BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047B21

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609054.1|  PREDICTED: probable serine/threonine-protein...    229   4e-67   Nicotiana tomentosiformis
ref|XP_006357240.1|  PREDICTED: probable serine/threonine-protein...    228   2e-66   Solanum tuberosum [potatoes]
ref|XP_004239372.1|  PREDICTED: probable serine/threonine-protein...    228   2e-66   Solanum lycopersicum
ref|XP_011086418.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    219   6e-63   
ref|XP_009770043.1|  PREDICTED: probable serine/threonine-protein...    215   1e-61   Nicotiana sylvestris
ref|XP_007044396.1|  Kinase, putative                                   196   2e-54   
gb|KDP21248.1|  hypothetical protein JCGZ_21719                         194   2e-52   Jatropha curcas
gb|KJB31395.1|  hypothetical protein B456_005G189300                    189   5e-52   Gossypium raimondii
ref|XP_008389548.1|  PREDICTED: probable serine/threonine-protein...    188   8e-52   Malus domestica [apple tree]
ref|XP_008339953.1|  PREDICTED: probable serine/threonine-protein...    188   2e-51   
gb|KDO36103.1|  hypothetical protein CISIN_1g036683mg                   175   5e-51   Citrus sinensis [apfelsine]
ref|XP_009360415.1|  PREDICTED: probable serine/threonine-protein...    185   9e-51   Pyrus x bretschneideri [bai li]
ref|XP_008221705.1|  PREDICTED: probable serine/threonine-protein...    184   3e-50   Prunus mume [ume]
ref|XP_007225115.1|  hypothetical protein PRUPE_ppa002671mg             182   9e-50   Prunus persica
ref|XP_010096313.1|  putative serine/threonine-protein kinase           182   1e-49   Morus notabilis
ref|XP_002520164.1|  kinase, putative                                   180   9e-49   Ricinus communis
gb|KGN51865.1|  hypothetical protein Csa_5G604100                       180   1e-48   Cucumis sativus [cucumbers]
ref|XP_004300632.1|  PREDICTED: probable serine/threonine-protein...    179   1e-48   Fragaria vesca subsp. vesca
ref|XP_004135207.1|  PREDICTED: probable serine/threonine-protein...    179   2e-48   Cucumis sativus [cucumbers]
ref|XP_008446290.1|  PREDICTED: probable serine/threonine-protein...    179   2e-48   Cucumis melo [Oriental melon]
ref|XP_010272197.1|  PREDICTED: probable serine/threonine-protein...    178   3e-48   Nelumbo nucifera [Indian lotus]
ref|XP_011011859.1|  PREDICTED: probable serine/threonine-protein...    177   5e-48   Populus euphratica
ref|XP_006483266.1|  PREDICTED: probable serine/threonine-protein...    177   6e-48   Citrus sinensis [apfelsine]
ref|XP_006438552.1|  hypothetical protein CICLE_v10030927mg             177   6e-48   Citrus clementina [clementine]
ref|XP_002268965.1|  PREDICTED: probable serine/threonine-protein...    177   6e-48   Vitis vinifera
ref|XP_006378174.1|  hypothetical protein POPTR_0010s04470g             175   6e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010255997.1|  PREDICTED: probable serine/threonine-protein...    174   7e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010551637.1|  PREDICTED: probable serine/threonine-protein...    173   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_003519780.1|  PREDICTED: probable serine/threonine-protein...    173   3e-46   Glycine max [soybeans]
ref|XP_006300627.1|  hypothetical protein CARUB_v10019905mg             172   7e-46   
gb|EYU28685.1|  hypothetical protein MIMGU_mgv1a018084mg                165   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_007157572.1|  hypothetical protein PHAVU_002G080400g             170   2e-45   Phaseolus vulgaris [French bean]
ref|XP_010470994.1|  PREDICTED: probable serine/threonine-protein...    170   2e-45   Camelina sativa [gold-of-pleasure]
gb|AAG52555.1|AC010675_3  putative protein kinase; 23181-21271          169   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177149.2|  Protein kinase superfamily protein                    169   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552604.1|  PREDICTED: probable serine/threonine-protein...    169   8e-45   Tarenaya hassleriana [spider flower]
ref|XP_010512057.1|  PREDICTED: probable serine/threonine-protein...    169   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010415660.1|  PREDICTED: probable serine/threonine-protein...    169   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004489958.1|  PREDICTED: probable serine/threonine-protein...    167   2e-44   Cicer arietinum [garbanzo]
ref|XP_003613504.1|  Wall-associated receptor kinase-like protein       166   5e-44   
gb|KFK41415.1|  hypothetical protein AALP_AA2G128000                    166   1e-43   Arabis alpina [alpine rockcress]
ref|XP_002863111.1|  kinase family protein                              165   1e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_008810583.1|  PREDICTED: probable serine/threonine-protein...    163   7e-43   Phoenix dactylifera
emb|CDY48385.1|  BnaA07g24040D                                          163   8e-43   Brassica napus [oilseed rape]
ref|XP_009104977.1|  PREDICTED: probable serine/threonine-protein...    163   8e-43   Brassica rapa
emb|CDY23541.1|  BnaC06g25100D                                          162   2e-42   Brassica napus [oilseed rape]
ref|XP_010935442.1|  PREDICTED: probable serine/threonine-protein...    160   7e-42   Elaeis guineensis
ref|XP_010046656.1|  PREDICTED: probable serine/threonine-protein...    159   8e-42   Eucalyptus grandis [rose gum]
ref|XP_009400976.1|  PREDICTED: probable serine/threonine-protein...    159   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60026.1|  hypothetical protein M569_14776                         159   2e-41   Genlisea aurea
ref|XP_010683296.1|  PREDICTED: probable serine/threonine-protein...    159   3e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010418542.1|  PREDICTED: probable serine/threonine-protein...    153   2e-39   
ref|XP_006390949.1|  hypothetical protein EUTSA_v10018260mg             152   6e-39   Eutrema salsugineum [saltwater cress]
ref|XP_002466268.1|  hypothetical protein SORBIDRAFT_01g004780          143   4e-36   Sorghum bicolor [broomcorn]
ref|XP_004981394.1|  PREDICTED: probable serine/threonine-protein...    142   1e-35   Setaria italica
ref|XP_006842745.1|  hypothetical protein AMTR_s00133p00058260          141   4e-35   
gb|EAZ28946.1|  hypothetical protein OsJ_12990                          138   9e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003559287.1|  PREDICTED: probable serine/threonine-protein...    138   2e-34   Brachypodium distachyon [annual false brome]
ref|XP_008665609.1|  PREDICTED: probable serine/threonine-protein...    138   2e-34   Zea mays [maize]
ref|NP_001173673.1|  Os03g0802100                                       138   2e-34   
dbj|BAJ85037.1|  predicted protein                                      138   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001774205.1|  predicted protein                                  122   2e-29   
gb|AEW90969.1|  hypothetical protein                                    115   1e-28   Pinus taeda
gb|AEW90971.1|  hypothetical protein                                    115   1e-28   Pinus taeda
gb|AEW90980.1|  hypothetical protein                                    115   2e-28   Pinus taeda
gb|AEW90970.1|  hypothetical protein                                    115   2e-28   Pinus taeda
gb|AEW90972.1|  hypothetical protein                                    114   3e-28   Pinus taeda
gb|AEW90968.1|  hypothetical protein                                    114   3e-28   Pinus taeda
dbj|BAJ96733.1|  predicted protein                                      122   7e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96357.1|  predicted protein                                      122   7e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003577672.1|  PREDICTED: wall-associated receptor kinase-l...    121   1e-27   
gb|EMS50841.1|  Wall-associated receptor kinase-like 14                 116   4e-27   Triticum urartu
