEAECAYYMKNGECKFGNTCKFHHPQ  180



>ref|XP_006645228.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Oryza brachyantha]
Length=381

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 112/153 (73%), Gaps = 9/153 (6%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            ES+  + G  Q YG S+ ++ A+ G+QGM   YR+ + P   YALQRENVFPERP QPEC
Sbjct  222  ESRLQSPGAQQTYGTSQQAD-ASAGNQGMLSPYRSSSYPGPQYALQRENVFPERPDQPEC  280

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFGAVCKFHHPR R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +
Sbjct  281  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  340

Query  341  CKFDH-----PMGVFTYNISPSSTTNAPTVRHF  258
            CKFDH     PMGV+ Y    S++ N P VR  
Sbjct  341  CKFDHPSMAPPMGVYAYG---SASANVPMVRRL  370


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  63   YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  122

Query  371  RYGICKFGPSCKFDHP  324
            + G CK+G +CKF HP
Sbjct  123  KTGQCKYGNTCKFHHP  138


 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP +P+C +Y++TG C+FG  C+F+HP +R      S       P R G+P C +Y 
Sbjct  18   YPERPEEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERMGQPECQYYL  76

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>ref|XP_008389043.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=195

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  575  YALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPG  396
            YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FHHP ERLIP PD +LSPIGLPLRPG
Sbjct  43   YALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPG  102

Query  395  EPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  300
            EP+C FYSRYGICKFGPSCKF+HPMG+FTY +
Sbjct  103  EPMCIFYSRYGICKFGPSCKFBHPMGIFTYGL  134



>ref|NP_001150019.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
 gb|ACG37517.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 112/156 (72%), Gaps = 11/156 (7%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+
Sbjct  262  QLQSPGAQQTYGSSQQGE-ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQY  320

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CK
Sbjct  321  YMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCK  380

Query  335  FDH-----PMGVFTYNISPS-----STTNAPTVRHF  258
            FDH     PMGV+ Y  S S     ++T AP  RH 
Sbjct  381  FDHPTMAAPMGVYAYGFSGSASVAPASTXAPMTRHL  416


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PL P E  CA+Y 
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  170

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            + G CK+  +CKF HP     +N+ PSS
Sbjct  171  KTGQCKYANTCKFHHPE---LFNVVPSS  195


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  590  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspigl  411
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F+HP +R      S       
Sbjct  53   MAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  111

Query  410  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  112  PERVGQPECQYYLKTGTCKFGPTCKFHHP  140



>ref|XP_002871723.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47982.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 94/118 (80%), Gaps = 5/118 (4%)
 Frame = -2

Query  605  YRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsll  426
            +   ++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD  L
Sbjct  191  HSGNSVPLGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCAL  250

Query  425  spiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI-----SPSSTTNAPTV  267
            S +GLPLR GEPLC FYSRYGICKFGPSCKFDHPM VFTYN      SPSS+ +  T 
Sbjct  251  SSVGLPLRQGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNDASPSPSSSLHQETA  308


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FY+KTG CKFG  CKFHHPR +        ++ +G PLRP E  C+++ 
Sbjct  52   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGNDGRVSVNVLGYPLRPNEDDCSYFL  111

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  112  RTGHCKFGGTCKFNHP  127


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PER G+P+C +Y++TG C+FG  C+F+HP +R      +       P R G+P C 
Sbjct  4    DGSYPERHGEPDCAYYIRTGLCRFGFTCRFNHPHDR-KLVIATARIKGEYPERIGQPECE  62

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  63   FYLKTGTCKFGVTCKFHHP  81



>ref|XP_006296584.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
 gb|EOA29482.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
Length=329

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 103/140 (74%), Gaps = 10/140 (7%)
 Frame = -2

Query  683  VGNSQAYGLSRSSEVANVGSQ------GMNPSYRAGTLPMG-YYALQRENVFPERPGQPE  525
             GN   Y   + SE     +Q      G NP     ++P+G +YAL RENVFPERPGQPE
Sbjct  152  TGNDLNYRSLQQSETKESSTQSQGSFSGFNP---GSSVPLGGFYALPRENVFPERPGQPE  208

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+RYGICKFGP
Sbjct  209  CQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGP  268

Query  344  SCKFDHPMGVFTYNISPSST  285
            SCKFDHPM VFTY+ + S +
Sbjct  269  SCKFDHPMRVFTYDNTASES  288


 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  11   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  70

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  71   RTGHCKFGGTCKFNHPQPQPTNMMVPTS  98



>ref|NP_566183.1| zinc finger protein 1 [Arabidopsis thaliana]
 sp|Q8GXX7.1|C3H33_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 33; 
Short=AtC3H33; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN1 [Arabidopsis thaliana]
 dbj|BAC42614.1| putative zinc finger protein 1 zfn1 [Arabidopsis thaliana]
 gb|ABG25055.1| At3g02830 [Arabidopsis thaliana]
 gb|AEE73864.1| zinc finger protein 1 [Arabidopsis thaliana]
Length=397

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLR
Sbjct  261  GYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  320

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  321  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASET  359


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|NP_568332.2| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAD27875.1|AF138872_1 zinc finger protein 3 [Arabidopsis thaliana]
 dbj|BAB09623.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92306.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=368

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 106/153 (69%), Gaps = 26/153 (17%)
 Frame = -2

Query  668  AYGLSRSSEVAN-----------VGSQG--MNPSYRAG-TLPMGYYALQRENVFPERPGQ  531
            +Y  SR+S VAN            GSQG   +  + +G ++P+G+YAL RENVFPERPGQ
Sbjct  187  SYSWSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQ  246

Query  530  PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKF  351
            PECQFYMKTGDCKFG VCKFHHPR+R  PPPD +LS        GEPLC FYSRYGICKF
Sbjct  247  PECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSS-------GEPLCVFYSRYGICKF  299

Query  350  GPSCKFDHPMGVFTYNI-----SPSSTTNAPTV  267
            GPSCKFDHPM VFTYN      SPSS+ +  T 
Sbjct  300  GPSCKFDHPMRVFTYNNNTASPSPSSSLHQETA  332


 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FY+KTG CKFG  CKFHHPR +        ++ +  PLRP E  C+++ 
Sbjct  84   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFL  143

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  144  RIGQCKFGGTCKFNHP  159


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PER G+P+C +Y++TG C+FG+ C+F+HP +R      +       P R G+P C 
Sbjct  36   DGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR-KLVIATARIKGEYPERIGQPECE  94

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  95   FYLKTGTCKFGVTCKFHHP  113



>gb|AAF26977.1|AC018363_22 zinc finger protein 1 (zfn1) [Arabidopsis thaliana]
Length=377

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLR
Sbjct  241  GYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  300

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  301  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASET  339


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  62   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  121

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  122  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  149


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  17   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGVTCKFHHP  91



>gb|AAD33769.1|AF138743_1 zinc finger protein 1 [Arabidopsis thaliana]
Length=424

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLR
Sbjct  261  GYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  320

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  321  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASET  359


 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G PEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGHPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+ +HPR+R      +       P R G P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRVNHPRDR-ELVIATARMRGEYPERIGHPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_006400193.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
 gb|ESQ41646.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
Length=395

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANV-GSQG---MNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            G+ QAY   + S+     GS+G    +  +   ++P GYYAL RENVFPERPGQPEC+FY
Sbjct  211  GSDQAYRNHQQSDAKETSGSRGGLFSSGEHSGNSVPFGYYALPRENVFPERPGQPECEFY  270

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            MKTGDCKFG VCKFHHPR+R  P PD LLSP+GLPLR GEPLC FYSRYGICKFGPSCKF
Sbjct  271  MKTGDCKFGTVCKFHHPRDRQTPAPDCLLSPVGLPLRLGEPLCVFYSRYGICKFGPSCKF  330

Query  332  DHPMGVFTY  306
            DHPM +FTY
Sbjct  331  DHPMRIFTY  339


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPEC+FY+KTG CKFG  CKFHHPR +         S +G PLRP E  C+++ 
Sbjct  64   FPERIGQPECEFYLKTGTCKFGVTCKFHHPRNK---AGRVSHSVLGYPLRPNEDDCSYFL  120

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  121  RTGHCKFGGTCKFNHP  136


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PERPG+P+C +Y++TG C+FG+ C+F+HP +R      +       P R G+P C 
Sbjct  16   DGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATERIKGEFPERIGQPECE  74

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  75   FYLKTGTCKFGVTCKFHHP  93



>ref|XP_010501886.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=400

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 103/141 (73%), Gaps = 11/141 (8%)
 Frame = -2

Query  683  VGNSQAYGLS-RSSEVANVGS------QGMNPSYRAGTLPMG-YYALQRENVFPERPGQP  528
             GN   Y  S + SE    GS       G NP     ++P+G +YAL RENVFPERPGQP
Sbjct  221  TGNDLNYNRSLQQSETKESGSPSQGSFSGFNP---GSSVPLGGFYALPRENVFPERPGQP  277

Query  527  ECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFG  348
            ECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+RYGICKFG
Sbjct  278  ECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFG  337

Query  347  PSCKFDHPMGVFTYNISPSST  285
            PSCKFDHPM VF Y+ + S T
Sbjct  338  PSCKFDHPMRVFAYDNTASET  358


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +G         +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P 
Sbjct  26   LGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPE  84

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R G+P C +Y + G CKFG +CKF HP
Sbjct  85   RIGQPECEYYLKTGTCKFGVTCKFHHP  111



>ref|XP_010501847.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=402

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 103/141 (73%), Gaps = 11/141 (8%)
 Frame = -2

Query  683  VGNSQAYGLS-RSSEVANVGS------QGMNPSYRAGTLPMG-YYALQRENVFPERPGQP  528
             GN   Y  S + SE    GS       G NP     ++P+G +YAL RENVFPERPGQP
Sbjct  223  TGNDLNYNRSLQQSETKESGSPSQGSFSGFNP---GSSVPLGGFYALPRENVFPERPGQP  279

Query  527  ECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFG  348
            ECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FY+RYGICKFG
Sbjct  280  ECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFG  339

Query  347  PSCKFDHPMGVFTYNISPSST  285
            PSCKFDHPM VF Y+ + S T
Sbjct  340  PSCKFDHPMRVFAYDNTASET  360


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  590  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspigl  411
            + +G         +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       
Sbjct  24   MNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEY  82

Query  410  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            P R G+P C +Y + G CKFG +CKF HP
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHP  111



>ref|XP_002882253.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58512.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLR
Sbjct  261  GYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  320

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  276
            PGEPLC FY+RYGICKFGPSCKFDHPM VF Y  + S T  A
Sbjct  321  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYENTASETDEA  362


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_004971057.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Setaria italica]
Length=425

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 110/155 (71%), Gaps = 10/155 (6%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E  + G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+
Sbjct  261  QLQSPGAQQTYGTSQQGE-PSAGNQGMLSPYRSSSFPVPQYALQRENVFPERPDQPECQY  319

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR R +PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CK
Sbjct  320  YMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCK  379

Query  335  FDH----PMGVFTYNI-----SPSSTTNAPTVRHF  258
            FDH    PMGV+ Y         S++TN P  R  
Sbjct  380  FDHPMTAPMGVYAYGFSASASPASASTNVPMARRL  414


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+ +G PLRP E  CA+Y 
Sbjct  110  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPNEKECAYYL  169

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            + G CK+  +CKF HP     +N  PSS
Sbjct  170  KTGQCKYANTCKFHHPE---LFNAVPSS  194


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 69/128 (54%), Gaps = 7/128 (5%)
 Frame = -2

Query  689  LTVGNSQAYGL---SRSSEVANVGSQGMNPSYRAGT---LPMGYYALQRENVFPERPGQP  528
            +TV  + A  L   S ++  A+  S   +  Y  G    + M   A  +   +PERPG+P
Sbjct  13   VTVSATSAPALPPPSATTAAADTSSPDPSALYGEGMWQQMAMNSGATMQPGPYPERPGEP  72

Query  527  ECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFG  348
            +C +Y++TG C+FG  C+F+HP +R      S       P R G+P C +Y + G CKFG
Sbjct  73   DCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERVGQPECQYYLKTGTCKFG  131

Query  347  PSCKFDHP  324
            P+CKF HP
Sbjct  132  PTCKFHHP  139



>gb|KFK25872.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=410

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 1/101 (1%)
 Frame = -2

Query  605  YRAGTLPMGYYA-LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsl  429
            +   ++P+GYYA L RE++FPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD +
Sbjct  254  HSGNSVPLGYYASLAREDLFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPAPDCV  313

Query  428  lspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  306
            LSP+ LPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY
Sbjct  314  LSPVDLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTY  354


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER  QP+CQFY+KTG CKFG  CKFHHPR          ++ +G PLRP E  C+++ 
Sbjct  77   YPERIDQPDCQFYLKTGTCKFGVTCKFHHPRNNADIAGSVSVNALGYPLRPEEDDCSYFL  136

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  137  RTGHCKFGGTCKFNHP  152


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 3/93 (3%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
            ++PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R  +P C FY
Sbjct  31   LYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-KLVIATARIRGEYPERIDQPDCQFY  89

Query  374  SRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  276
             + G CKFG +CKF HP      +I+ S + NA
Sbjct  90   LKTGTCKFGVTCKFHHPRN--NADIAGSVSVNA  120



>ref|XP_006408378.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49831.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=385

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R +PPPD LLSPIGLPLR
Sbjct  258  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLR  317

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  318  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASET  356


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+    TG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECE----TGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  137

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  138  RTGHCKFGGTCKFNHPQPQPTTNM  161


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 5/76 (7%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P C ++++TG C+FG+ C+F+HPR+R      +       P R G+P C    
Sbjct  37   YPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPEC----  91

Query  371  RYGICKFGPSCKFDHP  324
              G CKFG SCKF HP
Sbjct  92   ETGTCKFGVSCKFHHP  107



>ref|XP_006408377.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49830.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=369

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R +PPPD LLSPIGLPLR
Sbjct  242  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLR  301

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  302  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASET  340


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  62   YPERIGQPECEYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  121

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  122  RTGHCKFGGTCKFNHPQPQPTTNM  145


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P C ++++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  17   YPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  75

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG SCKF HP
Sbjct  76   KTGTCKFGVSCKFHHP  91



>ref|XP_010485612.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Camelina 
sativa]
Length=401

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLR
Sbjct  262  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  321

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  322  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASET  360


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_006408379.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49832.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=389

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R +PPPD LLSPIGLPLR
Sbjct  262  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLR  321

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  322  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASET  360


 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTTNM  165


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P C ++++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG SCKF HP
Sbjct  96   KTGTCKFGVSCKFHHP  111



>ref|XP_010463710.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=402

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLR
Sbjct  261  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  320

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  321  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASET  359


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFI  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_010463709.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=404

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLR
Sbjct  263  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  322

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  323  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASET  361


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFI  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            +G         +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P 
Sbjct  26   LGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPE  84

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R G+P C +Y + G CKFG +CKF HP
Sbjct  85   RIGQPECEYYLKTGTCKFGVTCKFHHP  111



>gb|ACF80171.1| unknown [Zea mays]
 tpg|DAA56153.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=320

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+
Sbjct  156  QLQSPGAQQTYGSSQQGE-ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQY  214

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CK
Sbjct  215  YMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCK  274

Query  335  FDHPMGV  315
            FDHP  V
Sbjct  275  FDHPTVV  281


 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+  G PLRP E  CA+Y 
Sbjct  5    YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  64

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            + G CK+  +CKF HP     +N+ PSS
Sbjct  65   KTGHCKYANTCKFHHPE---LFNVVPSS  89



>ref|NP_001132883.1| uncharacterized protein LOC100194377 [Zea mays]
 gb|ACF81912.1| unknown [Zea mays]
Length=430

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E A+ G+QGM   YR+ + P+  YALQRENVFPERP +PECQ+
Sbjct  266  QLQSPGAQQTYGSSQQGE-ASTGNQGMLSPYRSSSFPVPQYALQRENVFPERPDEPECQY  324

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CK
Sbjct  325  YMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCK  384

Query  335  FDHPMGV  315
            FDHP  V
Sbjct  385  FDHPTVV  391


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+  G PLRP E  CA+Y 
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  174

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            + G CK+  +CKF HP     +N+ PSS
Sbjct  175  KTGHCKYANTCKFHHPE---LFNVVPSS  199


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A  +   +PERPG+P+C +Y++TG C+FG  C+F+HP +R      S       P R G+
Sbjct  63   ATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERAGQ  121

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
            P C +Y + G CKFGP+CKF HP
Sbjct  122  PECQYYLKTGTCKFGPTCKFHHP  144



>emb|CDY51531.1| BnaA05g33310D [Brassica napus]
Length=395

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 103/138 (75%), Gaps = 5/138 (4%)
 Frame = -2

Query  683  VGNSQ-AYGLSRSSEVANVGS--QGMNPSYRAGT-LPMG-YYALQRENVFPERPGQPECQ  519
             GN Q +Y   + SE+   GS  QG       G+ +P+G +YAL  E+VFPERPGQPECQ
Sbjct  227  TGNDQTSYRNMQQSEIKESGSHSQGSFSGLNTGSSVPLGGFYALPSESVFPERPGQPECQ  286

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            FYMKTGDCKFG VCKFHHPR+R  PPPD LLS IGLPLRPGEPLC FYSRYGICKFGPSC
Sbjct  287  FYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSTIGLPLRPGEPLCVFYSRYGICKFGPSC  346

Query  338  KFDHPMGVFTYNISPSST  285
            KF HPM VF Y+ + S T
Sbjct  347  KFHHPMEVFAYDNTASET  364


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P C +Y++TG C+FG+ C+F+HP +R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_006287837.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
 gb|EOA20735.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
Length=418

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 3/111 (3%)
 Frame = -2

Query  629  GSQG--MNPSYRAG-TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            GSQG   +  + +G ++P+G YAL  ENVFPERPGQ EC+FYMKTGDCKFG VCKFHHPR
Sbjct  253  GSQGGVFSSGFHSGNSVPLGQYALPSENVFPERPGQLECEFYMKTGDCKFGTVCKFHHPR  312

Query  458  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  306
             R  P PD +LS +GLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY
Sbjct  313  NRQTPAPDCVLSTVGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTY  363


 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FY+KTG CKFG  CKFHHPR +        ++ +G PLRP E  C+++ 
Sbjct  87   YPERIGQPECEFYIKTGTCKFGVTCKFHHPRNKAGIDERVSVNVLGYPLRPNEDDCSYFL  146

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG SCKF+HP
Sbjct  147  RTGHCKFGGSCKFNHP  162


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            + ++PERPG+P+C +Y++TG C+FG+ C+F+HP +R      +  +    P R G+P C 
Sbjct  39   DGLYPERPGEPDCSYYIRTGLCRFGSTCRFNHPYDR-KLVIATARTKGEYPERIGQPECE  97

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  98   FYIKTGTCKFGVTCKFHHP  116



>tpg|DAA56151.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=430

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+
Sbjct  266  QLQSPGAQQTYGSSQQGE-ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQY  324

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CK
Sbjct  325  YMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCK  384

Query  335  FDHPMGV  315
            FDHP  V
Sbjct  385  FDHPTVV  391


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+  G PLRP E  CA+Y 
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  174

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            + G CK+  +CKF HP     +N+ PSS
Sbjct  175  KTGHCKYANTCKFHHPE---LFNVVPSS  199


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A  +   +PERPG+P+C +Y++TG C+FG  C+F+HP +R      S       P R G+
Sbjct  63   ATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERAGQ  121

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
            P C +Y + G CKFGP+CKF HP
Sbjct  122  PECQYYLKTGTCKFGPTCKFHHP  144



>emb|CDX74233.1| BnaA03g28140D [Brassica napus]
Length=365

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLSPIGLPLR
Sbjct  230  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  289

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FYSRY ICKFGPSCKF HPMGVFTY+ + S T
Sbjct  290  PGEPLCVFYSRYRICKFGPSCKFHHPMGVFTYDNTASET  328


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  68   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  127

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  128  RTGHCKFGATCKFNHPQPQPTTNL  151


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  23   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  81

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  82   KTGTCKFGVTCKFHHP  97



>emb|CDY28712.1| BnaCnng05980D [Brassica napus]
Length=390

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = -2

Query  599  AGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdslls  423
            A ++P+G ++AL  E+VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS
Sbjct  254  ASSVPLGGFFALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLS  313

Query  422  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PIGLPLRPGEPLC FYSRYGICKFGPSCKF HPM VF Y+ + S T
Sbjct  314  PIGLPLRPGEPLCVFYSRYGICKFGPSCKFHHPMEVFAYDNTASET  359


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P C +Y++TG C+FG+ C+F+HP +R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_010558591.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
[Tarenaya hassleriana]
Length=397

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G+YAL RENVFPE+PGQPECQFYMKTGDCKFG+VCKFHHPR R  P PD +LSPIGLPLR
Sbjct  264  GFYALPRENVFPEKPGQPECQFYMKTGDCKFGSVCKFHHPRNRQNPAPDCVLSPIGLPLR  323

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FYSRYGICKFGPSCKFDHPM     +++P  T
Sbjct  324  PGEPLCGFYSRYGICKFGPSCKFDHPMQRVFTSMNPEET  362


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPR ++    +  L+ +G P+RP E  CA+Y 
Sbjct  87   YPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKVGIAGNVSLNALGYPIRPNEVDCAYYL  146

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  147  RTGHCKFGSTCKFNHP  162


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -2

Query  554  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFY  375
             +P+RPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y
Sbjct  41   AYPDRPGEPDCAYYIRTGLCRFGSTCRFNHPRDR-NLAIATARMKGEYPERIGQPECQYY  99

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKF HP
Sbjct  100  LKTGTCKFGVTCKFHHP  116



>ref|XP_004495537.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Cicer arietinum]
Length=389

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -2

Query  569  LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppds-llspiglpLRPGE  393
            LQREN+FP+RPGQPECQFYMKTGDCKFGAVC+FHHP +RLIP P   LLS +GLPLR GE
Sbjct  234  LQRENIFPDRPGQPECQFYMKTGDCKFGAVCRFHHPHQRLIPVPPDCLLSSLGLPLRHGE  293

Query  392  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  258
            PLC FYSRYGICKFGPSCKFDHPMG+F+YN+S S   ++ T RH 
Sbjct  294  PLCVFYSRYGICKFGPSCKFDHPMGIFSYNLSASPLADS-TGRHL  337


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQFY+KTG CKFGA CKFHHPR++        L+ +G PLRP E  C++Y 
Sbjct  82   FPERIGQPECQFYLKTGTCKFGATCKFHHPRDQAGISGRVALNILGYPLRPTEAECSYYL  141

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  142  RTGECKFGNTCKFHHP  157


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P RPG+P+C +Y++TG C+FGA C+F+HP         +       P R G+P C FY 
Sbjct  37   YPHRPGEPDCSYYIRTGLCRFGATCRFNHP-PNANLAIVTARMIGEFPERIGQPECQFYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGATCKFHHP  111


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG+CKFG  CKFHHP+
Sbjct  128  YPLRPTEAECSYYLRTGECKFGNTCKFHHPQ  158



>emb|CDX92015.1| BnaC03g33170D [Brassica napus]
Length=371

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G YAL  E+VFPERPGQPECQFY+KTGDCKFG VCKFHHPR+R  PPPD LLSPIGLPLR
Sbjct  236  GIYALPSESVFPERPGQPECQFYVKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  295

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEP C FYSRYGICKFGPSCKF HPMGVFTY+ + S T
Sbjct  296  PGEPSCVFYSRYGICKFGPSCKFHHPMGVFTYDNTASET  334


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  75   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLR-NEVDCAYFL  133

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  134  RTGHCKFGATCKFNHPQPQPTTNL  157


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  30   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  88

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  89   KTGTCKFGVTCKFHHP  104



>ref|XP_009147316.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Brassica 
rapa]
Length=392

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = -2

Query  599  AGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdslls  423
            A ++P+G +YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLS
Sbjct  256  ASSVPLGGFYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLS  315

Query  422  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PIGLPLRPGEPLC FYSRY ICKFGPSCKF HPM VF Y+ + S T
Sbjct  316  PIGLPLRPGEPLCVFYSRYRICKFGPSCKFHHPMEVFAYDNTASET  361


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P C +Y++TG C+FG+ C+F+HP +R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_009134713.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=377

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLSPIGLPLR
Sbjct  242  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  301

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FYSRY ICKFGPSCKF  PMGVFTY+ + S T
Sbjct  302  PGEPLCVFYSRYRICKFGPSCKFHPPMGVFTYDNTASET  340


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  142  RTGHCKFGATCKFNHPQPQPTTNL  165


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR--ELVIATAMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_009134712.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=379

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -2

Query  581  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLR  402
            G YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  PPPD LLSPIGLPLR
Sbjct  244  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  303

Query  401  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            PGEPLC FYSRY ICKFGPSCKF  PMGVFTY+ + S T
Sbjct  304  PGEPLCVFYSRYRICKFGPSCKFHPPMGVFTYDNTASET  342


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  141

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  142  RTGHCKFGATCKFNHPQPQPTTNL  165


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR--ELVIATAMRGEYPERIGQPECEYYL  95

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>emb|CDY53749.1| BnaAnng12770D [Brassica napus]
Length=374

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            ENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD LLSPIGLPLRPGEP+C 
Sbjct  245  ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCV  304

Query  380  FYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            FYSRYGICKFGPSCKF+HPM VF Y+ + S T
Sbjct  305  FYSRYGICKFGPSCKFNHPMEVFAYDNTASET  336


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  143  RTGHCKFGATCKFNHPQPQPTTNL  166


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  96

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>ref|XP_009118604.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=374

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            ENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD LLSPIGLPLRPGEP+C 
Sbjct  245  ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCV  304

Query  380  FYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            FYSRYGICKFGPSCKF+HPM +F Y+ + S T
Sbjct  305  FYSRYGICKFGPSCKFNHPMEIFAYDNTASET  336


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  143  RTGHCKFGATCKFNHPQPQPTTNL  166


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  96

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>emb|CDY67901.1| BnaCnng56860D [Brassica napus]
Length=374

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            ENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD LLSPIGLPLRPGEP+C 
Sbjct  245  ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCV  304

Query  380  FYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            FYSRYGICKFGPSCKF+HPM +F Y+ + S T
Sbjct  305  FYSRYGICKFGPSCKFNHPMEIFAYDNTASET  336


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  143  RTGHCKFGATCKFNHPQPQPTTNL  166


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  96

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>ref|XP_009118612.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=372

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            ENVFPERPGQPECQFYMKTGDCKFG VCKFHHPR+R  P PD LLSPIGLPLRPGEP+C 
Sbjct  243  ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCV  302

Query  380  FYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
            FYSRYGICKFGPSCKF+HPM +F Y+ + S T
Sbjct  303  FYSRYGICKFGPSCKFNHPMEIFAYDNTASET  334


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC++Y+KTG CKFG  CKFHHPR +        L+ +G PLR  E  CA++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  371  RYGICKFGPSCKFDHPMGVFTYNI  300
            R G CKFG +CKF+HP    T N+
Sbjct  143  RTGHCKFGATCKFNHPQPQPTTNL  166


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FG+ C+F+HPR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  96

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>ref|XP_010453818.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 57-like [Camelina sativa]
Length=420

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 97/133 (73%), Gaps = 10/133 (8%)
 Frame = -2

Query  689  LTVGNSQAYGLSRSSEVA-NVGSQG--MNPSYRAGT-LPMGYYALQRENVFPERPGQPEC  522
            L  G+ Q Y   + ++   + GSQG   +  + +G+ +P+G YA      FPERPGQ EC
Sbjct  239  LPXGSDQNYRNQQQNDAEESSGSQGGLFSSEFHSGSYVPLGLYA------FPERPGQLEC  292

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            QFYMKTGDCKFG VCKFHHPR+R  P PD +LS +GLPLR GEPLC FYSRYGICKFGPS
Sbjct  293  QFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPS  352

Query  341  CKFDHPMGVFTYN  303
            CKFDHPMGV TYN
Sbjct  353  CKFDHPMGVLTYN  365


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FYMKTG CKFG  CKFHHP  +        ++ +G PLRP E  C+++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPSNKAGIDGRVSINVLGYPLRPNEDDCSYFL  147

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PER G+P+C +Y++TG C+FG+ C+F+HP +R      + ++    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATAMTKGEYPERIGQPECE  98

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|XP_010492565.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
[Camelina sativa]
Length=418

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 96/130 (74%), Gaps = 10/130 (8%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVA-NVGSQG--MNPSYRAGT-LPMGYYALQRENVFPERPGQPECQFY  513
            G+ Q Y   R ++   + GSQG   +  + +G+ +P+  YA      FPERPGQ ECQFY
Sbjct  239  GSDQNYRNQRQNDAEESSGSQGGLFSSEFHSGSSVPLCLYA------FPERPGQLECQFY  292

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            MKTGDCKFG VCKFHHPR+R  P PD +LS +GLPLR GEPLC FYSRYGICKFGPSCKF
Sbjct  293  MKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKF  352

Query  332  DHPMGVFTYN  303
            DHPMGVFTYN
Sbjct  353  DHPMGVFTYN  362


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FYMKTG CKFG  CKFHHPR                PLRP E  C+++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPRNN---AGTDDGRVSVYPLRPNEDDCSYFL  144

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  145  RTGHCKFGGTCKFNHP  160


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PER G+P+C +Y++TG C+FG+ C+F+HP +R      +  +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATARAKGEYPERIGQPECE  98

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|XP_008672228.1| PREDICTED: uncharacterized protein LOC100194377 isoform X1 [Zea 
mays]
Length=410

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 82/127 (65%), Gaps = 21/127 (17%)
 Frame = -2

Query  695  QQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  + G  Q YG S+  E A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+
Sbjct  266  QLQSPGAQQTYGSSQQGE-ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQY  324

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            YMKTGDCKFGAVCKFHHPR                    GE LC FYSRYGICKFG +CK
Sbjct  325  YMKTGDCKFGAVCKFHHPR--------------------GEELCKFYSRYGICKFGANCK  364

Query  335  FDHPMGV  315
            FDHP  V
Sbjct  365  FDHPTVV  371


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFG  CKFHHPRE+        L+  G PLRP E  CA+Y 
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  174

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSS  288
            + G CK+  +CKF HP     +N+ PSS
Sbjct  175  KTGHCKYANTCKFHHPE---LFNVVPSS  199


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  590  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspigl  411
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F+HP +R      S       
Sbjct  57   MAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  115

Query  410  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  116  PERAGQPECQYYLKTGTCKFGPTCKFHHP  144



>gb|EYU22370.1| hypothetical protein MIMGU_mgv1a005385mg [Erythranthe guttata]
Length=485

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q  VG +Q YG+++ S  A   +    P   AG       + Q+E+ FPERPGQPECQ
Sbjct  262  SNQPPVGGAQIYGITQLSSSATAYAGPYMPITSAGQS----SSSQKEHAFPERPGQPECQ  317

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +Y++TGDCKFGA CK+HHP E  +P  + +LS +GLPLRPG PLC+ Y++ G+CKFGPSC
Sbjct  318  YYLRTGDCKFGATCKYHHPSEWSVPRGNFVLSAMGLPLRPGAPLCSHYAQNGMCKFGPSC  377

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPM   +Y+ S SS T+ P  
Sbjct  378  KFDHPMKTLSYSPSASSLTDMPVA  401