gb|AAW81731.1|  putative Basic helix-loop-helix(bHLH) family protein    112   1e-26   Brassica oleracea
ref|XP_009127496.1|  PREDICTED: probable serine/threonine-protein...    118   2e-26   Brassica rapa
ref|XP_009127495.1|  PREDICTED: probable serine/threonine-protein...    118   2e-26   Brassica rapa
ref|XP_009127494.1|  PREDICTED: probable serine/threonine-protein...    118   2e-26   Brassica rapa
emb|CDY12594.1|  BnaA02g12620D                                          118   2e-26   Brassica napus [oilseed rape]
emb|CDP07589.1|  unnamed protein product                                116   6e-26   Coffea canephora [robusta coffee]
ref|XP_002960238.1|  hypothetical protein SELMODRAFT_139490             113   7e-26   
ref|XP_002967476.1|  hypothetical protein SELMODRAFT_87751              113   1e-25   
ref|XP_009127497.1|  PREDICTED: probable serine/threonine-protein...    115   2e-25   
ref|XP_006293370.1|  hypothetical protein CARUB_v10022765mg             115   2e-25   Capsella rubella
ref|XP_009347440.1|  PREDICTED: probable serine/threonine-protein...    114   2e-25   Pyrus x bretschneideri [bai li]
emb|CDX96118.1|  BnaA07g26130D                                          108   2e-25   
ref|XP_008674033.1|  PREDICTED: WAK-like kinase isoform X1              114   3e-25   Zea mays [maize]
tpg|DAA47345.1|  TPA: putative WAK-related receptor-like protein ...    114   3e-25   
ref|XP_006391445.1|  hypothetical protein EUTSA_v10018045mg             115   3e-25   
ref|XP_010540002.1|  PREDICTED: probable serine/threonine-protein...    114   3e-25   Tarenaya hassleriana [spider flower]
ref|NP_001147438.1|  WAK-like kinase precursor                          114   3e-25   
ref|XP_010540003.1|  PREDICTED: probable serine/threonine-protein...    114   3e-25   Tarenaya hassleriana [spider flower]
emb|CDY61885.1|  BnaCnng38660D                                          114   3e-25   Brassica napus [oilseed rape]
ref|XP_006391446.1|  hypothetical protein EUTSA_v10018045mg             115   4e-25   
ref|XP_008374780.1|  PREDICTED: probable serine/threonine-protein...    114   4e-25   Malus domestica [apple tree]
emb|CDY50595.1|  BnaC02g16920D                                          112   4e-25   Brassica napus [oilseed rape]
ref|XP_006430730.1|  hypothetical protein CICLE_v10011179mg             114   5e-25   Citrus clementina [clementine]
ref|XP_008374779.1|  PREDICTED: probable serine/threonine-protein...    113   5e-25   Malus domestica [apple tree]
ref|XP_009117279.1|  PREDICTED: wall-associated receptor kinase-l...    113   6e-25   Brassica rapa
emb|CDY68677.1|  BnaCnng60020D                                          113   7e-25   Brassica napus [oilseed rape]
ref|XP_007158796.1|  hypothetical protein PHAVU_002G182500g             113   7e-25   Phaseolus vulgaris [French bean]
ref|XP_004963056.1|  PREDICTED: wall-associated receptor kinase-l...    113   8e-25   Setaria italica
gb|AEW07680.1|  hypothetical protein 0_8683_01                          106   8e-25   Pinus lambertiana
emb|CDX89573.1|  BnaC04g35920D                                          113   9e-25   
emb|CDX96120.1|  BnaA07g26110D                                          113   9e-25   
emb|CDY65028.1|  BnaC05g50050D                                          110   9e-25   Brassica napus [oilseed rape]
gb|KDO63212.1|  hypothetical protein CISIN_1g013686mg                   110   9e-25   Citrus sinensis [apfelsine]
ref|XP_006482215.1|  PREDICTED: probable serine/threonine-protein...    111   9e-25   
ref|XP_006482214.1|  PREDICTED: probable serine/threonine-protein...    113   1e-24   Citrus sinensis [apfelsine]
ref|XP_010106074.1|  Wall-associated receptor kinase-like 14            110   1e-24   
ref|XP_010415223.1|  PREDICTED: probable serine/threonine-protein...    112   1e-24   
emb|CDY46073.1|  BnaA09g41970D                                          112   1e-24   Brassica napus [oilseed rape]
ref|XP_002510319.1|  kinase, putative                                   112   1e-24   
ref|XP_009360135.1|  PREDICTED: probable serine/threonine-protein...    111   1e-24   
ref|XP_008347440.1|  PREDICTED: wall-associated receptor kinase-l...    110   2e-24   
gb|AAL91622.1|  At2g23450/F26B6.10                                      112   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565552.1|  wall-associated receptor kinase-like 14               112   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHN40934.1|  Putative serine/threonine-protein kinase                107   2e-24   Glycine soja [wild soybean]
emb|CDY38944.1|  BnaA04g13650D                                          112   2e-24   Brassica napus [oilseed rape]
ref|XP_007142946.1|  hypothetical protein PHAVU_007G0307001g            109   2e-24   Phaseolus vulgaris [French bean]
ref|XP_009140464.1|  PREDICTED: wall-associated receptor kinase-l...    111   2e-24   Brassica rapa
emb|CDY01771.1|  BnaC06g28110D                                          111   3e-24   
ref|XP_010415222.1|  PREDICTED: probable serine/threonine-protein...    111   3e-24   
emb|CDY01770.1|  BnaC06g28100D                                          111   3e-24   
emb|CDX81871.1|  BnaC08g37300D                                          111   3e-24   
ref|XP_009105240.1|  PREDICTED: probable serine/threonine-protein...    111   4e-24   Brassica rapa
ref|XP_004512900.1|  PREDICTED: probable serine/threonine-protein...    111   4e-24   Cicer arietinum [garbanzo]
ref|XP_009360133.1|  PREDICTED: probable serine/threonine-protein...    110   4e-24   Pyrus x bretschneideri [bai li]
tpg|DAA38848.1|  TPA: putative WAK receptor-like protein kinase f...    108   4e-24   
ref|XP_004512901.1|  PREDICTED: probable serine/threonine-protein...    110   4e-24   Cicer arietinum [garbanzo]
ref|XP_002880505.1|  kinase family protein                              111   4e-24   Arabidopsis lyrata subsp. lyrata
emb|CDY52891.1|  BnaC06g27840D                                          110   5e-24   Brassica napus [oilseed rape]
ref|XP_003592612.1|  hypothetical protein MTR_1g110130                  111   5e-24   
gb|KDP29455.1|  hypothetical protein JCGZ_18376                         105   5e-24   Jatropha curcas
ref|XP_010922259.1|  PREDICTED: probable serine/threonine-protein...    108   5e-24   
ref|XP_004512899.1|  PREDICTED: probable serine/threonine-protein...    110   6e-24   Cicer arietinum [garbanzo]
ref|XP_004963055.1|  PREDICTED: wall-associated receptor kinase-l...    110   6e-24   Setaria italica
ref|XP_010922266.1|  PREDICTED: probable serine/threonine-protein...    108   6e-24   
gb|KJB17856.1|  hypothetical protein B456_003G019500                    110   7e-24   Gossypium raimondii
ref|XP_008671496.1|  PREDICTED: probable serine/threonine-protein...    108   7e-24   
ref|XP_006404832.1|  hypothetical protein EUTSA_v10000066mg             110   7e-24   Eutrema salsugineum [saltwater cress]
emb|CDY21708.1|  BnaA09g44590D                                          110   7e-24   Brassica napus [oilseed rape]
ref|XP_009365635.1|  PREDICTED: wall-associated receptor kinase-l...    110   7e-24   Pyrus x bretschneideri [bai li]
ref|XP_008377371.1|  PREDICTED: wall-associated receptor kinase-l...    110   7e-24   
ref|XP_004291924.1|  PREDICTED: wall-associated receptor kinase-l...    110   7e-24   Fragaria vesca subsp. vesca
ref|XP_006605928.1|  PREDICTED: probable serine/threonine-protein...    110   8e-24   Glycine max [soybeans]
gb|KDO76913.1|  hypothetical protein CISIN_1g0479691mg                  107   8e-24   Citrus sinensis [apfelsine]
ref|XP_009117614.1|  PREDICTED: probable serine/threonine-protein...    110   8e-24   Brassica rapa
ref|XP_010472340.1|  PREDICTED: wall-associated receptor kinase-l...    110   8e-24   Camelina sativa [gold-of-pleasure]
ref|NP_001067182.1|  Os12g0595800                                       110   9e-24   
ref|XP_010417096.1|  PREDICTED: wall-associated receptor kinase-l...    110   9e-24   Camelina sativa [gold-of-pleasure]
gb|EAY83755.1|  hypothetical protein OsI_38972                          110   9e-24   Oryza sativa Indica Group [Indian rice]
gb|ABG22068.1|  Protein kinase domain containing protein, expressed     110   9e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006448414.1|  hypothetical protein CICLE_v10014492mg             110   1e-23   Citrus clementina [clementine]
ref|XP_010429293.1|  PREDICTED: wall-associated receptor kinase-l...    110   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006416610.1|  hypothetical protein EUTSA_v10007020mg             109   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009622953.1|  PREDICTED: probable serine/threonine-protein...    109   1e-23   Nicotiana tomentosiformis
ref|XP_010316315.1|  PREDICTED: probable serine/threonine-protein...    110   1e-23   Solanum lycopersicum
ref|XP_011021277.1|  PREDICTED: probable serine/threonine-protein...    109   1e-23   Populus euphratica
ref|XP_010415226.1|  PREDICTED: probable serine/threonine-protein...    109   1e-23   
gb|KHG05164.1|  Wall-associated receptor kinase-like 14                 109   1e-23   Gossypium arboreum [tree cotton]
ref|XP_006842370.1|  hypothetical protein AMTR_s00079p00188790          108   1e-23   
ref|XP_009149279.1|  PREDICTED: probable serine/threonine-protein...    109   1e-23   Brassica rapa
ref|XP_009622954.1|  PREDICTED: probable serine/threonine-protein...    109   1e-23   Nicotiana tomentosiformis
ref|XP_006301694.1|  hypothetical protein CARUB_v10022151mg             110   1e-23   
gb|AES73970.2|  wall associated kinase-like protein                     109   1e-23   Medicago truncatula
gb|ABA99190.2|  Protein kinase domain containing protein, expressed     109   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010415225.1|  PREDICTED: probable serine/threonine-protein...    109   1e-23   
ref|XP_009149280.1|  PREDICTED: probable serine/threonine-protein...    109   2e-23   Brassica rapa
gb|AAG50588.1|AC083891_2  wall-associated kinase, putative              110   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006664705.1|  PREDICTED: wall-associated receptor kinase-l...    108   2e-23   
gb|AFG66670.1|  hypothetical protein 0_8683_01                          102   2e-23   Pinus taeda
ref|XP_006468738.1|  PREDICTED: probable serine/threonine-protein...    109   2e-23   Citrus sinensis [apfelsine]
ref|XP_002527016.1|  wall-associated kinase, putative                   108   2e-23   Ricinus communis
gb|KJB31466.1|  hypothetical protein B456_005G193100                    109   2e-23   Gossypium raimondii
ref|XP_009622952.1|  PREDICTED: probable serine/threonine-protein...    109   2e-23   Nicotiana tomentosiformis
ref|XP_010511593.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009802455.1|  PREDICTED: probable serine/threonine-protein...    109   2e-23   Nicotiana sylvestris
ref|XP_006375036.1|  hypothetical protein POPTR_0014s03810g             109   2e-23   
ref|XP_011031055.1|  PREDICTED: wall-associated receptor kinase-l...    108   2e-23   Populus euphratica
gb|KGN63838.1|  hypothetical protein Csa_1G024230                       107   2e-23   Cucumis sativus [cucumbers]
ref|XP_006366440.1|  PREDICTED: wall-associated receptor kinase-l...    108   2e-23   Solanum tuberosum [potatoes]
ref|XP_009391159.1|  PREDICTED: probable serine/threonine-protein...    107   2e-23   
gb|AAG60067.1|AC013288_1  protein kinase, putative                      110   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511592.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|NP_176860.2|  serine/threonine protein kinase                       110   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511594.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   Camelina sativa [gold-of-pleasure]
gb|KDP38442.1|  hypothetical protein JCGZ_04367                         108   2e-23   Jatropha curcas
ref|XP_011031029.1|  PREDICTED: wall-associated receptor kinase-l...    108   2e-23   Populus euphratica
gb|KCW64692.1|  hypothetical protein EUGRSUZ_G02280                     107   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010415224.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   
ref|XP_010470565.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010470566.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006856200.1|  hypothetical protein AMTR_s00059p00192290          108   2e-23   Amborella trichopoda
ref|XP_010470564.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006383414.1|  hypothetical protein POPTR_0005s15270g             108   2e-23   
ref|XP_010922240.1|  PREDICTED: probable serine/threonine-protein...    108   2e-23   
ref|XP_010316317.1|  PREDICTED: probable serine/threonine-protein...    108   3e-23   Solanum lycopersicum
gb|KJB38887.1|  hypothetical protein B456_007G1836001                   106   3e-23   Gossypium raimondii
ref|XP_009802454.1|  PREDICTED: probable serine/threonine-protein...    108   3e-23   Nicotiana sylvestris
ref|XP_010511591.1|  PREDICTED: probable serine/threonine-protein...    108   3e-23   Camelina sativa [gold-of-pleasure]
gb|ACU23279.1|  unknown                                                 103   3e-23   Glycine max [soybeans]
ref|XP_004232335.1|  PREDICTED: probable serine/threonine-protein...    108   3e-23   Solanum lycopersicum
ref|XP_004238203.1|  PREDICTED: wall-associated receptor kinase-l...    108   3e-23   Solanum lycopersicum
ref|XP_010316316.1|  PREDICTED: probable serine/threonine-protein...    108   3e-23   
gb|KCW83895.1|  hypothetical protein EUGRSUZ_B00747                     105   3e-23   Eucalyptus grandis [rose gum]
ref|XP_002442442.1|  hypothetical protein SORBIDRAFT_08g020100          108   3e-23   Sorghum bicolor [broomcorn]
ref|XP_010470563.1|  PREDICTED: probable serine/threonine-protein...    108   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010470561.1|  PREDICTED: probable serine/threonine-protein...    108   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010922245.1|  PREDICTED: probable serine/threonine-protein...    108   4e-23   
emb|CDY26166.1|  BnaA06g12510D                                          108   4e-23   Brassica napus [oilseed rape]
gb|KDO84381.1|  hypothetical protein CISIN_1g007442mg                   107   4e-23   Citrus sinensis [apfelsine]
ref|XP_010922253.1|  PREDICTED: probable serine/threonine-protein...    108   4e-23   
ref|XP_011021278.1|  PREDICTED: probable serine/threonine-protein...    108   4e-23   Populus euphratica
ref|XP_002968448.1|  hypothetical protein SELMODRAFT_89809              105   4e-23   
ref|NP_001167990.1|  uncharacterized LOC100381711 precursor             107   5e-23   Zea mays [maize]
ref|XP_006473409.1|  PREDICTED: wall-associated receptor kinase-l...    107   5e-23   Citrus sinensis [apfelsine]
ref|XP_002516765.1|  wall-associated kinase, putative                   108   5e-23   
ref|XP_006434895.1|  hypothetical protein CICLE_v10000511mg             107   5e-23   Citrus clementina [clementine]
ref|XP_009108191.1|  PREDICTED: probable serine/threonine-protein...    107   5e-23   
gb|AEW07681.1|  hypothetical protein 0_8683_01                          101   5e-23   Pinus radiata
ref|XP_009394439.1|  PREDICTED: probable serine/threonine-protein...    105   5e-23   
gb|AES75438.2|  wall associated kinase-like protein                     107   5e-23   Medicago truncatula
ref|XP_007033202.1|  Kinase family protein, putative isoform 1          108   5e-23   
ref|XP_007139177.1|  hypothetical protein PHAVU_008G007900g             107   6e-23   Phaseolus vulgaris [French bean]
gb|AFG66675.1|  hypothetical protein 0_8683_01                          101   6e-23   Pinus taeda
ref|XP_003619220.1|  Wall-associated receptor kinase-like protein       107   6e-23   
ref|XP_003592617.1|  Wall-associated receptor kinase-like protein       107   6e-23   
gb|AFG66662.1|  hypothetical protein 0_8683_01                          101   6e-23   Pinus taeda