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFG  CK+ HP+  L     + L+  G PLRPGE  C++Y+
Sbjct  92   YPERVGQPICQYYMRTGMCKFGTSCKYDHPKHGLGSSAPAGLNFYGYPLRPGEKECSYYA  151

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CK+ HP
Sbjct  152  KTGQCKFGVTCKYHHP  167


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP +P+  +Y++ G C++G  C+F+HPR R +            P R G+P+C +Y 
Sbjct  46   YPERPDEPDRMYYLRIGFCRYGNRCRFNHPRVRSMVMGALRAGGGEYPERVGQPICQYYM  105

Query  371  RYGICKFGPSCKFDHP  324
            R G+CKFG SCK+DHP
Sbjct  106  RTGMCKFGTSCKYDHP  121


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y KTG CKFG  CK+HHP+
Sbjct  138  YPLRPGEKECSYYAKTGQCKFGVTCKYHHPQ  168



>ref|XP_011090931.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Sesamum 
indicum]
Length=496

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 96/144 (67%), Gaps = 3/144 (2%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q TVG    YGL++ S  A   +    P     +      + Q+E+ FPERPGQPECQ
Sbjct  268  SAQPTVGPGPIYGLTQLSPSATAYT---GPFLSVTSSAGPSSSSQKEHPFPERPGQPECQ  324

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +Y+KTGDCKFGA CK+HHP E   P  + +LSP+GLPLRPG PLC+ Y++ G+CKFGPSC
Sbjct  325  YYLKTGDCKFGATCKYHHPPEWSAPKINFVLSPMGLPLRPGAPLCSHYAQNGVCKFGPSC  384

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPM + +Y+ S SS T+ P  
Sbjct  385  KFDHPMRILSYSPSASSLTDMPVA  408


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP+  +       L+  G PLRPGE  C++Y 
Sbjct  102  YPERAGQPVCQYYMRTGMCKFGASCKYHHPKHGVGSSAPVTLNVYGYPLRPGEKECSYYV  161

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  162  KTGQCKFGVTCKFHHP  177


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP +P+C +Y++TG C +G  C+F+HPR+R +            P R G+P+C +Y 
Sbjct  56   YPERPDEPDCIYYLRTGFCGYGNRCRFNHPRDRSMAMGALRAGGGEYPERAGQPVCQYYM  115

Query  371  RYGICKFGPSCKFDHP  324
            R G+CKFG SCK+ HP
Sbjct  116  RTGMCKFGASCKYHHP  131


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y+KTG CKFG  CKFHHP+
Sbjct  148  YPLRPGEKECSYYVKTGQCKFGVTCKFHHPQ  178



>ref|XP_006397979.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
 gb|ESQ39432.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
Length=525

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 93/142 (65%), Gaps = 5/142 (4%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ S        G+ PS  +   P G   LQ+E  FPERPG+PECQ+Y
Sbjct  300  QHAVGATSLYGVTQLSSTTASLPPGVYPSLSS---PTGI--LQKEQTFPERPGEPECQYY  354

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKF
Sbjct  355  LKTGDCKFGTSCKFHHPRDRIPPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKF  414

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  415  DHPMGTIRYNPSASSLADAPVA  436


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A++    +PER G+P CQFY+KTG CKFGA CKFHHP+          L+  G P+R GE
Sbjct  135  AVRATGQYPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGE  194

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
              C++Y + G CKFG +CKF HP
Sbjct  195  KDCSYYLKTGQCKFGITCKFHHP  217


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -2

Query  557  NVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAF  378
              +PERPG P+C +YM+TG C +G  C+++HPR+R      ++ +    P R GEP C F
Sbjct  95   ETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ATVEAAVRATGQYPERIGEPPCQF  153

Query  377  YSRYGICKFGPSCKFDHP  324
            Y + G CKFG SCKF HP
Sbjct  154  YLKTGTCKFGASCKFHHP  171



>ref|XP_007222805.1| hypothetical protein PRUPE_ppa005056mg [Prunus persica]
 gb|EMJ24004.1| hypothetical protein PRUPE_ppa005056mg [Prunus persica]
Length=479

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 94/144 (65%), Gaps = 1/144 (1%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q  VG+   YG+S+ S  A   +    P     +L +   + Q+E++FPERPGQPECQ
Sbjct  250  STQPGVGSGTLYGMSQLSPSAAAYTGMYQPIPLPSSLGLPTTS-QKEHLFPERPGQPECQ  308

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YM+TGDCKFG+ C++HHP E + P     LSP GLP RPG PLC  Y++ G+CKFGP+C
Sbjct  309  YYMRTGDCKFGSSCRYHHPPEVVGPKTTVALSPSGLPSRPGAPLCTHYAQRGVCKFGPAC  368

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG  +Y+ S SS  + P  
Sbjct  369  KFDHPMGTLSYSPSASSLADMPVA  392


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLR GE  C++Y 
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSGSPVSLNYYGYPLRQGERECSYYV  148

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  149  KTGQCKFGATCKFHHP  164


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M    L     +PERP + +C +Y++TG C +G+ C+++HPR+R      +    +  P 
Sbjct  32   MWQLGLGPGESYPERPNETDCSYYLRTGICGYGSRCRYNHPRDRSAVTGAARPGGLEYPE  91

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R G+P+C +Y R G CKFG SCK+ HP
Sbjct  92   RAGQPVCQYYMRTGTCKFGASCKYHHP  118


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P R G+ EC +Y+KTG CKFGA CKFHHP+
Sbjct  135  YPLRQGERECSYYVKTGQCKFGATCKFHHPQ  165



>ref|XP_008223126.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Prunus 
mume]
Length=479

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 94/144 (65%), Gaps = 1/144 (1%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q  VG+   YG+S+ S  A   +    P     +L +   + Q+E++FPERPGQPECQ
Sbjct  250  STQPGVGSGTLYGMSQLSPSAAAYTGMYQPIPLPSSLGLPTTS-QKEHLFPERPGQPECQ  308

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YM+TGDCKFG+ C++HHP E + P     L+P GLP RPG PLC  Y++ G+CKFGP+C
Sbjct  309  YYMRTGDCKFGSSCRYHHPPEVVGPKTTVALNPSGLPSRPGAPLCTHYAQRGVCKFGPAC  368

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG  +Y+ S SS  + P  
Sbjct  369  KFDHPMGTLSYSPSASSLADMPVA  392


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLR GE  C++Y 
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSSSPVSLNYYGYPLRQGERECSYYV  148

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  149  KTGQCKFGATCKFHHP  164


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M    L     +PERP + +C +Y++TG C +G+ C+++HPR+R      +    +  P 
Sbjct  32   MWQLGLGPGESYPERPNETDCSYYLRTGICGYGSRCRYNHPRDRSAVTGGARPGGLEYPE  91

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R G+P+C +Y R G CKFG SCK+ HP
Sbjct  92   RAGQPVCQYYMRTGTCKFGASCKYHHP  118


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P R G+ EC +Y+KTG CKFGA CKFHHP+
Sbjct  135  YPLRQGERECSYYVKTGQCKFGATCKFHHPQ  165



>ref|XP_002276435.1| PREDICTED: zinc finger CCCH domain-containing protein 34 isoform 
X1 [Vitis vinifera]
 emb|CBI26091.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 94/144 (65%), Gaps = 3/144 (2%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q TVG+ Q YGL+  S  A   +    P     +      + Q+E +FPERPGQPECQ
Sbjct  254  STQPTVGSGQMYGLTPLSPSAPAYT---GPYTPLPSSVGPSSSSQKEQIFPERPGQPECQ  310

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YM+TGDCKFG+ CK+HHP E   P  + +LSP+GLPLRPG P C  Y++ GICKFGP+C
Sbjct  311  YYMRTGDCKFGSSCKYHHPPEWDTPKTNCVLSPMGLPLRPGAPQCTHYAQRGICKFGPTC  370

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG  +Y+ S SS  + P  
Sbjct  371  KFDHPMGTLSYSPSASSLADMPVA  394


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQP CQFYMKTG CKFGA CK+HHPR+         L+  G PLRPGE  C++Y 
Sbjct  92   FPERVGQPVCQFYMKTGTCKFGASCKYHHPRQGGGTVSPVTLNYFGYPLRPGEKECSYYV  151

Query  371  RYGICKFGPSCKFDHP  324
            + G+CKFG +CKF HP
Sbjct  152  KTGLCKFGETCKFHHP  167


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  557  NVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAF  378
              +PERP + +C +Y+KTG C +GA C+F+HPR+R              P R G+P+C F
Sbjct  44   EAYPERPDEADCIYYLKTGFCGYGARCRFNHPRDRGGVGGTVRPGGGEFPERVGQPVCQF  103

Query  377  YSRYGICKFGPSCKFDHP  324
            Y + G CKFG SCK+ HP
Sbjct  104  YMKTGTCKFGASCKYHHP  121


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y+KTG CKFG  CKFHHP+
Sbjct  138  YPLRPGEKECSYYVKTGLCKFGETCKFHHPQ  168



>emb|CAN78551.1| hypothetical protein VITISV_003243 [Vitis vinifera]
Length=518

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 94/144 (65%), Gaps = 3/144 (2%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q TVG+ Q YGL+  S  A   +    P     +      + Q+E +FPERPGQPECQ
Sbjct  294  STQPTVGSGQMYGLTPLSPSAPAYT---GPYTPLPSSVGPSSSSQKEQIFPERPGQPECQ  350

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YM+TGDCKFG+ CK+HHP E   P  + +LSP+GLPLRPG P C  Y++ GICKFGP+C
Sbjct  351  YYMRTGDCKFGSSCKYHHPPEWDTPKTNCVLSPMGLPLRPGAPQCTHYAQRGICKFGPTC  410

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG  +Y+ S SS  + P  
Sbjct  411  KFDHPMGTLSYSPSASSLADMPVA  434


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQP CQFYMKTG CKFGA CK+HHPR+         L+  G PLRPGE  C++Y 
Sbjct  132  FPERVGQPVCQFYMKTGTCKFGASCKYHHPRQGGGTVSPVTLNYFGYPLRPGEKECSYYV  191

Query  371  RYGICKFGPSCKFDHP  324
            + G+CKFG +CKF HP
Sbjct  192  KTGLCKFGETCKFHHP  207


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  557  NVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAF  378
              +PERP + +C +Y+KTG C +GA C+F+HPR+R              P R G+P+C F
Sbjct  84   EAYPERPDEADCIYYLKTGFCGYGARCRFNHPRDRGGVGGTVRPGGGEFPERVGQPVCQF  143

Query  377  YSRYGICKFGPSCKFDHP  324
            Y + G CKFG SCK+ HP
Sbjct  144  YMKTGTCKFGASCKYHHP  161


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y+KTG CKFG  CKFHHP+
Sbjct  178  YPLRPGEKECSYYVKTGLCKFGETCKFHHPQ  208



>ref|XP_004987433.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Setaria italica]
Length=134

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+ QQ T G +Q Y  S  SE   +G  GM PSY+AG++P+G YA+Q EN+FPERP QPE
Sbjct  6    PDDQQRTPGTNQYYTSSHQSETTGMGEHGMYPSYQAGSVPVGLYAVQGENIFPERPDQPE  65

Query  524  CQFYMKTGDCKFGAVCKFHHPRER  453
            CQFYMKTGDCKFGAVCKF+HP+ER
Sbjct  66   CQFYMKTGDCKFGAVCKFNHPKER  89



>gb|KCW84570.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=345

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            +SQ + +G SQ +G S  S+  N GS G   SY++G++P+G+YALQR+N+FPERPGQPEC
Sbjct  243  DSQLIMMGQSQIFGSSGQSDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPEC  302

Query  521  QFYMKTGDCKFGAVCKFHHPRER  453
            QFYMKTGDCKFGAVC+FHHPRER
Sbjct  303  QFYMKTGDCKFGAVCRFHHPRER  325


 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G P RP E  CA+Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP +R      +       P R G+P C +Y 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDR-KLAIANARMKGEYPERVGQPECQYYL  100

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  101  KTGTCKFGATCKFHHP  116


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG+ CKFHHP+
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQ  163



>gb|KJB75169.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=361

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPEC  522
            E+ Q T GN+Q YG SR +E A+ GSQ +   +R+G+ P+G+YALQRENVFPERPG+ EC
Sbjct  251  ENLQQTNGNNQIYGTSRPNESASAGSQALFSQFRSGSAPVGFYALQRENVFPERPGELEC  310

Query  521  QFYMKTGDCKFGAVCKFHHPRER  453
            QFYMKTGDCKFGAVC+FHHPRER
Sbjct  311  QFYMKTGDCKFGAVCRFHHPRER  333


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQPECQ+Y+KTG CKFGA CKFHHPR++        L+ +G PLRP E  CA+Y 
Sbjct  94   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYL  153

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF HP
Sbjct  154  RTGQCKFGSTCKFHHP  169


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C+FGA C+F+HP  R      +       P R G+P C +Y 
Sbjct  49   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAITTARMKGEFPERVGQPECQYYL  107

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  108  KTGTCKFGATCKFHHP  123



>gb|ACN40302.1| unknown [Picea sitchensis]
Length=468

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 92/135 (68%), Gaps = 7/135 (5%)
 Frame = -2

Query  701  ESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAG-------TLPMGYYALQRENVFPE  543
            + QQ  +G    YG S  ++    G QG    +  G       TL +   + QRE++FPE
Sbjct  265  DGQQQAMGAGLVYGPSSQTDPMASGIQGTLSHFPPGSPGMGPPTLQLPSSSAQRESMFPE  324

Query  542  RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYG  363
            RPGQ ECQFYMKTGDCKFG  C++HHP+ER+IP P+ +L+ +GLPLRPG P C F++RYG
Sbjct  325  RPGQQECQFYMKTGDCKFGMTCRYHHPKERIIPVPNCVLNSLGLPLRPGAPACTFFTRYG  384

Query  362  ICKFGPSCKFDHPMG  318
            ICKFG +CKFDHPMG
Sbjct  385  ICKFGATCKFDHPMG  399


 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHPR++      ++++  G PLRP E
Sbjct  98   AARNKGEYPERLGQPECQYYLKTGSCKFGATCKFHHPRDKAGSTGRAVINVYGYPLRPNE  157

Query  392  PLCAFYSRYGICKFGPSCKFDHPMGVFT  309
              CA+Y R G CK+G +CKF HP  V T
Sbjct  158  KECAYYMRTGQCKYGATCKFHHPQPVST  185



>ref|XP_002880326.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56585.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 93/142 (65%), Gaps = 6/142 (4%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ S        G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y
Sbjct  248  QHAVGATSLYGVTQLSST-TPSLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYY  301

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKF
Sbjct  302  LKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKF  361

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  362  DHPMGTIRYNPSASSLADAPVA  383


 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A++    +PER G+P CQFY+KTG CKFGA CKFHHP+          L+  G P+R G+
Sbjct  82   AVRATGQYPERLGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMTHVPLNIYGYPVREGD  141

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
              C++Y + G CKFG +CKF HP
Sbjct  142  NECSYYLKTGQCKFGITCKFHHP  164


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG P+C +YM+TG C +G  C+++HPR+R      ++ +    P R GEP C FY 
Sbjct  44   YPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEAAVRATGQYPERLGEPPCQFYL  102

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG SCKF HP
Sbjct  103  KTGTCKFGASCKFHHP  118



>ref|XP_009802826.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
isoform X2 [Nicotiana sylvestris]
Length=492

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 95/144 (66%), Gaps = 4/144 (3%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            + Q   G    YGL++ S  A     G + S  A   P G  ++Q+E+ FPERPGQPECQ
Sbjct  265  TTQPAAGAGPVYGLTQLSASAP-SYMGPHTSLTASIGPSG--SIQKEHAFPERPGQPECQ  321