gb|KHN22281.1|  Wall-associated receptor kinase-like 14                 107   6e-23   Glycine soja [wild soybean]
ref|XP_003527703.1|  PREDICTED: wall-associated receptor kinase-l...    107   6e-23   Glycine max [soybeans]
ref|XP_003611850.1|  Kinase-like protein                                107   6e-23   Medicago truncatula
gb|EEC76354.1|  hypothetical protein OsI_13937                          105   6e-23   Oryza sativa Indica Group [Indian rice]
gb|KDP35040.1|  hypothetical protein JCGZ_09328                         107   6e-23   Jatropha curcas
ref|XP_009412515.1|  PREDICTED: wall-associated receptor kinase-l...    107   6e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES62863.2|  wall associated kinase-like protein                     107   7e-23   Medicago truncatula
gb|KJB38886.1|  hypothetical protein B456_007G1836001                   106   7e-23   Gossypium raimondii
ref|XP_009616014.1|  PREDICTED: wall-associated receptor kinase-l...    107   7e-23   Nicotiana tomentosiformis
ref|XP_011083766.1|  PREDICTED: wall-associated receptor kinase-l...    107   7e-23   Sesamum indicum [beniseed]
ref|XP_009794572.1|  PREDICTED: wall-associated receptor kinase-l...    107   7e-23   Nicotiana sylvestris
ref|XP_003619214.1|  Wall-associated receptor kinase-like protein       107   7e-23   
ref|XP_008240314.1|  PREDICTED: probable serine/threonine-protein...    107   7e-23   
ref|XP_008220730.1|  PREDICTED: wall-associated receptor kinase-l...    107   7e-23   Prunus mume [ume]
emb|CDY52892.1|  BnaC06g27850D                                          107   7e-23   Brassica napus [oilseed rape]
ref|XP_010908096.1|  PREDICTED: wall-associated receptor kinase-l...    107   8e-23   Elaeis guineensis
gb|ACN33695.1|  unknown                                                 107   8e-23   Zea mays [maize]
ref|XP_004160450.1|  PREDICTED: probable serine/threonine-protein...    107   8e-23   
ref|XP_007226546.1|  hypothetical protein PRUPE_ppa024936mg             107   8e-23   
ref|XP_007139178.1|  hypothetical protein PHAVU_008G007900g             107   8e-23   Phaseolus vulgaris [French bean]
gb|KHN12475.1|  Putative serine/threonine-protein kinase                107   9e-23   Glycine soja [wild soybean]
ref|XP_004137545.1|  PREDICTED: probable serine/threonine-protein...    107   9e-23   
ref|XP_004497060.1|  PREDICTED: probable serine/threonine-protein...    107   9e-23   Cicer arietinum [garbanzo]
ref|XP_007156857.1|  hypothetical protein PHAVU_002G023400g             107   9e-23   Phaseolus vulgaris [French bean]
ref|XP_007142949.1|  hypothetical protein PHAVU_007G030900g             107   9e-23   Phaseolus vulgaris [French bean]
ref|XP_010548399.1|  PREDICTED: wall-associated receptor kinase-l...    107   9e-23   Tarenaya hassleriana [spider flower]
ref|XP_006585075.1|  PREDICTED: probable serine/threonine-protein...    107   1e-22   Glycine max [soybeans]
dbj|BAF02226.1|  wall-associated kinase like protein                    107   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389437.1|  PREDICTED: wall-associated receptor kinase-l...    107   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003624374.1|  Ser/Thr protein kinase                             107   1e-22   
ref|XP_003624375.1|  Ser/Thr protein kinase                             107   1e-22   
ref|XP_010263819.1|  PREDICTED: wall-associated receptor kinase-l...    107   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010068728.1|  PREDICTED: probable serine/threonine-protein...    104   1e-22   
ref|XP_003624373.1|  Ser/Thr protein kinase                             107   1e-22   
gb|AAN60342.1|  unknown                                                 107   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009407350.1|  PREDICTED: probable serine/threonine-protein...    106   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002318540.2|  hypothetical protein POPTR_0012s05090g             104   1e-22   
ref|XP_009407341.1|  PREDICTED: probable serine/threonine-protein...    106   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407357.1|  PREDICTED: probable serine/threonine-protein...    106   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009105241.1|  PREDICTED: probable serine/threonine-protein...    107   1e-22   Brassica rapa
ref|XP_006303925.1|  hypothetical protein CARUB_v10008544mg             106   1e-22   Capsella rubella
ref|XP_010906921.1|  PREDICTED: wall-associated receptor kinase-l...    106   1e-22   Elaeis guineensis
ref|XP_008229260.1|  PREDICTED: probable serine/threonine-protein...    106   1e-22   Prunus mume [ume]
gb|KHN37244.1|  Putative serine/threonine-protein kinase                104   1e-22   Glycine soja [wild soybean]
ref|XP_010042926.1|  PREDICTED: probable serine/threonine-protein...    104   1e-22   
ref|XP_007044245.1|  Kinase superfamily protein, putative isoform 1     106   1e-22   
gb|KCW64689.1|  hypothetical protein EUGRSUZ_G02277                     104   1e-22   Eucalyptus grandis [rose gum]
ref|XP_008229259.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   Prunus mume [ume]
ref|XP_008229261.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   Prunus mume [ume]
ref|XP_008790198.1|  PREDICTED: wall-associated receptor kinase-l...    106   2e-22   Phoenix dactylifera
ref|XP_006604085.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   Glycine max [soybeans]
ref|XP_010068749.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   Eucalyptus grandis [rose gum]
ref|XP_007033203.1|  Wall-associated kinase, putative isoform 2         106   2e-22   
ref|XP_010535318.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-22   
ref|XP_009392373.1|  PREDICTED: wall-associated receptor kinase-l...    106   2e-22   
ref|XP_006357829.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   
ref|XP_010099270.1|  putative serine/threonine-protein kinase           106   2e-22   
ref|XP_004511986.1|  PREDICTED: wall-associated receptor kinase-l...    106   2e-22   
ref|XP_006604084.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   
gb|KCW64661.1|  hypothetical protein EUGRSUZ_G02246                     104   2e-22   
ref|XP_009601566.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   
ref|XP_010664629.1|  PREDICTED: wall-associated receptor kinase-l...    106   2e-22   
ref|XP_009601567.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   
ref|XP_002522378.1|  kinase, putative                                   106   2e-22   
ref|XP_009601565.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   
ref|XP_006425789.1|  hypothetical protein CICLE_v10025043mg             106   2e-22   
ref|XP_008792620.1|  PREDICTED: wall-associated receptor kinase-l...    106   2e-22   
ref|XP_008229262.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   
gb|KHN06683.1|  Putative serine/threonine-protein kinase                106   2e-22   
ref|XP_006583429.1|  PREDICTED: probable serine/threonine-protein...    105   2e-22   
ref|XP_008229263.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   
ref|XP_008782360.1|  PREDICTED: probable serine/threonine-protein...    103   2e-22   
ref|XP_009600764.1|  PREDICTED: probable serine/threonine-protein...    105   2e-22   
gb|KCW64663.1|  hypothetical protein EUGRSUZ_G02248                     104   2e-22   
emb|CDX86810.1|  BnaA09g22000D                                          106   2e-22   
ref|XP_003555250.1|  PREDICTED: probable serine/threonine-protein...    105   2e-22   
ref|XP_009601563.1|  PREDICTED: probable serine/threonine-protein...    106   2e-22   
ref|XP_006357831.1|  PREDICTED: probable serine/threonine-protein...    105   2e-22   
ref|XP_011458446.1|  PREDICTED: probable serine/threonine-protein...    105   2e-22   
emb|CDP02756.1|  unnamed protein product                                103   3e-22   
gb|AES80593.2|  wall associated kinase-like protein                     105   3e-22   
gb|KCW45663.1|  hypothetical protein EUGRSUZ_L00560                     103   3e-22   