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YMK GDCKFG+ C++HHP E   P    +LS +GLPLRPG P+C+ YS+ G+CKFGPSC
Sbjct  322  YYMKYGDCKFGSSCRYHHPPEWSGPKLGFILSAMGLPLRPGAPICSHYSQNGVCKFGPSC  381

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG+ +Y+ S SS  + P  
Sbjct  382  KFDHPMGI-SYSPSASSLVDMPVA  404


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHPR+    P     +  G PLRPGE  C FY 
Sbjct  94   YPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPGEKECLFYM  153

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  154  KTGQCKFGITCKFHHP  169


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 55/95 (58%), Gaps = 11/95 (12%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp-----LRPGEPL  387
            +PERP + +C +Y++TG C +G+ C+F+HP +R +    +     G        R G+P+
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGGGEGEYPERVGQPV  102

Query  386  CAFYSRYGICKFGPSCKFDHPM------GVFTYNI  300
            C +Y R G+CKFG SCK+ HP        + T+NI
Sbjct  103  CQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNI  137


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -2

Query  572  ALQRENVF--PERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            AL   N++  P RPG+ EC FYMKTG CKFG  CKFHHP+
Sbjct  131  ALMTHNIYGYPLRPGEKECLFYMKTGQCKFGITCKFHHPQ  170



>ref|XP_009802825.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana sylvestris]
Length=496

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 95/144 (66%), Gaps = 4/144 (3%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            + Q   G    YGL++ S  A     G + S  A   P G  ++Q+E+ FPERPGQPECQ
Sbjct  269  TTQPAAGAGPVYGLTQLSASAP-SYMGPHTSLTASIGPSG--SIQKEHAFPERPGQPECQ  325

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YMK GDCKFG+ C++HHP E   P    +LS +GLPLRPG P+C+ YS+ G+CKFGPSC
Sbjct  326  YYMKYGDCKFGSSCRYHHPPEWSGPKLGFILSAMGLPLRPGAPICSHYSQNGVCKFGPSC  385

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG+ +Y+ S SS  + P  
Sbjct  386  KFDHPMGI-SYSPSASSLVDMPVA  408


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRP----GEPLC  384
            +PER GQP CQ+YM+TG CKFGA CK+HHPR+    P     +  G PLRP    GE  C
Sbjct  94   YPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPFLAQGEKEC  153

Query  383  AFYSRYGICKFGPSCKFDHP  324
             FY + G CKFG +CKF HP
Sbjct  154  LFYMKTGQCKFGITCKFHHP  173


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 55/95 (58%), Gaps = 11/95 (12%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp-----LRPGEPL  387
            +PERP + +C +Y++TG C +G+ C+F+HP +R +    +     G        R G+P+
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGGGEGEYPERVGQPV  102

Query  386  CAFYSRYGICKFGPSCKFDHPM------GVFTYNI  300
            C +Y R G+CKFG SCK+ HP        + T+NI
Sbjct  103  CQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNI  137


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 6/44 (14%)
 Frame = -2

Query  572  ALQRENVF--PERP----GQPECQFYMKTGDCKFGAVCKFHHPR  459
            AL   N++  P RP    G+ EC FYMKTG CKFG  CKFHHP+
Sbjct  131  ALMTHNIYGYPLRPFLAQGEKECLFYMKTGQCKFGITCKFHHPQ  174



>ref|XP_006294140.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27038.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=445

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 93/142 (65%), Gaps = 6/142 (4%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ S        G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y
Sbjct  221  QHAVGATSLYGVTQLSST-TPSLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYY  274

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKF
Sbjct  275  LKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKF  334

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  335  DHPMGNIRYNPSASSLADAPVA  356


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
               +PERPG P+C +YM+TG C +G  C+++HPR+R      ++ +    P R GEP C 
Sbjct  41   SETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERIGEPPCQ  99

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF HP
Sbjct  100  FYLKTGTCKFGASCKFHHP  118


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +PER G+P CQFY+KTG CKFGA CKFHHP+
Sbjct  89   YPERIGEPPCQFYLKTGTCKFGASCKFHHPK  119



>ref|NP_001078077.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10898.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=442

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 6/142 (4%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ +        G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y
Sbjct  219  QHAVGATSLYGVTQLTST-TPSLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYY  272

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKF
Sbjct  273  LKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKF  332

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  333  DHPMGTIRYNPSASSLADAPVA  354


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
             + +PERPG P+C +YM+TG C +G  C+++HPR+R      ++ +    P R GEP C 
Sbjct  39   SDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERFGEPPCQ  97

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF HP
Sbjct  98   FYLKTGTCKFGASCKFHHP  116


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  456
            +PER G+P CQFY+KTG CKFGA CKFHHP+ 
Sbjct  87   YPERFGEPPCQFYLKTGTCKFGASCKFHHPKN  118



>ref|XP_010523985.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523986.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523988.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523989.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
Length=475

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 96/143 (67%), Gaps = 4/143 (3%)
 Frame = -2

Query  692  QLTVGNSQAYGLSR-SSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQF  516
            Q  VG +  YG+++ SS   +V   G+  S  + T P      Q+E +FPERPG+PECQ+
Sbjct  246  QHAVGATSLYGVTQLSSSTPSVA--GVYQSLSSSTAPSAA-GNQKEQIFPERPGEPECQY  302

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            Y++TGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G C+FG +CK
Sbjct  303  YLRTGDCKFGLSCKFHHPRDRVPPRANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCK  362

Query  335  FDHPMGVFTYNISPSSTTNAPTV  267
            FDHPMG  +YN S SS  +AP  
Sbjct  363  FDHPMGTLSYNPSASSLVDAPVA  385


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 4/119 (3%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  501
            G +QA   S+S +     S G           +G   L     +PERPG P+C +YM+TG
Sbjct  5    GRNQATNGSQSGQAPEWSSGGNETGLEESMWRLG---LSNSETYPERPGVPDCAYYMRTG  61

Query  500  DCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             C +G+ C+++HPR+R      ++ +    P R GEP C FY + G CKFG SCKF HP
Sbjct  62   ICGYGSRCRYNHPRDR-AMVEAAVRATGDYPERVGEPPCQFYLKTGTCKFGASCKFHHP  119


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A++    +PER G+P CQFY+KTG CKFGA CKFHHP+          L+  G PLR GE
Sbjct  83   AVRATGDYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREGE  142

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
              C+ Y + G CKFG +CKF HP
Sbjct  143  KECSHYLKTGQCKFGVTCKFHHP  165


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P R G+ EC  Y+KTG CKFG  CKFHHP+
Sbjct  136  YPLREGEKECSHYLKTGQCKFGVTCKFHHPQ  166



>ref|XP_010420350.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X2 [Camelina sativa]
Length=413

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 90/130 (69%), Gaps = 16/130 (12%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVA-NVGSQG---MNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            G+ Q Y   R ++   + GSQG    +  +   ++P+G YA      FPERPGQ ECQFY
Sbjct  240  GSDQNYRNQRQNDAEESSGSQGGVFSSGFHSGSSVPLGLYA------FPERPGQLECQFY  293

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            MKTGDCKF      HHPR+R  P PD +LS +GLPLR GEPLC FYSRYGICKFGPSCKF
Sbjct  294  MKTGDCKF------HHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKF  347

Query  332  DHPMGVFTYN  303
            DHPMGVFTYN
Sbjct  348  DHPMGVFTYN  357


 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FYMKTG CKFG  CKFHHPR  +       +  +G PLRP E  C+++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFL  147

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PER G+P+C +Y++TG C+FG+ C+F+HP +R      +  +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATARTKGEYPERIGQPECE  98

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>gb|AAC63639.1| unknown protein [Arabidopsis thaliana]
Length=553

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 6/142 (4%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ +        G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y
Sbjct  330  QHAVGATSLYGVTQLTSTTP-SLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYY  383

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKF
Sbjct  384  LKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKF  443

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  444  DHPMGTIRYNPSASSLADAPVA  465


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P CQFY+KTG CKFGA CKFHHP+          L+  G P+R G+  C++Y 
Sbjct  161  YPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGDNECSYYL  220

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  221  KTGQCKFGITCKFHHP  236


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
             + +PERPG P+C +YM+TG C +G  C+++HPR+R      ++ +    P R GEP C 
Sbjct  113  SDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERFGEPPCQ  171

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF HP
Sbjct  172  FYLKTGTCKFGASCKFHHP  190



>ref|NP_182306.2| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 ref|NP_001078078.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 sp|Q84W91.2|C3H32_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 32; 
Short=AtC3H32; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 1 [Arabidopsis thaliana]
 gb|ABO45694.1| At2g47850 [Arabidopsis thaliana]
 gb|AEC10897.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10899.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=468

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 6/142 (4%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ +        G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y
Sbjct  245  QHAVGATSLYGVTQLTST-TPSLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYY  298

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKF
Sbjct  299  LKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKF  358

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  359  DHPMGTIRYNPSASSLADAPVA  380


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P CQFY+KTG CKFGA CKFHHP+          L+  G P+R G+  C++Y 
Sbjct  87   YPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGDNECSYYL  146

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  147  KTGQCKFGITCKFHHP  162


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
             + +PERPG P+C +YM+TG C +G  C+++HPR+R      ++ +    P R GEP C 
Sbjct  39   SDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERFGEPPCQ  97

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF HP
Sbjct  98   FYLKTGTCKFGASCKFHHP  116



>ref|XP_010420349.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X1 [Camelina sativa]
Length=415

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 90/130 (69%), Gaps = 16/130 (12%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVA-NVGSQG---MNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            G+ Q Y   R ++   + GSQG    +  +   ++P+G YA      FPERPGQ ECQFY
Sbjct  242  GSDQNYRNQRQNDAEESSGSQGGVFSSGFHSGSSVPLGLYA------FPERPGQLECQFY  295

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            MKTGDCKF      HHPR+R  P PD +LS +GLPLR GEPLC FYSRYGICKFGPSCKF
Sbjct  296  MKTGDCKF------HHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKF  349

Query  332  DHPMGVFTYN  303
            DHPMGVFTYN
Sbjct  350  DHPMGVFTYN  359


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQPEC+FYMKTG CKFG  CKFHHPR  +       +  +G PLRP E  C+++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFL  147

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PER G+P+C +Y++TG C+FG+ C+F+HP +R      +  +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATARTKGEYPERIGQPECE  98

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|XP_006294141.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27039.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=471

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 93/142 (65%), Gaps = 6/142 (4%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ S        G+ PS  +   P G   +Q+E  FPERPG+PECQ+Y
Sbjct  247  QHAVGATSLYGVTQLSST-TPSLPGVYPSLSS---PTG--VIQKEQAFPERPGEPECQYY  300

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CKF
Sbjct  301  LKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKF  360

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  361  DHPMGNIRYNPSASSLADAPVA  382


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+P CQFY+KTG CKFGA CKFHHP+          L+  G P+R GE  C++Y 
Sbjct  89   YPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGENECSYYL  148

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  149  KTGQCKFGITCKFHHP  164


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
               +PERPG P+C +YM+TG C +G  C+++HPR+R      ++ +    P R GEP C 
Sbjct  41   SETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERIGEPPCQ  99

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF HP
Sbjct  100  FYLKTGTCKFGASCKFHHP  118



>ref|XP_006829498.1| hypothetical protein AMTR_s00074p00109750 [Amborella trichopoda]
 gb|ERM96914.1| hypothetical protein AMTR_s00074p00109750 [Amborella trichopoda]
Length=201

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  653  RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCK  474
            +S+E A+ G   M   +    LP    ALQ   +FPERP QPECQ+YMKTGDCKFGA CK
Sbjct  24   QSTEPASSGPMRMPSPFVHQLLP----ALQN-GLFPERPDQPECQYYMKTGDCKFGASCK  78

Query  473  FHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH  327
            +HHP ER +P  +  L P+GLPLRPG+PLC FYS+YGICKFGP+CKFDH
Sbjct  79   YHHPLERAMPLTNCALGPLGLPLRPGQPLCTFYSKYGICKFGPTCKFDH  127



>emb|CDO98891.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 92/144 (64%), Gaps = 3/144 (2%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q  VG    YG+++ S  A   + G   S      P G  + QRE+ FPERPGQPECQ
Sbjct  265  SNQPAVGAGHIYGITQLSPSAPAYT-GQYLSIPPAAGPSG--SSQREHAFPERPGQPECQ  321

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YMK GDCKFGA C++HHP E      + +LSP+GLPLRPG  +C+ Y + G+CKFGPSC
Sbjct  322  YYMKYGDCKFGASCRYHHPPELSAQKSNPVLSPMGLPLRPGAAVCSHYIQNGVCKFGPSC  381

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG  +Y+ S SS  + P  
Sbjct  382  KFDHPMGTLSYSPSASSLADMPVA  405


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -2

Query  602  RAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdslls  423
            R  T  MG  A   E  +PER GQP CQFYM+TG+CKFGA CK+HHPR+         L+
Sbjct  77   RDRTAAMGARATAGE--YPERVGQPVCQFYMRTGNCKFGASCKYHHPRQGSGSQTPVNLN  134

Query  422  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
              G PLRPGE  C++Y + G CK+G +CK+ HP
Sbjct  135  FFGYPLRPGEKDCSYYVKTGQCKYGVTCKYHHP  167


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP Q +C +Y++TG C +GA C+F+HPR+R      +  +    P R G+P+C FY 
Sbjct  47   YPERPDQADCIYYLRTGLCGYGARCRFNHPRDR-TAAMGARATAGEYPERVGQPVCQFYM  105

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG SCK+ HP
Sbjct  106  RTGNCKFGASCKYHHP  121


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ +C +Y+KTG CK+G  CK+HHP+
Sbjct  138  YPLRPGEKDCSYYVKTGQCKYGVTCKYHHPQ  168



>ref|XP_011071464.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
 ref|XP_011071465.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
Length=488

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            Q+E+ FPERPG+PECQ+Y+KTGDCKFG+ CK+HHP E   P  + LLSP+GLPLRPG PL
Sbjct  306  QKESPFPERPGEPECQYYLKTGDCKFGSTCKYHHPPEWSAPKSNFLLSPMGLPLRPGAPL  365

Query  386  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            C+ Y++ G+CKFGPSCKFDHPM   +Y+ S SS T+ P  
Sbjct  366  CSHYAQNGVCKFGPSCKFDHPMRTLSYSPSASSLTDMPVA  405


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER  QP CQ+YM+TG CKFGA CK+HHP++ +      +L+  G PLRPGE  C++Y 
Sbjct  88   YPERISQPVCQYYMRTGMCKFGASCKYHHPKQGIGSSAPIMLNFYGYPLRPGEKECSYYV  147

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  148  KTGQCKFGVTCKFHHP  163


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP +P+C +Y++TG C +G  C+F+HPR+R         S  G P R  +P+C +Y 
Sbjct  42   YPERPDEPDCIYYLRTGSCGYGTRCRFNHPRDRGAAVGALRASGGGYPERISQPVCQYYM  101

Query  371  RYGICKFGPSCKFDHP  324
            R G+CKFG SCK+ HP
Sbjct  102  RTGMCKFGASCKYHHP  117


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y+KTG CKFG  CKFHHP+
Sbjct  134  YPLRPGEKECSYYVKTGQCKFGVTCKFHHPQ  164



>ref|XP_002314462.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
 gb|EEF00633.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
Length=456

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 94/144 (65%), Gaps = 7/144 (5%)
 Frame = -2

Query  692  QLTVGNSQAYGLS--RSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            Q  VG+   YG+S    S  A  G+    P+ +  +      + Q+E+VFPERPGQPECQ
Sbjct  254  QPAVGSGSVYGISPLSPSAPAYTGAYQSIPTAKGPSS-----SSQKEHVFPERPGQPECQ  308