gb|AES80591.2|  wall associated kinase-like protein                     105   3e-22   
ref|XP_006357830.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
ref|XP_007217639.1|  hypothetical protein PRUPE_ppa002429mg             105   3e-22   
ref|XP_004290448.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
gb|KDO79395.1|  hypothetical protein CISIN_1g005522mg                   105   3e-22   
ref|XP_004290450.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
emb|CDX96117.1|  BnaA07g26140D                                          105   3e-22   
gb|KEH27004.1|  wall-associated kinase-like protein                     105   3e-22   
dbj|BAB11288.1|  unnamed protein product                                106   3e-22   
ref|XP_002887084.1|  hypothetical protein ARALYDRAFT_894396             105   3e-22   
ref|XP_011465376.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
ref|XP_006838635.1|  hypothetical protein AMTR_s00002p00236690          105   3e-22   
ref|XP_010039876.1|  PREDICTED: probable serine/threonine-protein...    103   3e-22   
ref|XP_006344314.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
gb|KCW86142.1|  hypothetical protein EUGRSUZ_B02841                     103   3e-22   
ref|XP_009622286.1|  PREDICTED: probable serine/threonine-protein...    102   3e-22   
gb|KHN20765.1|  Putative serine/threonine-protein kinase                106   3e-22   
ref|XP_006589676.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
ref|XP_004290449.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
ref|XP_002307237.1|  hypothetical protein POPTR_0005s13920g             105   3e-22   
ref|XP_003533930.2|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
ref|XP_010477016.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
gb|EYU45087.1|  hypothetical protein MIMGU_mgv1a002843mg                105   3e-22   
gb|KHN29805.1|  Putative serine/threonine-protein kinase                105   3e-22   
ref|XP_010039882.1|  PREDICTED: probable serine/threonine-protein...    103   3e-22   
gb|KCW45668.1|  hypothetical protein EUGRSUZ_L00569                     103   3e-22   
ref|XP_006603050.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
ref|XP_006583428.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22   
ref|XP_002993997.1|  hypothetical protein SELMODRAFT_25054              102   4e-22   
ref|XP_004300505.1|  PREDICTED: probable serine/threonine-protein...    105   4e-22   
ref|XP_006605927.1|  PREDICTED: wall-associated receptor kinase-l...    105   4e-22   
ref|XP_007044246.1|  Kinase superfamily protein, putative isoform 2     105   4e-22   
gb|KFK41095.1|  hypothetical protein AALP_AA2G085200                    105   4e-22   
ref|XP_002979084.1|  hypothetical protein SELMODRAFT_25174              102   4e-22   
ref|XP_011004593.1|  PREDICTED: wall-associated receptor kinase-l...    105   4e-22   
gb|KDP32982.1|  hypothetical protein JCGZ_13013                         105   4e-22   
gb|KHN23761.1|  Putative serine/threonine-protein kinase                104   4e-22   
ref|XP_004300506.2|  PREDICTED: probable serine/threonine-protein...    105   4e-22   
ref|XP_003517271.1|  PREDICTED: wall-associated receptor kinase-l...    105   4e-22   
ref|XP_010477015.1|  PREDICTED: probable serine/threonine-protein...    105   4e-22   
ref|XP_010255034.1|  PREDICTED: wall-associated receptor kinase-l...    105   4e-22   
gb|KEH20472.1|  wall associated kinase-like protein                     105   4e-22   
ref|XP_006583427.1|  PREDICTED: probable serine/threonine-protein...    105   4e-22   
ref|XP_002305832.2|  hypothetical protein POPTR_0004s09580g             105   4e-22   
ref|XP_006603052.1|  PREDICTED: probable serine/threonine-protein...    105   5e-22   
ref|XP_010070472.1|  PREDICTED: wall-associated receptor kinase-l...    105   5e-22   
ref|XP_010039879.1|  PREDICTED: probable serine/threonine-protein...    102   5e-22   
ref|NP_001238417.1|  serine/threonine protein kinase family protein     105   5e-22   
ref|XP_010064777.1|  PREDICTED: probable serine/threonine-protein...    105   5e-22   
ref|XP_010459452.1|  PREDICTED: probable serine/threonine-protein...    104   6e-22   
ref|XP_007210376.1|  hypothetical protein PRUPE_ppa001217mg             105   6e-22   
gb|KCW64691.1|  hypothetical protein EUGRSUZ_G02279                     102   6e-22   
gb|KHN17296.1|  Putative serine/threonine-protein kinase                105   6e-22   
ref|XP_006383412.1|  hypothetical protein POPTR_0005s15240g             104   6e-22   
gb|KCW86140.1|  hypothetical protein EUGRSUZ_B02837                     102   7e-22   
ref|XP_008453431.1|  PREDICTED: probable serine/threonine-protein...    105   7e-22   
gb|AES62868.2|  wall associated kinase-like protein                     104   7e-22   
ref|XP_006605929.1|  PREDICTED: probable serine/threonine-protein...    104   7e-22   
ref|XP_010498225.1|  PREDICTED: probable serine/threonine-protein...    104   7e-22   
ref|XP_010459451.1|  PREDICTED: probable serine/threonine-protein...    104   7e-22   
emb|CDX74541.1|  BnaA04g08480D                                          105   8e-22   
gb|KCW68952.1|  hypothetical protein EUGRSUZ_F025172                    104   8e-22   
ref|XP_010099273.1|  putative serine/threonine-protein kinase           104   8e-22   
ref|XP_002455236.1|  hypothetical protein SORBIDRAFT_03g006850          102   8e-22   
ref|XP_002524904.1|  wall-associated kinase, putative                   104   8e-22   
ref|XP_006603051.1|  PREDICTED: probable serine/threonine-protein...    104   9e-22   
ref|XP_009139770.1|  PREDICTED: probable serine/threonine-protein...    105   9e-22   
ref|XP_011045830.1|  PREDICTED: probable serine/threonine-protein...    104   9e-22   
ref|XP_010068747.1|  PREDICTED: probable serine/threonine-protein...    104   9e-22   
ref|XP_010498226.1|  PREDICTED: probable serine/threonine-protein...    104   9e-22   
ref|XP_011045829.1|  PREDICTED: probable serine/threonine-protein...    104   9e-22   
ref|XP_007047100.1|  Kinase superfamily protein                         104   9e-22   
gb|KDO39222.1|  hypothetical protein CISIN_1g017232mg                   102   9e-22   
ref|XP_009793146.1|  PREDICTED: probable serine/threonine-protein...    104   9e-22   
ref|NP_001154349.1|  probable serine/threonine-protein kinase           104   9e-22   
gb|EPS73768.1|  hypothetical protein M569_00987                         103   1e-21   
ref|XP_002310180.1|  hypothetical protein POPTR_0007s11990g             104   1e-21   
gb|KFK43998.1|  hypothetical protein AALP_AA1G201500                    104   1e-21   
ref|XP_004152788.1|  PREDICTED: wall-associated receptor kinase-l...    104   1e-21   
ref|XP_010108877.1|  putative serine/threonine-protein kinase           103   1e-21   
gb|KHG13439.1|  Wall-associated receptor kinase-like 14                 104   1e-21   
gb|KJB43590.1|  hypothetical protein B456_007G208300                    104   1e-21   
ref|XP_006388427.1|  hypothetical protein POPTR_0188s002402g            100   1e-21   
ref|XP_011025667.1|  PREDICTED: wall-associated receptor kinase-l...    103   1e-21   
ref|NP_173275.4|  probable serine/threonine-protein kinase              103   1e-21   
ref|XP_006338251.1|  PREDICTED: wall-associated receptor kinase-l...    103   1e-21   
ref|XP_006393874.1|  hypothetical protein EUTSA_v10003840mg             103   1e-21   
ref|XP_006353811.1|  PREDICTED: probable serine/threonine-protein...    101   1e-21   
ref|XP_009341914.1|  PREDICTED: wall-associated receptor kinase-l...    103   1e-21   
ref|XP_002305830.2|  hypothetical protein POPTR_0004s09640g             103   1e-21   
ref|XP_004504581.1|  PREDICTED: probable serine/threonine-protein...    103   1e-21   
ref|XP_006578002.1|  PREDICTED: wall-associated receptor kinase-l...    103   1e-21   
gb|KHN04540.1|  Wall-associated receptor kinase-like 14                 103   1e-21   
ref|XP_003523885.1|  PREDICTED: wall-associated receptor kinase-l...    103   1e-21   
ref|NP_001234504.1|  wall-associated receptor kinase-like 14 prec...    103   1e-21   
ref|XP_009415309.1|  PREDICTED: wall-associated receptor kinase-l...    103   1e-21   
ref|XP_010068727.1|  PREDICTED: probable serine/threonine-protein...    103   1e-21   
ref|XP_006387971.1|  hypothetical protein POPTR_0442s00200g             103   1e-21   
ref|XP_003548009.1|  PREDICTED: wall-associated receptor kinase-l...    103   1e-21   
ref|XP_002890272.1|  F15H18.11                                          104   1e-21   
ref|XP_006384188.1|  hypothetical protein POPTR_0004s09610g             103   1e-21   
ref|XP_009793145.1|  PREDICTED: probable serine/threonine-protein...    103   1e-21   
ref|XP_009801718.1|  PREDICTED: probable serine/threonine-protein...    103   1e-21   
ref|XP_010089008.1|  Wall-associated receptor kinase-like 14            103   1e-21   
ref|XP_011035095.1|  PREDICTED: probable serine/threonine-protein...    103   1e-21   
ref|XP_006388423.1|  hypothetical protein POPTR_0188s002102g          98.2    1e-21   
ref|XP_009760973.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   
gb|AAS45124.1|  WAK-like kinase                                         103   2e-21   
ref|XP_010068748.1|  PREDICTED: probable serine/threonine-protein...    102   2e-21   
ref|XP_009341926.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_004509198.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_009760974.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   
ref|XP_010550388.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
gb|KHN42112.1|  Putative serine/threonine-protein kinase              99.4    2e-21   
ref|XP_010646389.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_010046523.1|  PREDICTED: probable serine/threonine-protein...    101   2e-21   
ref|XP_002275295.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_009589485.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   
ref|XP_004238903.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   
ref|XP_006290688.1|  hypothetical protein CARUB_v10016781mg             103   2e-21   
gb|KDP35039.1|  hypothetical protein JCGZ_09327                         103   2e-21   
gb|KCW86297.1|  hypothetical protein EUGRSUZ_B02988                     101   2e-21   
ref|XP_008367960.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_010320744.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   
gb|KCW86131.1|  hypothetical protein EUGRSUZ_B02823                     100   2e-21   
ref|XP_010680965.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_009371964.1|  PREDICTED: wall-associated receptor kinase-l...  99.4    2e-21   
ref|XP_010044107.1|  PREDICTED: probable serine/threonine-protein...    100   2e-21   
ref|XP_010028331.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_002301212.2|  hypothetical protein POPTR_0002s13210g             103   2e-21   
ref|XP_010046527.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   
dbj|BAK05177.1|  predicted protein                                      103   2e-21   
ref|XP_008444664.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_010046526.1|  PREDICTED: probable serine/threonine-protein...    102   2e-21   
gb|KFK43997.1|  hypothetical protein AALP_AA1G201500                    103   2e-21   
ref|XP_006388060.1|  hypothetical protein POPTR_0373s00210g             103   2e-21   
ref|XP_007017425.1|  Kinase superfamily protein                         103   2e-21   
ref|XP_011099534.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   
ref|NP_198637.2|  protein kinase family protein                         103   2e-21   
ref|XP_008241591.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
emb|CDP00659.1|  unnamed protein product                                101   2e-21   
ref|XP_009589479.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   
gb|KHN13357.1|  Wall-associated receptor kinase-like 14                 103   2e-21   
ref|XP_009379147.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
gb|KCW45665.1|  hypothetical protein EUGRSUZ_L00566                     100   2e-21   
ref|XP_008351005.1|  PREDICTED: probable serine/threonine-protein...  99.4    2e-21   
gb|KHN20762.1|  Putative serine/threonine-protein kinase                100   2e-21   
ref|XP_007204625.1|  hypothetical protein PRUPE_ppa002163mg             103   2e-21   
gb|KJB71062.1|  hypothetical protein B456_011G103300                    102   2e-21   
ref|NP_001238739.1|  wall-associated kinase                             103   2e-21   
ref|XP_010264788.1|  PREDICTED: probable serine/threonine-protein...    102   3e-21   
ref|XP_006574720.1|  PREDICTED: wall-associated receptor kinase-l...    103   3e-21   
ref|XP_011099531.1|  PREDICTED: probable serine/threonine-protein...    103   3e-21   
gb|AAF25996.1|AC013354_15  F15H18.11                                    103   3e-21   
gb|KCW64693.1|  hypothetical protein EUGRSUZ_G02282                     100   3e-21   
gb|KHN00584.1|  Wall-associated receptor kinase-like 14                 103   3e-21   
gb|KHG04381.1|  Wall-associated receptor kinase-like 14                 103   3e-21   
ref|XP_001776649.1|  predicted protein                                  100   3e-21   
ref|XP_011096985.1|  PREDICTED: probable serine/threonine-protein...    102   3e-21   
ref|XP_009801720.1|  PREDICTED: probable serine/threonine-protein...    100   3e-21   
ref|XP_010068725.1|  PREDICTED: probable serine/threonine-protein...  99.8    3e-21   
ref|XP_011099536.1|  PREDICTED: probable serine/threonine-protein...    102   3e-21   
ref|XP_004497058.1|  PREDICTED: probable serine/threonine-protein...    102   3e-21   
gb|KCW86295.1|  hypothetical protein EUGRSUZ_B02985                     101   3e-21   
ref|XP_010528496.1|  PREDICTED: probable serine/threonine-protein...    102   3e-21   
ref|XP_009381737.1|  PREDICTED: probable serine/threonine-protein...    100   3e-21   
ref|XP_010528497.1|  PREDICTED: probable serine/threonine-protein...    102   3e-21   
ref|XP_008347439.1|  PREDICTED: wall-associated receptor kinase-l...    101   4e-21   
ref|XP_004501050.1|  PREDICTED: wall-associated receptor kinase-l...    102   4e-21   
gb|KDP20149.1|  hypothetical protein JCGZ_05918                       99.4    4e-21   
ref|XP_010660405.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
gb|KDP29454.1|  hypothetical protein JCGZ_18375                         101   4e-21   
ref|XP_010528498.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
ref|XP_011099533.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
ref|XP_011035096.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
ref|XP_010910519.1|  PREDICTED: probable serine/threonine-protein...    100   4e-21   
ref|XP_011035098.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
ref|XP_009600766.1|  PREDICTED: probable serine/threonine-protein...    100   4e-21   
ref|XP_010528494.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
ref|XP_010528495.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
ref|XP_011035099.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
gb|KDP31840.1|  hypothetical protein JCGZ_12301                         102   4e-21   
gb|KGN64141.1|  hypothetical protein Csa_1G042520                       100   4e-21   
ref|XP_009357791.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
ref|XP_011099532.1|  PREDICTED: probable serine/threonine-protein...    102   4e-21   
ref|XP_002527017.1|  wall-associated kinase, putative                   102   5e-21   
gb|EYU44613.1|  hypothetical protein MIMGU_mgv1a018009mg                102   5e-21   
ref|XP_008243423.1|  PREDICTED: probable serine/threonine-protein...    102   5e-21   
ref|XP_008338734.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    102   5e-21   
ref|XP_010663616.1|  PREDICTED: probable serine/threonine-protein...    102   5e-21   
ref|XP_010450952.1|  PREDICTED: probable serine/threonine-protein...    102   5e-21   