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YMKTGDCKF + C++HHP E +    + +LSP+GLPLRPG P C  Y+++G CKFGP+C
Sbjct  309  YYMKTGDCKFESSCRYHHPPELVTSKTNVVLSPMGLPLRPGAPTCTHYTQHGQCKFGPAC  368

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG  +Y+ S SS  + P  
Sbjct  369  KFDHPMGTLSYSPSASSLADMPVA  392


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQP CQ+YM+TG CKFGA CK++HP++         L+  G PLRPGE  C +Y 
Sbjct  90   FPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNYYGYPLRPGERECTYYI  149

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  150  KTGQCKFGATCKFHHP  165


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            + E+ +PERP + +C +Y++TG C +GA C+++HPR+R      +       P R G+PL
Sbjct  39   ETESEYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAVLGAARAGGGEFPERVGQPL  98

Query  386  CAFYSRYGICKFGPSCKFDHP  324
            C +Y R G CKFG SCK++HP
Sbjct  99   CQYYMRTGTCKFGASCKYNHP  119


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y+KTG CKFGA CKFHHP+
Sbjct  136  YPLRPGERECTYYIKTGQCKFGATCKFHHPQ  166



>ref|XP_009631342.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana tomentosiformis]
Length=488

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 4/144 (3%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            + Q   G    YGL++ S  A     G   S  A   P G  ++Q+E+ FPERPGQPECQ
Sbjct  261  TTQPAAGAGPVYGLTQLSASAPA-YMGPYTSLTASIGPSG--SIQKEHAFPERPGQPECQ  317

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +Y+K GDCKFG+ C++HHP E   P    +LS +GLPLRPG P+C+ YS+ G+CKFGPSC
Sbjct  318  YYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMGLPLRPGAPICSHYSQNGVCKFGPSC  377

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDHPMG+ +Y+ S SS  + P  
Sbjct  378  KFDHPMGI-SYSPSASSLVDMPVA  400


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            E  +PER GQP CQ+YM+TG CKFGA CK+HHPR+    P     +  G PLRPGE  C 
Sbjct  89   EEKYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPGEKECL  148

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG +CKF HP
Sbjct  149  FYMKTGQCKFGITCKFHHP  167


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 9/93 (10%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRP---GEPLCA  381
            +PERP + +C +Y++TG C +G+ C+F+HP +R +    +     G    P   G+P+C 
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGEEKYPERVGQPVCQ  102

Query  380  FYSRYGICKFGPSCKFDHPM------GVFTYNI  300
            +Y R G+CKFG SCK+ HP        + T+NI
Sbjct  103  YYMRTGMCKFGASCKYHHPRQGGGSPALMTHNI  135


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -2

Query  572  ALQRENVF--PERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            AL   N++  P RPG+ EC FYMKTG CKFG  CKFHHP+
Sbjct  129  ALMTHNIYGYPLRPGEKECLFYMKTGQCKFGITCKFHHPQ  168



>ref|XP_010545037.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X1 [Tarenaya hassleriana]
Length=469

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 91/142 (64%), Gaps = 3/142 (2%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ S  +     G  PS  + T P      Q+E +FPERPG+PECQ+Y
Sbjct  246  QHAVGATSLYGVTQLSS-STPSLAGAYPSLSSSTAPS--VGSQKEQIFPERPGEPECQYY  302

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            ++TGDCKFG  CKFHH R+R+    + +LSPIGLPLRPG   C FY + G C+FG +CKF
Sbjct  303  LRTGDCKFGLSCKFHHRRDRIPQRANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKF  362

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  363  DHPMGTLRYNPSASSLVDAPVA  384


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  501
            G SQA   ++S +     S+G +         +G   L     +PERPG P+C +YM+TG
Sbjct  5    GRSQAMSGAQSGQAPEWSSEGADTGLEESMWRLG---LSSSETYPERPGAPDCAYYMRTG  61

Query  500  DCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             C +G+ C+++HPR+R      ++ +    P R GEP C FY + G CKFG SCKF HP
Sbjct  62   ICGYGSRCRYNHPRDR-AVVEAAVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHP  119


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A++    +PER G+P CQFY+KTG CKFGA CKFHHP+          L+  G PLR  E
Sbjct  83   AVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAE  142

Query  392  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
              C+ Y + G CKFG +CKF HP    T   +P+ST
Sbjct  143  KECSHYLKTGQCKFGVTCKFHHPQPAGT--TTPAST  176



>ref|XP_010545038.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X2 [Tarenaya hassleriana]
Length=463

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 91/142 (64%), Gaps = 3/142 (2%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YG+++ S  +     G  PS  + T P      Q+E +FPERPG+PECQ+Y
Sbjct  240  QHAVGATSLYGVTQLSS-STPSLAGAYPSLSSSTAPS--VGSQKEQIFPERPGEPECQYY  296

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            ++TGDCKFG  CKFHH R+R+    + +LSPIGLPLRPG   C FY + G C+FG +CKF
Sbjct  297  LRTGDCKFGLSCKFHHRRDRIPQRANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKF  356

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHPMG   YN S SS  +AP  
Sbjct  357  DHPMGTLRYNPSASSLVDAPVA  378


 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 10/119 (8%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTG  501
            G SQA   ++S +     S+G +          G   L     +PERPG P+C +YM+TG
Sbjct  5    GRSQAMSGAQSGQAPEWSSEGAD---------TGLEGLSSSETYPERPGAPDCAYYMRTG  55

Query  500  DCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             C +G+ C+++HPR+R      ++ +    P R GEP C FY + G CKFG SCKF HP
Sbjct  56   ICGYGSRCRYNHPRDR-AVVEAAVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHP  113


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A++    +PER G+P CQFY+KTG CKFGA CKFHHP+          L+  G PLR  E
Sbjct  77   AVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAE  136

Query  392  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  285
              C+ Y + G CKFG +CKF HP    T   +P+ST
Sbjct  137  KECSHYLKTGQCKFGVTCKFHHPQPAGT--TTPAST  170



>ref|XP_009142499.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Brassica rapa]
Length=455

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 13/146 (9%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P S  L+ G +  YG+++ S            S   G  P G   L+ E+ FPERPG+PE
Sbjct  246  PVSPALSPGAASLYGVTQLS------------STTPGVYPSGVVTLKEES-FPERPGEPE  292

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQ+Y+KTGDCKFG  CKFHHPR+R+ P P+  LS IGLPLRPG   C+FY + G CKFG 
Sbjct  293  CQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSIGLPLRPGVQRCSFYVQNGFCKFGS  352

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTV  267
            +CKFDHP+G   YN S SS  +AP  
Sbjct  353  TCKFDHPVGTIRYNPSASSLADAPVA  378


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp--LRPGEPLCAF  378
            +PER G   CQFY+KTG CKFGA CKF+HPR        + +        +R GE  C++
Sbjct  92   YPERIGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLNIYGYPVRQGENECSY  151

Query  377  YSRYGICKFGPSCKFDHP  324
            + + G CKFG +CKF HP
Sbjct  152  FLKTGQCKFGITCKFHHP  169


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
               +P+R G P+C +YM+TG C +G+ C+F+HP +R      ++ +    P R G   C 
Sbjct  44   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDR-ASVEATVRATGQYPERIGALPCQ  102

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF+HP
Sbjct  103  FYLKTGTCKFGASCKFNHP  121



>ref|XP_009142498.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Brassica rapa]
Length=456

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 13/146 (9%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P S  L+ G +  YG+++ S            S   G  P G   L+ E+ FPERPG+PE
Sbjct  247  PVSPALSPGAASLYGVTQLS------------STTPGVYPSGVVTLKEES-FPERPGEPE  293

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQ+Y+KTGDCKFG  CKFHHPR+R+ P P+  LS IGLPLRPG   C+FY + G CKFG 
Sbjct  294  CQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSIGLPLRPGVQRCSFYVQNGFCKFGS  353

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTV  267
            +CKFDHP+G   YN S SS  +AP  
Sbjct  354  TCKFDHPVGTIRYNPSASSLADAPVA  379


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp--LRPGEPLCAF  378
            +PER G   CQFY+KTG CKFGA CKF+HPR        + +        +R GE  C++
Sbjct  93   YPERIGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLNIYGYPVRQGENECSY  152

Query  377  YSRYGICKFGPSCKFDHP  324
            + + G CKFG +CKF HP
Sbjct  153  FLKTGQCKFGITCKFHHP  170


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
               +P+R G P+C +YM+TG C +G+ C+F+HP +R      ++ +    P R G   C 
Sbjct  45   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDR-ASVEATVRATGQYPERIGALPCQ  103

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF+HP
Sbjct  104  FYLKTGTCKFGASCKFNHP  122



>emb|CDX80137.1| BnaA05g00190D [Brassica napus]
Length=456

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 13/146 (9%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P S  L+ G +  YG+++ S            S   G  P G   L+ E+ FPERPG+PE
Sbjct  247  PVSPALSPGAASLYGVTQLS------------STTPGVYPSGVVTLKEES-FPERPGEPE  293

Query  524  CQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGP  345
            CQ+Y+KTGDCKFG  CKFHHPR+R+ P P+  LS IGLPLRPG   C+FY + G CKFG 
Sbjct  294  CQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSIGLPLRPGVQRCSFYVQNGFCKFGS  353

Query  344  SCKFDHPMGVFTYNISPSSTTNAPTV  267
            +CKFDHP+G   YN S SS  +AP  
Sbjct  354  TCKFDHPVGTIRYNPSASSLADAPVA  379


 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp--LRPGEPLCAF  378
            +PER G   CQFY+KTG CKFGA CKF+HPR        + +        +R GE  C++
Sbjct  93   YPERMGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLNIYGYPVRQGENECSY  152

Query  377  YSRYGICKFGPSCKFDHP  324
            + + G CKFG +CKF HP
Sbjct  153  FLKTGQCKFGITCKFHHP  170


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
               +P+R G P+C +YM+TG C +G+ C+F+HP +R      ++ +    P R G   C 
Sbjct  45   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDR-ASVEATVRATGQYPERMGALPCQ  103

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF+HP
Sbjct  104  FYLKTGTCKFGASCKFNHP  122



>ref|XP_011013662.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=476

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            Q+E+VFPERPGQPECQ+YMKTGDCKF + C++HHP E +    + +LSP+G PLRPG P 
Sbjct  293  QKEHVFPERPGQPECQYYMKTGDCKFESSCRYHHPPELVASKTNVVLSPMGFPLRPGAPT  352

Query  386  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            C  Y+++G CKFGP+CKFDHPMG  +Y+ S SS  + P  
Sbjct  353  CTHYTQHGQCKFGPACKFDHPMGTLSYSPSASSLADMPVA  392


 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQP CQ+YM+TG CKFGA CK++HP++         L+  G PLRPG+  C +Y 
Sbjct  90   FPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNFYGYPLRPGDKECTYYI  149

Query  371  RYGICKFGPSCKFDHP----MGVFTYNISPS-STTNAPTV  267
            + G CKFG +CKF HP    M +   +++P  ++  APT+
Sbjct  150  KTGQCKFGATCKFHHPQPANMQIPAQSLAPQVASVPAPTL  189


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            + E+ +PERP + +C +Y++TG C +GA C+++HPR+R              P R G+PL
Sbjct  39   ETESEYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAALEAGRTGGGEFPERVGQPL  98

Query  386  CAFYSRYGICKFGPSCKFDHP  324
            C +Y R G CKFG SCK++HP
Sbjct  99   CQYYMRTGTCKFGASCKYNHP  119



>ref|XP_010507789.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Camelina 
sativa]
Length=399

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 94/143 (66%), Gaps = 7/143 (5%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENV-FPERPGQPECQF  516
            Q  VG +  YG+++ S  +     G+ PS  +   P G   +Q+E   FPERPG+PECQ+
Sbjct  175  QHAVGATSLYGVTQLSSTSP-SLPGVYPSLSS---PTG--VIQKEQAAFPERPGEPECQY  228

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            Y+KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CK
Sbjct  229  YLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSTCK  288

Query  335  FDHPMGVFTYNISPSSTTNAPTV  267
            FDHPMG   YN S SS  +AP  
Sbjct  289  FDHPMGTIRYNPSASSLADAPVA  311


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+  CQFY+KTG CKFGA CKFHHP+          L+  G P+R GE  C++Y 
Sbjct  13   YPERFGELPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGENECSYYL  72

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  73   KTGQCKFGITCKFHHP  88



>ref|XP_001768387.1| predicted protein [Physcomitrella patens]
 gb|EDQ66749.1| predicted protein, partial [Physcomitrella patens]
Length=332

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 87/127 (69%), Gaps = 10/127 (8%)
 Frame = -2

Query  680  GNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQ-------RENVFPERPGQPEC  522
            G+ Q Y    + +  +V   G    Y  G+  +G  A Q       +E VFPERPGQPEC
Sbjct  209  GHQQGYVFGGAPQGEHVSGYG---PYMQGSSAVGLPAHQATQAVGGQETVFPERPGQPEC  265

Query  521  QFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  342
            Q+YMKTGDCKFG+ C++HHP++R  P P   LSP+GLPLRPG P C+FYSRYGICKFGP+
Sbjct  266  QYYMKTGDCKFGSTCRYHHPKDRATPSPTCHLSPMGLPLRPGNPPCSFYSRYGICKFGPT  325

Query  341  CKFDHPM  321
            CKFDHP+
Sbjct  326  CKFDHPL  332


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A + +  +PER G PECQ+Y+KTG CKFGA CK+HHPRE+        L+ +GLPLR GE
Sbjct  59   ATRGKGEYPERVGHPECQYYLKTGTCKFGATCKYHHPREKAGSTGRVHLNVLGLPLRLGE  118

Query  392  PLCAFYSRYGICKFGPSCKFDHP  324
              CA+Y R G CK+G +CKF HP
Sbjct  119  KECAYYMRTGSCKYGVTCKFHHP  141


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            +  +PERPG+P+C +YM+TG C FG  C+++HP  R      +       P R G P C 
Sbjct  18   QGPYPERPGEPDCVYYMRTGLCGFGMTCRYNHPPNR-KLAAAATRGKGEYPERVGHPECQ  76

Query  380  FYSRYGICKFGPSCKFDHP  324
            +Y + G CKFG +CK+ HP
Sbjct  77   YYLKTGTCKFGATCKYHHP  95



>ref|XP_011018690.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=479

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG+   YGLS  S  A   + G   S    T P    + Q+E++FPERPGQPECQ+Y
Sbjct  254  QPAVGSGSVYGLSALSPSAPAYT-GAFQSIPPATGPSS--STQKEHLFPERPGQPECQYY  310

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKF + C++HHP E ++   + +LSPIGLPLRPG P C+ Y++ G CKFGP+CKF
Sbjct  311  IKTGDCKFRSSCRYHHPPELVVSKTNVVLSPIGLPLRPGAPTCSHYTQRGQCKFGPACKF  370

Query  332  DHPMGVFTYNISPSSTTNAPTVRHF  258
            DHPMG  +Y+ S SS  + P   + 
Sbjct  371  DHPMGTLSYSPSASSLADMPVAPYL  395


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLRPGE  C +Y 
Sbjct  90   YPERVGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERECTYYI  149

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  150  KTGQCKFGATCKFHHP  165


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            + E+V+PERP + +C +Y++TG C +GA C+++HPR+R              P R G+PL
Sbjct  39   ETESVYPERPNEQDCMYYLRTGWCGYGARCRYNHPRDRSAVLGAPRAGGAEYPERVGQPL  98

Query  386  CAFYSRYGICKFGPSCKFDHP  324
            C +Y R G CKFG SCK+ HP
Sbjct  99   CQYYMRTGTCKFGASCKYHHP  119


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y+KTG CKFGA CKFHHP+
Sbjct  136  YPLRPGERECTYYIKTGQCKFGATCKFHHPQ  166



>ref|XP_010921758.1| PREDICTED: zinc finger CCCH domain-containing protein 6 [Elaeis 
guineensis]
Length=466

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 90/132 (68%), Gaps = 12/132 (9%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYAL-----QRENVFPERPGQP  528
            Q TV     YGLS S   A+V      PSY+    P+   A      QRE+ FPERPGQP
Sbjct  243  QQTVQAGHLYGLS-SQVTASV------PSYQGPYTPVSSSAGPSSGSQREHTFPERPGQP  295

Query  527  ECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFG  348
            ECQFYM+TGDCKFG+ C++HHPR+  +P  +  LSP+GLPLRPG   CA+Y+++G+CKFG
Sbjct  296  ECQFYMRTGDCKFGSTCRYHHPRDWSMPKTNCALSPLGLPLRPGAQPCAYYAQHGVCKFG  355

Query  347  PSCKFDHPMGVF  312
            P+CKFDHPMG  
Sbjct  356  PTCKFDHPMGTL  367


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP C++YM+TG CKFG+ CK+HHPR+        LL+  G PLRPGE  C++Y 
Sbjct  85   YPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLLNYSGYPLRPGEKECSYYM  144

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  145  KTGQCKFGSTCKFHHP  160


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            ++ +PERPG+P+C +YM+TG C +G  C+++HPR+R         +    P R G+P+C 
Sbjct  36   DSPYPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGAGRTAAGEYPERVGQPVCE  95

Query  380  FYSRYGICKFGPSCKFDHP  324
            +Y R G CKFG +CK+ HP
Sbjct  96   YYMRTGTCKFGSTCKYHHP  114



>ref|XP_008802110.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Phoenix dactylifera]
Length=466

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 13/132 (10%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYAL-----QRENVFPERPGQP  528
            Q TV     YGLS  S+ A+V      P+Y     P+   A      QRE+ FPERPGQP
Sbjct  244  QQTVQAGHLYGLS--SQTASV------PAYPGPYTPVSSSAGPSSSSQREHTFPERPGQP  295

Query  527  ECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFG  348
            ECQFYM+TGDCKFGA C++HHPR+  IP  +  LSP+GLPLRPG   CA+Y+++G+CKFG
Sbjct  296  ECQFYMRTGDCKFGATCRYHHPRDWSIPKTNCALSPLGLPLRPGAQPCAYYAQHGVCKFG  355

Query  347  PSCKFDHPMGVF  312
            P+CKFDHPMG  
Sbjct  356  PTCKFDHPMGTL  367


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 61/99 (62%), Gaps = 4/99 (4%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP C++YM+TG CKFG+ CK+HHPR+        L +  G PLRPGE  C++Y 
Sbjct  86   YPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLFNYYGFPLRPGEKECSYYM  145

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPS----STTNAPTV  267
            + G CKFG +CKF HP        SP+     T  +PTV
Sbjct  146  KTGQCKFGSTCKFHHPQPAGASVPSPAPTFYPTVQSPTV  184


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +YM+TG C +G  C+++HPR+R              P R G+P+C +Y 
Sbjct  40   YPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGGGRTGVGEYPERVGQPVCEYYM  99

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG +CK+ HP
Sbjct  100  RTGTCKFGSTCKYHHP  115



>ref|XP_009339837.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            Q+E +FPERPGQPECQ+YM+TGDCKFG+ C++HHP E +      LLS  GLP RPG PL
Sbjct  289  QKEQIFPERPGQPECQYYMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPSRPGAPL  348

Query  386  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            C  Y + G CKFG +CKFDHP+G  +Y+ S SS  + P  
Sbjct  349  CTHYQQRGACKFGSACKFDHPIGTLSYSPSASSLADMPVA  388


 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLRPGE  C++Y 
Sbjct  89   YPERVGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPGERDCSYYV  148

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  149  KTGQCKFGATCKFHHP  164


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER  + +C +Y++TG C +G+ C+++HPR+R +    +    +  P R G+P+C +Y 
Sbjct  43   YPERSDEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGGLEYPERVGQPVCQYYM  102

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG SCK+ HP
Sbjct  103  RTGTCKFGASCKYHHP  118


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ +C +Y+KTG CKFGA CKFHHP+
Sbjct  135  YPLRPGERDCSYYVKTGQCKFGATCKFHHPQ  165



>ref|XP_010507842.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Camelina sativa]
 ref|XP_010507843.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Camelina sativa]
Length=449

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 93/143 (65%), Gaps = 7/143 (5%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENV-FPERPGQPECQF  516
            Q  VG +  YG+++ S      S  +   Y + + P G   +Q+E   FPERPG+PECQ+
Sbjct  225  QHAVGATSLYGVTQLSST----SPSLPGVYPSLSSPTG--VIQKEQAAFPERPGEPECQY  278

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            Y+KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CK
Sbjct  279  YLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSTCK  338

Query  335  FDHPMGVFTYNISPSSTTNAPTV  267
            FDHP+G   YN S SS  +AP  
Sbjct  339  FDHPVGTIRYNPSASSLADAPVA  361


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M    L     +PER G P+C +YM+TG C +G  C+++HPR+R      ++ +    P 
Sbjct  34   MWRLGLGSSETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPE  92

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R GE  C FY + G CKFG SCKF HP
Sbjct  93   RIGELPCQFYLKTGTCKFGASCKFHHP  119


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +PER G+  CQFY+KTG CKFGA CKFHHP+
Sbjct  90   YPERIGELPCQFYLKTGTCKFGASCKFHHPK  120



>ref|XP_006380188.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
 gb|ERP57985.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
Length=477

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG+   YG+S  S  A   + G   S    T P    + Q+E++FPERPGQPECQ+Y
Sbjct  254  QPAVGSGSVYGMSALSPSAPAYT-GAFQSIPPATGPSS--STQKEHLFPERPGQPECQYY  310

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            +KTGDCKF + C++HHP E ++   + +LSPIGLPLRPG P C+ Y++ G CKFGP+CKF
Sbjct  311  IKTGDCKFRSSCRYHHPPELVVSKSNVVLSPIGLPLRPGAPTCSHYTQRGQCKFGPACKF  370

Query  332  DHPMGVFTYNISPSSTTNAPTVRHF  258
            DHPMG  +Y+ S SS  + P   + 
Sbjct  371  DHPMGTLSYSPSASSLADMPVAPYL  395


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLRPGE  C +Y 
Sbjct  90   YPERAGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERECTYYI  149

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  150  KTGQCKFGATCKFHHP  165


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            + E+ +PER  + +C +Y++TG C +GA C+++HPR+R      +       P R G+PL
Sbjct  39   ETESEYPERSNEQDCMYYLRTGFCGYGARCRYNHPRDRNAVLGAARAGGAEYPERAGQPL  98

Query  386  CAFYSRYGICKFGPSCKFDHP  324
            C +Y R G CKFG SCK+ HP
Sbjct  99   CQYYMRTGTCKFGASCKYHHP  119


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y+KTG CKFGA CKFHHP+
Sbjct  136  YPLRPGERECTYYIKTGQCKFGATCKFHHPQ  166



>gb|EEE54266.1| hypothetical protein OsJ_01160 [Oryza sativa Japonica Group]
Length=182

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            ++E  FP RPGQPECQ+Y+KTG CKFG+ CK+HHP+    P  + +LSP+GLPLRPG   
Sbjct  7    KQEPAFPARPGQPECQYYLKTGSCKFGSACKYHHPQYLNTPKSNCMLSPLGLPLRPGSQP  66

Query  386  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            CA+Y+++G CKFGP+CKFDHPMG  +Y+ S SS T+ P  
Sbjct  67   CAYYTQHGFCKFGPTCKFDHPMGTLSYSPSASSITDLPIA  106



>ref|XP_010507840.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
 ref|XP_010507841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
Length=475

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 93/143 (65%), Gaps = 7/143 (5%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENV-FPERPGQPECQF  516
            Q  VG +  YG+++ S      S  +   Y + + P G   +Q+E   FPERPG+PECQ+
Sbjct  251  QHAVGATSLYGVTQLSST----SPSLPGVYPSLSSPTG--VIQKEQAAFPERPGEPECQY  304

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            Y+KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG +CK
Sbjct  305  YLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSTCK  364

Query  335  FDHPMGVFTYNISPSSTTNAPTV  267
            FDHP+G   YN S SS  +AP  
Sbjct  365  FDHPVGTIRYNPSASSLADAPVA  387


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G+  CQFY+KTG CKFGA CKFHHP+          L+  G P+R GE  C++Y 
Sbjct  90   YPERIGELPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGENECSYYL  149

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  150  KTGQCKFGITCKFHHP  165


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M    L     +PER G P+C +YM+TG C +G  C+++HPR+R      ++ +    P 
Sbjct  34   MWRLGLGSSETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPE  92

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R GE  C FY + G CKFG SCKF HP
Sbjct  93   RIGELPCQFYLKTGTCKFGASCKFHHP  119


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P R G+ EC +Y+KTG CKFG  CKFHHP+
Sbjct  136  YPVREGENECSYYLKTGQCKFGITCKFHHPQ  166



>gb|EEC80695.1| hypothetical protein OsI_23121 [Oryza sativa Indica Group]
Length=217

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+ QQ T   +Q YG SR SE   +G  GM  SY+ G++P+G Y +Q EN+FPERP QPE
Sbjct  110  PDDQQRTPVTTQYYG-SRQSETGGMGDHGMYQSYQGGSVPVGVYTVQGENIFPERPDQPE  168

Query  524  CQFYMKTGDCKFGAVCKFHHPRER  453
            CQFYMKTGDCKFGAVCKFHHP+ER
Sbjct  169  CQFYMKTGDCKFGAVCKFHHPKER  192



>ref|XP_008340827.1| PREDICTED: zinc finger CCCH domain-containing protein 34 [Malus 
domestica]
Length=476

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            Q+E +FPERPGQPECQ+YM+TGDCKFG+ C++HHP E +      LLS  GLP RPG PL
Sbjct  292  QKEQLFPERPGQPECQYYMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPSRPGAPL  351

Query  386  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            C  Y + G CKFG +CKFDHP+G  +Y+ S SS  + P  
Sbjct  352  CTHYQQRGACKFGSACKFDHPIGTLSYSPSASSLADMPVA  391


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLRPGE  C++Y 
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPGERECSYYV  148

Query  371  RYGICKFGPSCKFDHPM  321
            + G CKFG +CKF HP+
Sbjct  149  KTGQCKFGATCKFHHPL  165


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = -2

Query  587  PMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp  408
            PM    L     +PERP + +C +Y++TG C +G+ C+++HPR+R +    +    +  P
Sbjct  31   PMWQLGLGPGESYPERPDEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGXLEYP  90

Query  407  LRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             R G+P+C +Y R G CKFG SCK+ HP
Sbjct  91   ERAGQPVCQYYMRTGTCKFGASCKYHHP  118



>ref|XP_010913061.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=381

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPE  525
            P+S+Q T G ++ Y  SR SE +  G+QG   SYR G++PMG YALQREN+FP RP QPE
Sbjct  249  PKSRQQTPGVAEYYSASRQSETSE-GAQGTFSSYRLGSIPMGVYALQRENIFPNRPDQPE  307

Query  524  CQFYMKTGDCKFGAVCKFHHPRER  453
            CQFYMKTGDCKFGA C+FHHPRER
Sbjct  308  CQFYMKTGDCKFGAACRFHHPRER  331


 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   A + +  +PER GQPECQ+Y+KTG CKFGA CKFHHP+++        L+ +G PL
Sbjct  81   MAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  140

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEKECAYYLRTGQCKFGNTCKFHHP  167


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -2

Query  569  LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEP  390
            L     +P+RPG+P+C +Y++TG C+FG  CKF+HP  R      +     G P R G+P
Sbjct  41   LMESGPYPKRPGEPDCAYYIRTGLCRFGMTCKFNHPPNR-KMAIAAARIKGGYPERVGQP  99

Query  389  LCAFYSRYGICKFGPSCKFDHP  324
             C +Y + G CKFG +CKF HP
Sbjct  100  ECQYYLKTGTCKFGATCKFHHP  121


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + EC +Y++TG CKFG  CKFHHP+
Sbjct  138  YPLRPNEKECAYYLRTGQCKFGNTCKFHHPQ  168



>ref|XP_006644012.1| PREDICTED: zinc finger CCCH domain-containing protein 5-like 
[Oryza brachyantha]
Length=436

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 94/152 (62%), Gaps = 8/152 (5%)
 Frame = -2

Query  704  PESQQLTVGNSQA------YGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPE  543
            P +Q  + G  QA      YGLS     + V          +  +P+   + ++E  FPE
Sbjct  210  PVNQVASAGGHQAVQAGQFYGLSHQGPSSAVTYSSQYAPLLSSAMPLS--SSKQEPAFPE  267

Query  542  RPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYG  363
            RPGQPECQ+Y+KTG CKFG+ CK+HHP+    P  + +LSP+GLPLRPG   CA+Y+++G
Sbjct  268  RPGQPECQYYLKTGSCKFGSACKYHHPQYLNTPKSNCMLSPLGLPLRPGSQPCAYYTQHG  327

Query  362  ICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
             CKFGP+CKFDHPMG   Y+ S SS T+ P  
Sbjct  328  FCKFGPTCKFDHPMGTLNYSPSASSITDLPIA  359


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPGQP C+++MK G CKFG+ CK+ HPRE        +L+  G PLRPGE  C++Y 
Sbjct  69   YPERPGQPVCEYFMKNGTCKFGSNCKYDHPRE--GSVQPVVLNASGYPLRPGEKDCSYYV  126

Query  371  RYGICKFGPSCKFDHP-MGVFTYNISP  294
            +   CKFG +CKF HP  G  T N+ P
Sbjct  127  KTSHCKFGSTCKFHHPETGGVTPNMYP  153


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppd-----sllspiglpLRPGEPL  387
             PERPG+ +C +Y++TG C +G  C+++HPR+R                   P RPG+P+
Sbjct  18   LPERPGEADCVYYLRTGACGYGENCRYNHPRDRASAAAALNGGGKSTHSAEYPERPGQPV  77

Query  386  CAFYSRYGICKFGPSCKFDHP  324
            C ++ + G CKFG +CK+DHP
Sbjct  78   CEYFMKNGTCKFGSNCKYDHP  98



>ref|XP_010518502.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Camelina sativa]
Length=445

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 92/143 (64%), Gaps = 7/143 (5%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENV-FPERPGQPECQF  516
            Q  VG +  YG+++ S      S  +   Y + + P G   +Q+E   FPERPG+PECQ+
Sbjct  221  QHAVGATSLYGVTQLSST----SPSLPGVYPSLSSPTG--VIQKEQAAFPERPGEPECQY  274

Query  515  YMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCK  336
            Y+KTGDCKFG  CKFHHPR+R+ P  + +LSPIGLPLRPG   C FY + G CKFG  CK
Sbjct  275  YLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGVQRCTFYVQNGFCKFGSKCK  334

Query  335  FDHPMGVFTYNISPSSTTNAPTV  267
            FDHP+G   YN S SS  +AP  
Sbjct  335  FDHPVGTIRYNPSASSLADAPVA  357


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -2

Query  569  LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEP  390
            L     +PER G P+C +YM+TG C +G  C+++HPR+R      ++ +    P R G+ 
Sbjct  35   LGSSETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGLYPERIGDL  93

Query  389  LCAFYSRYGICKFGPSCKFDHP  324
             C FY + G CKFG SCKF HP
Sbjct  94   PCQFYLKTGTCKFGASCKFHHP  115


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  569  LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRE  456
            ++   ++PER G   CQFY+KTG CKFGA CKFHHP+ 
Sbjct  80   VRATGLYPERIGDLPCQFYLKTGTCKFGASCKFHHPKN  117



>ref|XP_006419655.1| hypothetical protein CICLE_v10004882mg [Citrus clementina]
 ref|XP_006489144.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Citrus sinensis]
 gb|ESR32895.1| hypothetical protein CICLE_v10004882mg [Citrus clementina]
Length=476