>ref|XP_009609054.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana tomentosiformis]
Length=635

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 123/138 (89%), Gaps = 4/138 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++SFRLNEKSD+YSFGVVLLELITGMKAVDQ REK EM LADMVV +IQMGLL Q
Sbjct  497  LDPDYHKSFRLNEKSDIYSFGVVLLELITGMKAVDQKREKREMALADMVVSRIQMGLLQQ  556

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR----GSGV  362
            V+DPVLVVDGEA EGVGAVAELAFRCVAADKDDRPD+R+V AELRRIR RAR    G G+
Sbjct  557  VVDPVLVVDGEAIEGVGAVAELAFRCVAADKDDRPDSRDVVAELRRIRGRARGVGSGGGI  616

Query  361  LRTSNSSNAVVPDGAGLI  308
            LRTSNSSN VVPDG GLI
Sbjct  617  LRTSNSSNMVVPDGLGLI  634



>ref|XP_006357240.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Solanum tuberosum]
Length=640

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 121/137 (88%), Gaps = 3/137 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++SFRLNEKSD+YSFGVVLLELITGMKAVDQ REK EM LADMVV +IQMGLL Q
Sbjct  503  LDPDYHKSFRLNEKSDIYSFGVVLLELITGMKAVDQKREKREMALADMVVSRIQMGLLQQ  562

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG---SGVL  359
            V+DP LVVDGEA EGVGAVAELAFRCVAADKDDRPD+R+V AELRRIR R RG    G+L
Sbjct  563  VVDPFLVVDGEAMEGVGAVAELAFRCVAADKDDRPDSRDVVAELRRIRGRTRGVGSGGIL  622

Query  358  RTSNSSNAVVPDGAGLI  308
            RTSNSSN VVPDG GLI
Sbjct  623  RTSNSSNMVVPDGIGLI  639



>ref|XP_004239372.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
Length=640

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 121/137 (88%), Gaps = 3/137 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++SFRLNEKSD+YSFGVVLLELITGMKAVDQ REK EM LADMVV +IQMGLL Q
Sbjct  503  LDPDYHKSFRLNEKSDIYSFGVVLLELITGMKAVDQKREKREMALADMVVSRIQMGLLQQ  562

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG---SGVL  359
            V+DP LVVDGEA EGVGAVAELAFRCVAADKDDRPD+R+V AELRRIR R RG    G+L
Sbjct  563  VVDPFLVVDGEAMEGVGAVAELAFRCVAADKDDRPDSRDVVAELRRIRGRTRGVGSGGIL  622

Query  358  RTSNSSNAVVPDGAGLI  308
            RTSNSSN VVPDG GLI
Sbjct  623  RTSNSSNMVVPDGIGLI  639



>ref|XP_011086418.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g18390 [Sesamum indicum]
Length=648

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDYYRSFRLNEKSD+YSFGVVLLELITGM+AVDQTREK EMTLADMVVP+IQMGLLHQ
Sbjct  511  LDPDYYRSFRLNEKSDIYSFGVVLLELITGMRAVDQTREKWEMTLADMVVPRIQMGLLHQ  570

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR--SRARGSGVLR  356
            V+DPVLVVDGEA EGV AVAELAFRCVAADKDDRPDAREVAAELR I+   R  GSG+LR
Sbjct  571  VVDPVLVVDGEAMEGVSAVAELAFRCVAADKDDRPDAREVAAELRMIKGRGRGGGSGMLR  630

Query  355  TSNSSNAVVPDGAG  314
             SNSSN VVPDG G
Sbjct  631  GSNSSNVVVPDGVG  644



>ref|XP_009770043.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=634

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 119/140 (85%), Gaps = 6/140 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++SFRLNEKSD+YSFGVVLLELITGMKAVDQ REK EM LADMVV +IQMGLL Q
Sbjct  494  LDPDYHKSFRLNEKSDIYSFGVVLLELITGMKAVDQKREKREMALADMVVSRIQMGLLQQ  553

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI------RSRARGS  368
            V+DPVLVVDGEA EGVGAVAELAFRCVAADKDDRPD+R+V AELRRI           G 
Sbjct  554  VVDPVLVVDGEATEGVGAVAELAFRCVAADKDDRPDSRDVVAELRRIRGRARGVGSGGGG  613

Query  367  GVLRTSNSSNAVVPDGAGLI  308
            G+LRTSNSSN VVPDG GLI
Sbjct  614  GILRTSNSSNMVVPDGLGLI  633



>ref|XP_007044396.1| Kinase, putative [Theobroma cacao]
 gb|EOY00228.1| Kinase, putative [Theobroma cacao]
Length=632