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 94/147 (64%), Gaps = 13/147 (9%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRA-----GTLPMGYYALQRENVFPERPGQP  528
            Q +VG+S  YG+++ S  A        P+Y        +      + Q+E+ FPERPGQ 
Sbjct  254  QSSVGSSSIYGITQLSASA--------PAYTGTYQSLPSSVGPSSSSQKEHPFPERPGQQ  305

Query  527  ECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFG  348
            ECQ+YMKTGDCKFG+ C+FHHPRE ++P  D  LSP GLPLRPG   C  Y + G+CKFG
Sbjct  306  ECQYYMKTGDCKFGSSCRFHHPRELIVPKMDVTLSPFGLPLRPGAAPCTHYVQRGVCKFG  365

Query  347  PSCKFDHPMGVFTYNISPSSTTNAPTV  267
            P+CKFDHPMG+ +Y+ S SS  + P  
Sbjct  366  PACKFDHPMGMLSYSPSASSLADMPVA  392


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPER GQP CQ+YM+TG CK+GA CK+HHPR+      +  L+  G PLRPGE  C++Y 
Sbjct  84   FPERVGQPVCQYYMRTGTCKYGASCKYHHPRQGAGSVSNVSLNYYGYPLRPGEKECSYYM  143

Query  371  RYGICKFGPSCKFDHP  324
            +   CKFG +CKF HP
Sbjct  144  KTRQCKFGATCKFHHP  159


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP + +C  Y++TG C +G+ C+F+HPR+R      +       P R G+P+C +Y 
Sbjct  38   YPERPDEADCIHYVRTGFCAYGSRCRFNHPRDRGSVMGAARAGGGEFPERVGQPVCQYYM  97

Query  371  RYGICKFGPSCKFDHP  324
            R G CK+G SCK+ HP
Sbjct  98   RTGTCKYGASCKYHHP  113


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +YMKT  CKFGA CKFHHP+
Sbjct  130  YPLRPGEKECSYYMKTRQCKFGATCKFHHPQ  160



>ref|XP_008796232.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X2 [Phoenix dactylifera]
Length=409

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            +RE +FPERPGQPECQFYM+TGDCKFGA CK+HHPR+  IP  + +LSP+GLPLRPG  +
Sbjct  226  EREQMFPERPGQPECQFYMRTGDCKFGATCKYHHPRDWSIPKTNCVLSPLGLPLRPGAQI  285

Query  386  CAFYSRYGICKFGPSCKFDHPMGVF  312
            C++Y+++G+CKFGP+CKFDHP+G  
Sbjct  286  CSYYAQHGVCKFGPTCKFDHPVGTL  310


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P+  GQP C++YMKTG CKFG+ CK+HHPR+        LL+  G PLRPGE  C++Y 
Sbjct  28   YPQHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYYGYPLRPGEKECSYYM  87

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  88   KTGQCKFGLTCKFHHP  103


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +YMKTG CKFG  CKFHHP+
Sbjct  74   YPLRPGEKECSYYMKTGQCKFGLTCKFHHPQ  104



>ref|XP_009369128.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            Q+E +FPERPGQPECQ++M+TGDCKFG+ C++HHP E +      LLS  GLPLRPG PL
Sbjct  289  QKEQIFPERPGQPECQYFMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPLRPGAPL  348

Query  386  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            C  Y + G CKFG +CKFDHP+G  +Y+ S SS  + P  
Sbjct  349  CTHYQQRGACKFGSACKFDHPIGTLSYSPSASSLADMPVA  388


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLRP E  C++Y 
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPSERDCSYYV  148

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  149  KTGQCKFGSTCKFHHP  164


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER  + +C +Y++TG C +G+ C+++HPR+R +    +    +  P R G+P+C +Y 
Sbjct  43   YPERSNEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGGLEYPERAGQPVCQYYM  102

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG SCK+ HP
Sbjct  103  RTGTCKFGASCKYHHP  118


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RP + +C +Y+KTG CKFG+ CKFHHP+
Sbjct  135  YPLRPSERDCSYYVKTGQCKFGSTCKFHHPQ  165



>ref|XP_008796231.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Phoenix dactylifera]
Length=464

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            +RE +FPERPGQPECQFYM+TGDCKFGA CK+HHPR+  IP  + +LSP+GLPLRPG  +
Sbjct  281  EREQMFPERPGQPECQFYMRTGDCKFGATCKYHHPRDWSIPKTNCVLSPLGLPLRPGAQI  340

Query  386  CAFYSRYGICKFGPSCKFDHPMGVF  312
            C++Y+++G+CKFGP+CKFDHP+G  
Sbjct  341  CSYYAQHGVCKFGPTCKFDHPVGTL  365


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P+  GQP C++YMKTG CKFG+ CK+HHPR+        LL+  G PLRPGE  C++Y 
Sbjct  83   YPQHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYYGYPLRPGEKECSYYM  142

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  143  KTGQCKFGLTCKFHHP  158


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            ++ +PERPG+P+C +Y++TG C +G  C+++HPR+            +  P   G+P+C 
Sbjct  34   DSPYPERPGEPDCAYYIRTGSCGYGERCRYNHPRDHGALAGAGRTGVVEYPQHVGQPVCE  93

Query  380  FYSRYGICKFGPSCKFDHP  324
            +Y + G CKFG +CK+ HP
Sbjct  94   YYMKTGTCKFGSTCKYHHP  112


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +YMKTG CKFG  CKFHHP+
Sbjct  129  YPLRPGEKECSYYMKTGQCKFGLTCKFHHPQ  159



>ref|XP_010938478.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Elaeis guineensis]
Length=463

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            +RE +FPERPGQPECQFYM+TGDCK+G  CK+HHPR+  IP  + +LSP+GLPLRPG  +
Sbjct  280  EREQMFPERPGQPECQFYMRTGDCKYGVTCKYHHPRDWSIPKTNCVLSPLGLPLRPGAQI  339

Query  386  CAFYSRYGICKFGPSCKFDHPMGVF  312
            CAFY+++G+CKFGP+CKFDHP+G  
Sbjct  340  CAFYAQHGVCKFGPTCKFDHPVGTL  364


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PE  GQP C++YMKTG CKFG+ CK+HHPR+        LL+  G PLRPGE  C++Y 
Sbjct  83   YPEHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYCGYPLRPGEKECSYYM  142

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  143  KTGQCKFGSTCKFHHP  158


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P+C +Y++TG C +G  C+++HP +R           +  P   G+P+C +Y 
Sbjct  37   YPERPGEPDCAYYIRTGSCGYGERCRYNHPPDRGALARSGRTGVVEYPEHVGQPVCEYYM  96

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CK+ HP
Sbjct  97   KTGTCKFGSTCKYHHP  112


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +YMKTG CKFG+ CKFHHP+
Sbjct  129  YPLRPGEKECSYYMKTGQCKFGSTCKFHHPQ  159



>ref|XP_004296815.1| PREDICTED: zinc finger CCCH domain-containing protein 34 [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 89/150 (59%), Gaps = 15/150 (10%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYAL------QRENVFPERP  537
            S Q  VG+   YG+++ S  A        P+Y  G  P   ++L      Q+E   PERP
Sbjct  250  STQTAVGSGALYGINQISPSA--------PAY-TGIFPTAPFSLGPPTTSQKEQSHPERP  300

Query  536  GQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGIC  357
            GQ ECQ+Y++TG+CKFG+ C++HHP E +       LS  GLP RPG PLC  Y++ G C
Sbjct  301  GQAECQYYLRTGECKFGSSCRYHHPAEVVPLKTPVALSSTGLPSRPGAPLCTHYAQRGAC  360

Query  356  KFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            KFG +CKFDHP+G  +Y+ S SS T+ P  
Sbjct  361  KFGSACKFDHPVGTLSYSPSASSLTDVPVA  390


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -2

Query  572  ALQRENV-FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPG  396
            AL+  +V +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLRPG
Sbjct  81   ALRAGSVEYPERVGQPVCQYYMRTGTCKFGATCKYHHPKQGGGSATPVSLNYYGYPLRPG  140

Query  395  EPLCAFYSRYGICKFGPSCKFDHP  324
            E  C++Y + G CKFG +CKF HP
Sbjct  141  ERECSYYVKTGQCKFGATCKFHHP  164


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   AL     +PERP + +C +Y++TG C +G+ C+++HPR+R           +  P 
Sbjct  32   MWQLALGPGESYPERPDEADCSYYLRTGICGYGSRCRYNHPRDRSAVTGALRAGSVEYPE  91

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            R G+P+C +Y R G CKFG +CK+ HP
Sbjct  92   RVGQPVCQYYMRTGTCKFGATCKYHHP  118



>gb|KCW58527.1| hypothetical protein EUGRSUZ_H01196 [Eucalyptus grandis]
Length=424

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 96/151 (64%), Gaps = 7/151 (5%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQ-----GMNPSYRAGTLPMGYYALQRENVFPER  540
            P S  L+ G   A G +   +VA + S      G  PS  +   P G  + Q+E +FP+R
Sbjct  250  PVSPALSPGARPAMGATSLYDVAQLTSSTPAIAGSYPSIPSSAGPWG--SSQKEQIFPQR  307

Query  539  PGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGI  360
             G+P+CQ+YM+TGDCKFG+ C++HHPR+R++     LL+P+GLPLRPG   CAFY + G 
Sbjct  308  AGEPDCQYYMRTGDCKFGSSCRYHHPRDRMVQGTSFLLNPLGLPLRPGVLPCAFYVQNGH  367

Query  359  CKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            CK+G +CKFDHPMG   Y+ S SS T+ P  
Sbjct  368  CKYGSTCKFDHPMGAMRYSPSASSLTDMPVA  398


 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P CQFY+KTG CKFGA CKFHHP+          L+  G PLR GE  C++Y 
Sbjct  101  YPERPGEPACQFYLKTGTCKFGASCKFHHPKNGGGSLNRVPLNMYGYPLRLGEQECSYYL  160

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  161  KTGQCKFGTTCKFHHP  176


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G P+C +YM+TG C FG+ C+++HPR+R      ++ +    P RPGEP C FY 
Sbjct  56   YPERSGMPDCAYYMRTGFCGFGSRCRYNHPRDR-AAVVAAVRATGDYPERPGEPACQFYL  114

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG SCKF HP
Sbjct  115  KTGTCKFGASCKFHHP  130


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P R G+ EC +Y+KTG CKFG  CKFHHP+
Sbjct  147  YPLRLGEQECSYYLKTGQCKFGTTCKFHHPQ  177



>tpg|DAA53995.1| TPA: hypothetical protein ZEAMMB73_505725 [Zea mays]
 tpg|DAA53996.1| TPA: hypothetical protein ZEAMMB73_505725 [Zea mays]
Length=220

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -2

Query  563  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLC  384
            +E  FPERPGQPEC+ YMKTG CK+GA CK+HHP+    P  + +LSP+GLPLRPG   C
Sbjct  51   QEYAFPERPGQPECEHYMKTGTCKYGAACKYHHPQYFSGPKSNCILSPLGLPLRPGSQPC  110

Query  383  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            A+Y+ +G CKFGP+CKFDHPMG   Y+IS SS T+ P  
Sbjct  111  AYYAHHGYCKFGPTCKFDHPMGTPNYSISTSSLTDVPIA  149



>ref|XP_010069978.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Eucalyptus 
grandis]
 gb|KCW58526.1| hypothetical protein EUGRSUZ_H01196 [Eucalyptus grandis]
Length=485

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 96/151 (64%), Gaps = 7/151 (5%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANVGSQ-----GMNPSYRAGTLPMGYYALQRENVFPER  540
            P S  L+ G   A G +   +VA + S      G  PS  +   P G  + Q+E +FP+R
Sbjct  250  PVSPALSPGARPAMGATSLYDVAQLTSSTPAIAGSYPSIPSSAGPWG--SSQKEQIFPQR  307

Query  539  PGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGI  360
             G+P+CQ+YM+TGDCKFG+ C++HHPR+R++     LL+P+GLPLRPG   CAFY + G 
Sbjct  308  AGEPDCQYYMRTGDCKFGSSCRYHHPRDRMVQGTSFLLNPLGLPLRPGVLPCAFYVQNGH  367

Query  359  CKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            CK+G +CKFDHPMG   Y+ S SS T+ P  
Sbjct  368  CKYGSTCKFDHPMGAMRYSPSASSLTDMPVA  398


 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P CQFY+KTG CKFGA CKFHHP+          L+  G PLR GE  C++Y 
Sbjct  101  YPERPGEPACQFYLKTGTCKFGASCKFHHPKNGGGSLNRVPLNMYGYPLRLGEQECSYYL  160

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  161  KTGQCKFGTTCKFHHP  176


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER G P+C +YM+TG C FG+ C+++HPR+R      ++ +    P RPGEP C FY 
Sbjct  56   YPERSGMPDCAYYMRTGFCGFGSRCRYNHPRDR-AAVVAAVRATGDYPERPGEPACQFYL  114

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG SCKF HP
Sbjct  115  KTGTCKFGASCKFHHP  130


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P R G+ EC +Y+KTG CKFG  CKFHHP+
Sbjct  147  YPLRLGEQECSYYLKTGQCKFGTTCKFHHPQ  177



>ref|XP_006855486.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
 gb|ERN16953.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
Length=458

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 88/130 (68%), Gaps = 17/130 (13%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSE-----VANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQP  528
            Q  VG    YGLS ++       + V S    PS   GT         +EN FPERPGQP
Sbjct  250  QQPVGTGSLYGLSPTATPYPGFFSPVSSSVAGPS---GT---------KENTFPERPGQP  297

Query  527  ECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFG  348
            ECQFYM+TGDCK+G+ C++HHP +R++P  +  LSPIG PLRPG P C+FY+++G+CKFG
Sbjct  298  ECQFYMRTGDCKYGSTCRYHHPPDRIVPQTNCTLSPIGFPLRPGAPTCSFYAQHGVCKFG  357

Query  347  PSCKFDHPMG  318
            P+CKFDHP+G
Sbjct  358  PTCKFDHPLG  367


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+++KTG CKFGA CK+HHPR          L+ +G PLRPG+  C++Y 
Sbjct  90   YPERVGQPTCQYFIKTGTCKFGATCKYHHPRYGGGLMSPVGLNILGYPLRPGDKECSYYV  149

Query  371  RYGICKFGPSCKFDHPMGVFT  309
            + G CKFGP+CKF HP  V T
Sbjct  150  KTGQCKFGPTCKFHHPQPVNT  170


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 3/90 (3%)
 Frame = -2

Query  584  MGYYALQREN---VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspig  414
            M   +L RE+    +PERPG+ +C FYMKTG C++GA C+++HP +R             
Sbjct  30   MWRLSLGRESGGEYYPERPGEADCMFYMKTGFCRYGANCRYNHPHDRNPAADVLQTGGGE  89

Query  413  lpLRPGEPLCAFYSRYGICKFGPSCKFDHP  324
             P R G+P C ++ + G CKFG +CK+ HP
Sbjct  90   YPERVGQPTCQYFIKTGTCKFGATCKYHHP  119



>emb|CDY53022.1| BnaC04g00080D [Brassica napus]
Length=458

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = -2

Query  596  GTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspi  417
            G  P G   L+ E+ FPERP +PECQ+Y+KTGDCKFG  CKFHHPR+R+ P P+  LS +
Sbjct  270  GVYPSGVVTLKEES-FPERPAEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSV  328

Query  416  glpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            GLPLRPG   C FY + G CKFG +CKFDHP+G   YN S SS  +AP  
Sbjct  329  GLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVA  378


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspi-glpLRPGEPLCAFY  375
            +PER G   CQFY+KTG CKFGA CKF+HPR         +   I G P+R GE  C+++
Sbjct  93   YPERLGALPCQFYLKTGTCKFGASCKFNHPRNAAGGSMTHVPLNIYGYPVRQGENECSYF  152

Query  374  SRYGICKFGPSCKFDHP  324
             + G CKFG +CKF HP
Sbjct  153  LKTGQCKFGITCKFHHP  169


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
               +P+R G P+C +YM+TG C +G+ C+F+HP +R      ++ +    P R G   C 
Sbjct  45   SEAYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDR-ASVEATVRATGQYPERLGALPCQ  103

Query  380  FYSRYGICKFGPSCKFDHP  324
            FY + G CKFG SCKF+HP
Sbjct  104  FYLKTGTCKFGASCKFNHP  122



>ref|XP_008438828.1| PREDICTED: zinc finger CCCH domain-containing protein 34 [Cucumis 
melo]
Length=481

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 4/144 (3%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q +VG+   YG++  S  A+  +    P   AG         Q+E+ FPERPGQPECQ
Sbjct  255  SAQPSVGSGPLYGMAHVSPSASAFAGSYQPMPSAGPSSTS----QKEHSFPERPGQPECQ  310

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YM+TGDCKFG+ C++HHP E +   P  +LS +GLPLRPG P C  + + G+CKFGP+C
Sbjct  311  YYMRTGDCKFGSSCRYHHPPELVTSRPSVVLSQLGLPLRPGAPPCTHFMQRGMCKFGPAC  370

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDH M   +Y+ S SS  + P  
Sbjct  371  KFDHSMDRLSYSPSASSLADMPVA  394


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLRPGE  C++Y 
Sbjct  90   YPERIGQPVCQYYMRTGMCKFGASCKYHHPQQERGSLSPVSLNFYGYPLRPGEKECSYYL  149

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  150  KNGQCKFGATCKFHHP  165


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -2

Query  557  NVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAF  378
            + +PERP + +C +Y++TG C +G+ C+F+HPRER      S L     P R G+P+C +
Sbjct  42   DSYPERPDEADCIYYLRTGFCGYGSRCRFNHPRERSPALGGSRLGGREYPERIGQPVCQY  101

Query  377  YSRYGICKFGPSCKFDHP  324
            Y R G+CKFG SCK+ HP
Sbjct  102  YMRTGMCKFGASCKYHHP  119



>ref|XP_009588295.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Nicotiana 
tomentosiformis]
Length=494

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            Q+E+ FPERPGQPECQ+YMK GDCK+G+ C++HHP E   P    +LS +GLPLRPG P+
Sbjct  305  QKEHAFPERPGQPECQYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPI  364

Query  386  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  279
            C+ Y++ G+CKFGPSCKFDHPMG+ +Y+ S SS T+
Sbjct  365  CSHYAQNGVCKFGPSCKFDHPMGM-SYSPSASSLTD  399


 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHPR+    P    ++  G PLRPGE  C++Y 
Sbjct  93   YPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKECSYYV  152

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  153  KTGQCKFGVTCKFHHP  168


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP +P+C +Y++TG C +GA C+F+HPR+R         +    P R G+P+C +Y 
Sbjct  47   YPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMRATGGEYPERVGQPVCQYYM  106

Query  371  RYGICKFGPSCKFDHP  324
            R G+CKFG SCK+ HP
Sbjct  107  RTGMCKFGASCKYHHP  122



>ref|XP_007035523.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
 gb|EOY06449.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
Length=472

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 91/142 (64%), Gaps = 3/142 (2%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q TVG+S  +G++  S  A   +    P     +      + Q+E  FPERPGQPECQ+Y
Sbjct  247  QPTVGSSSIFGVTPLSPSAPAYT---GPYLPVPSSVGPSSSSQKEQSFPERPGQPECQYY  303

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            MKTGDCK+G+ C++HHP E + P  D +L P+GLPLRPG P C+ YS+ G+CKFG +CKF
Sbjct  304  MKTGDCKYGSSCRYHHPPEVIAPKADVMLGPLGLPLRPGAPPCSHYSQRGVCKFGAACKF  363

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHP G  +Y+ S SS  + P  
Sbjct  364  DHPTGTLSYSPSASSLADMPVA  385


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFG  CK+HHP++        LL+  G PLRPGE  C++Y 
Sbjct  84   YPERVGQPVCQYYMRTGTCKFGVSCKYHHPKQGGGSVSSVLLNYYGYPLRPGEKECSYYV  143

Query  371  RYGICKFGPSCKFDH  327
            + G CKFG +CKF H
Sbjct  144  KTGQCKFGATCKFHH  158


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP + +C +Y++TG C +G+ C+F+HPR+R              P R G+P+C +Y 
Sbjct  38   YPERPEEADCIYYLRTGFCGYGSRCRFNHPRDRAAVMGAGRGGVGEYPERVGQPVCQYYM  97

Query  371  RYGICKFGPSCKFDHP  324
            R G CKFG SCK+ HP
Sbjct  98   RTGTCKFGVSCKYHHP  113



>gb|KHG22563.1| hypothetical protein F383_29382 [Gossypium arboreum]
Length=475

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 95/142 (67%), Gaps = 3/142 (2%)
 Frame = -2

Query  692  QLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFY  513
            Q  VG +  YGL++ S  +     G  PS  + T P    + Q++  FPERPG+PECQ+Y
Sbjct  249  QPAVGATSLYGLTQLSS-STPSLAGPYPSLPSSTGPSS--SNQKDQTFPERPGEPECQYY  305

Query  512  MKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKF  333
            ++TGDCKFG+ C++HHPR+R++P  + +LSP+GLPLRPG   C+FY + G CKFG +CKF
Sbjct  306  LRTGDCKFGSTCRYHHPRDRVVPRTNCILSPMGLPLRPGVQPCSFYLQNGHCKFGSTCKF  365

Query  332  DHPMGVFTYNISPSSTTNAPTV  267
            DHP+G   YN S SS  + P  
Sbjct  366  DHPVGAMRYNPSASSFIDMPVA  387


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPG+P CQFY+KTG CKFGA CKFHHP+          L+  G PLRPGE  C++Y 
Sbjct  90   YPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSQVPLNIYGYPLRPGEEECSYYL  149

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  150  KMGQCKFGVTCKFHHP  165


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -2

Query  584  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpL  405
            M   +L+    +PERPG P+C +YM+TG C +G+ C+++HPR R      ++ +    P 
Sbjct  34   MWQLSLRGAESYPERPGVPDCVYYMRTGLCGYGSRCRYNHPRNR-AAVEAAVRATGEYPE  92

Query  404  RPGEPLCAFYSRYGICKFGPSCKFDHP  324
            RPGEP C FY + G CKFG SCKF HP
Sbjct  93   RPGEPACQFYLKTGTCKFGASCKFHHP  119


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPR  459
            +P RPG+ EC +Y+K G CKFG  CKFHHP+
Sbjct  136  YPLRPGEEECSYYLKMGQCKFGVTCKFHHPQ  166



>gb|AGT16102.1| hypothetical protein SHCRBa_134_J05_F_10 [Saccharum hybrid cultivar 
R570]
Length=353

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -2

Query  563  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLC  384
            +E  FPERPGQPEC+ YMKTG CK+GAVCK+HHP+    P  + +LSP+GLPLRPG   C
Sbjct  198  QEYAFPERPGQPECEHYMKTGTCKYGAVCKYHHPQYFSGPKSNCILSPLGLPLRPGSQPC  257

Query  383  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            A+Y+ +G CKFGP+CKFDHPMG   Y+IS SS T+ P  
Sbjct  258  AYYAHHGFCKFGPTCKFDHPMGTPNYSISASSLTDVPVA  296


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPGQP C++Y K G CKFG+ CKF HPRE         L+  G PLR GE  C++Y 
Sbjct  4    YPERPGQPLCEYYAKNGTCKFGSNCKFDHPRE--GGFVPVTLNSSGFPLRLGEKECSYYM  61

Query  371  RYGICKFGPSCKFDHP-MGVFT  309
            + G CKFG +CKF HP +G  T
Sbjct  62   KTGHCKFGATCKFHHPELGFLT  83



>gb|AGT16494.1| zinc finger CCCH type domain-containing protein [Saccharum hybrid 
cultivar R570]
Length=448

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = -2

Query  704  PESQQLTVGNSQAYGLSRSSEVANV--GSQGMNPSYRAGTLPMGYYALQRENVFPERPGQ  531
            P   Q  V  + +YGLS     + V  GS         GT         +E  FPERPGQ
Sbjct  235  PAGGQQAVPAAASYGLSHQGPTSAVTYGSHYAQLYSSTGTSSSNI----QEYAFPERPGQ  290

Query  530  PECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKF  351
            PEC+ YMKTG CK+GAVCK+HHP+    P  + +LSP+GLPLRPG   CA+Y+ +G CKF
Sbjct  291  PECEHYMKTGTCKYGAVCKYHHPQYFSGPKSNCILSPLGLPLRPGSQPCAYYAHHGFCKF  350

Query  350  GPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            GP+CKFDHPMG   Y+IS SS T+ P  
Sbjct  351  GPTCKFDHPMGTPNYSISASSLTDVPVA  378


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglp--LRPGEPL  387
            E   PERPG+ +C +Y++TG C +G  C+++HPR+R  P      +   +    RPG+PL
Sbjct  35   EEKLPERPGEADCAYYLRTGACGYGERCRYNHPRDRPAPVNGVGKTAGMVEYPERPGQPL  94

Query  386  CAFYSRYGICKFGPSCKFDHP  324
            C +Y++ G CKFG +CKFDHP
Sbjct  95   CEYYAKNGTCKFGSNCKFDHP  115


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERPGQP C++Y K G CKFG+ CKF HPRE         L+  G PLR GE  C++Y 
Sbjct  86   YPERPGQPLCEYYAKNGTCKFGSNCKFDHPRE--GGFVPVTLNSSGFPLRLGEKECSYYM  143

Query  371  RYGICKFGPSCKFDHP-MGVFT  309
            + G CKFG +CKF HP +G  T
Sbjct  144  KTGHCKFGATCKFHHPELGFLT  165



>ref|XP_010270054.1| PREDICTED: zinc finger CCCH domain-containing protein 12 isoform 
X2 [Nelumbo nucifera]
Length=385

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPERP QPECQ+YMKTG CKFG  CK+HHP+ER+ P   S L P+GLPLRPG+ +C FY+
Sbjct  222  FPERPDQPECQYYMKTGSCKFGPTCKYHHPKERIAPLATSTLGPLGLPLRPGQAVCTFYT  281

Query  371  RYGICKFGPSCKFDHPMGV-FTYNIS-PSSTTNAPTV  267
             YGICK+GP+CK+DHP+G  F+Y++S P+ +   PT+
Sbjct  282  LYGICKYGPTCKYDHPLGAYFSYSMSLPALSMPDPTL  318


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGE  393
            A+Q     PER GQP+CQ+++KTG CKFGA CK+HHPR+R       LL+ +GLP+R  E
Sbjct  19   AVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDR-HDTAHVLLNILGLPMRQEE  77

Query  392  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  294
              C +Y R G CKFG +CKF HP       +SP
Sbjct  78   KSCPYYMRTGSCKFGMACKFHHPQPATLGLVSP  110



>ref|XP_001752915.1| predicted protein [Physcomitrella patens]
 gb|EDQ82419.1| predicted protein, partial [Physcomitrella patens]
Length=78

 Score =   107 bits (267),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -2

Query  560  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCA  381
            E++FPERPGQPECQ+YMKTGDCKFG  C++HHP++R  P P   LSPIGLPLRPG   C+
Sbjct  1    ESLFPERPGQPECQYYMKTGDCKFGTTCRYHHPKDRTTPSPTCHLSPIGLPLRPGNLPCS  60

Query  380  FYSRYGICKFGPSCKFDH  327
            FY+RYGICKFGP+CKFDH
Sbjct  61   FYTRYGICKFGPTCKFDH  78



>ref|XP_010270055.1| PREDICTED: zinc finger CCCH domain-containing protein 57 isoform 
X3 [Nelumbo nucifera]
Length=345

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            FPERP QPECQ+YMKTG CKFG  CK+HHP+ER+ P   S L P+GLPLRPG+ +C FY+
Sbjct  182  FPERPDQPECQYYMKTGSCKFGPTCKYHHPKERIAPLATSTLGPLGLPLRPGQAVCTFYT  241

Query  371  RYGICKFGPSCKFDHPMGV-FTYNIS-PSSTTNAPTV  267
             YGICK+GP+CK+DHP+G  F+Y++S P+ +   PT+
Sbjct  242  LYGICKYGPTCKYDHPLGAYFSYSMSLPALSMPDPTL  278


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +P+RPG+P+C +Y++TG C +G+ C+F+HP         ++     LP R G+P C ++ 
Sbjct  49   YPDRPGEPDCIYYLRTGLCGYGSNCRFNHP----AYAGRAVQYRGELPERVGQPDCQYFL  104

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CK+ HP
Sbjct  105  KTGTCKFGATCKYHHP  120


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  572  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRER  453
            A+Q     PER GQP+CQ+++KTG CKFGA CK+HHPR+R
Sbjct  84   AVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDR  123



>ref|XP_009774842.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Nicotiana sylvestris]
Length=492

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -2

Query  566  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPL  387
            Q+E+ FPERPGQPECQ+YMK GDCK+G+ C++HHP E   P    +LS +GLPLRPG P+
Sbjct  305  QKEHAFPERPGQPECQYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPI  364

Query  386  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  279
            C+ Y++ G+CKFGPSCKFDHPMG+ +Y+ S SS  +
Sbjct  365  CSHYAQNGVCKFGPSCKFDHPMGM-SYSPSASSLAD  399


 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHPR+    P    ++  G PLRPGE  C++Y 
Sbjct  93   YPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKECSYYV  152

Query  371  RYGICKFGPSCKFDHP  324
            + G CKFG +CKF HP
Sbjct  153  KTGQCKFGVTCKFHHP  168


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PERP +P+C +Y++TG C +GA C+F+HPR+R         +    P R G+P+C +Y 
Sbjct  47   YPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMRATGGEYPERVGQPVCQYYM  106

Query  371  RYGICKFGPSCKFDHP  324
            R G+CKFG SCK+ HP
Sbjct  107  RTGMCKFGASCKYHHP  122



>ref|XP_004169150.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like, 
partial [Cucumis sativus]
Length=403

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 4/144 (3%)
 Frame = -2

Query  698  SQQLTVGNSQAYGLSRSSEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQ  519
            S Q +VG+   YG++  S  A+    G   SY+           Q+E+ FPERPGQPECQ
Sbjct  177  SAQPSVGSGPLYGMAHVSPSAS----GFAGSYQPMPSTGPSSTSQKEHSFPERPGQPECQ  232

Query  518  FYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSC  339
            +YM+TGDCKFG+ C++HHP E +   P  +LS +GLPLRPG P C  + + G+CKFGP+C
Sbjct  233  YYMRTGDCKFGSSCRYHHPPELVTSRPSVVLSQLGLPLRPGAPPCTHFMQRGMCKFGPAC  292

Query  338  KFDHPMGVFTYNISPSSTTNAPTV  267
            KFDH M   +Y+ S SS  + P  
Sbjct  293  KFDHSMDRLSYSPSASSLADMPVA  316


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = -2

Query  551  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERlipppdsllspiglpLRPGEPLCAFYS  372
            +PER GQP CQ+YM+TG CKFGA CK+HHP++         L+  G PLRPGE  C++Y 
Sbjct  12   YPERIGQPVCQYYMRTGMCKFGASCKYHHPQQERGSLSPVSLNFYGYPLRPGEKECSYYL  71

Query  371  RYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  267
            + G CKFG +CKF HP        +PS    AP  
Sbjct  72   KNGQCKFGATCKFHHPEPAGLQFPAPSPVQVAPIA  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350