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 5/132 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQTREK EM LAD+ V KIQMGLLHQ
Sbjct  504  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQTREKREMALADLAVSKIQMGLLHQ  563

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRT-  353
            ++DPVLV DGEA +GV AVAELAFRCVAADKDDRPDARE+  EL+RIRSR R   VLR  
Sbjct  564  LVDPVLVHDGEAMDGVDAVAELAFRCVAADKDDRPDAREIVEELKRIRSRTR---VLRVS  620

Query  352  -SNSSNAVVPDG  320
             SN SN  V  G
Sbjct  621  YSNGSNTDVSKG  632



>gb|KDP21248.1| hypothetical protein JCGZ_21719 [Jatropha curcas]
Length=1258

 Score =   194 bits (492),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 93/130 (72%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -1

Query  709   LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
             LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+R+K EM LAD+VV KIQMG LHQ
Sbjct  1129  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSRDKREMALADLVVSKIQMGQLHQ  1188

Query  529   VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRTS  350
             V+DPVL+V+GEAKE + A AELAFRCVAADKDDRPD++EV  EL RIRS  RG G    S
Sbjct  1189  VVDPVLIVEGEAKESIYAAAELAFRCVAADKDDRPDSKEVVEELERIRSCTRGFGGANNS  1248

Query  349   NSSNAVVPDG  320
             N     V  G
Sbjct  1249  NGGEGDVAKG  1258


 Score =   192 bits (488),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+R+K EM LAD+VV KIQMG LHQ
Sbjct  516  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSRDKREMALADLVVSKIQMGQLHQ  575

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRTS  350
            V+DPVL+V+GEAKE + A AELAFRCVAADKDDRPD++EV  EL RIRS  RG G    S
Sbjct  576  VVDPVLIVEGEAKESIYAAAELAFRCVAADKDDRPDSKEVVEELERIRSCTRGFGGANNS  635

Query  349  N  347
            N
Sbjct  636  N  636



>gb|KJB31395.1| hypothetical protein B456_005G189300 [Gossypium raimondii]
Length=635

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 5/129 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ REK EM LAD+VV KIQMGLLHQ
Sbjct  496  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQRREKREMALADLVVSKIQMGLLHQ  555

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR--  356
            V+DP L++DG+  +GV AVAELAFRCVAADKDDRPDARE+  EL+RI++R R   VLR  
Sbjct  556  VVDPALILDGQPMDGVEAVAELAFRCVAADKDDRPDAREIVGELKRIKNRTR---VLRLS  612

Query  355  TSNSSNAVV  329
             SN SN  V
Sbjct  613  YSNGSNGEV  621



>ref|XP_008389548.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Malus domestica]
Length=636

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL +KSDVYSFGVVLLELI+GMKAVDQ R+K E+ LAD+VV KIQMGLLHQ
Sbjct  507  LDPDYHRSFRLTDKSDVYSFGVVLLELISGMKAVDQRRDKRELALADLVVSKIQMGLLHQ  566

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRTS  350
            V+DPVLVVDG+  +GV A AELAFRCVAADKDDRPDA+EV  EL+RIRS  RG   + +S
Sbjct  567  VVDPVLVVDGDVSDGVDAAAELAFRCVAADKDDRPDAKEVVEELKRIRSHTRGVSRVSSS  626

Query  349  N  347
            N
Sbjct  627  N  627



>ref|XP_008339953.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Malus domestica]
 ref|XP_008339954.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Malus domestica]
Length=719

 Score =   188 bits (477),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL +KSDVYSFGVVLLELI+G+KAVDQ R+K  + LAD+VV KIQ GLLHQ
Sbjct  590  LDPDYHRSFRLTDKSDVYSFGVVLLELISGLKAVDQRRDKRXLALADLVVQKIQTGLLHQ  649

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRTS  350
            V+DPVLVVDG+  +GV A AELAFRCVAADKDDRPDA+EV  EL+RIRSR RG     +S
Sbjct  650  VVDPVLVVDGDVSDGVYAAAELAFRCVAADKDDRPDAKEVVEELKRIRSRTRGVSRASSS  709

Query  349  NSSNAVVPDG  320
            N     V  G
Sbjct  710  NVMGEDVAKG  719



>gb|KDO36103.1| hypothetical protein CISIN_1g036683mg [Citrus sinensis]
Length=169

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+REK EM LAD+VV KIQMGLLHQ
Sbjct  38   LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSREKREMALADLVVSKIQMGLLHQ  97

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV--LR  356
            V+DPVL +  EA  GV A+AELAFRCVAADKDDRPDA+E+  EL+RI S  RG G   LR
Sbjct  98   VVDPVLALHEEAMNGVDALAELAFRCVAADKDDRPDAKEIVEELKRIGSCVRGGGGGDLR  157

Query  355  TSN  347
             SN
Sbjct  158  GSN  160



>ref|XP_009360415.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Pyrus x bretschneideri]
Length=636

 Score =   185 bits (470),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL +KSDVYSFGVVLLELI+G+KAVDQ R+K E+ LAD+VV KIQMGLLHQ
Sbjct  507  LDPDYHRSFRLTDKSDVYSFGVVLLELISGLKAVDQRRDKRELALADLVVSKIQMGLLHQ  566

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRTS  350
            V+DPVLVVDG+  +GV A AELAFRCVAADK DRPDA+EV  EL+RIRSR RG   + +S
Sbjct  567  VVDPVLVVDGDVSDGVDAAAELAFRCVAADKADRPDAKEVVEELKRIRSRTRGVSRVSSS  626

Query  349  N  347
            N
Sbjct  627  N  627



>ref|XP_008221705.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Prunus mume]
Length=647

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL +KSDVYSFGVVLLELI+G++AVDQ R+K E+ LAD+VV KIQMGLLHQ
Sbjct  518  LDPDYHRSFRLTDKSDVYSFGVVLLELISGLRAVDQRRDKRELALADLVVSKIQMGLLHQ  577

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRTS  350
            V+DPVL+VDG   +GV   AELAFRCVAADKDDRPDAREV  EL+RIRSR RG     +S
Sbjct  578  VVDPVLIVDGNVIDGVDVAAELAFRCVAADKDDRPDAREVVEELKRIRSRTRGMSRASSS  637

Query  349  N  347
            N
Sbjct  638  N  638



>ref|XP_007225115.1| hypothetical protein PRUPE_ppa002671mg [Prunus persica]
 gb|EMJ26314.1| hypothetical protein PRUPE_ppa002671mg [Prunus persica]
Length=646

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL +KSDVYSFGVVLLELI+G++AVDQ R+K E+ LAD+VV KIQMGLLHQ
Sbjct  517  LDPDYHRSFRLTDKSDVYSFGVVLLELISGLRAVDQRRDKRELALADLVVSKIQMGLLHQ  576

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRTS  350
            V+DPV +VDG   +GV   AELAFRCVAADKDDRPDAREV  EL+RIRSR RG     +S
Sbjct  577  VVDPVFIVDGNVIDGVDVAAELAFRCVAADKDDRPDAREVVEELKRIRSRTRGMSRASSS  636

Query  349  N  347
            N
Sbjct  637  N  637



>ref|XP_010096313.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB63788.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=635

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 100/117 (85%), Gaps = 2/117 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+GMKAVDQ+R K EM+LAD+VV KI MGLLHQ
Sbjct  506  LDPDYHRSFRLTEKSDVYSFGVVLLELISGMKAVDQSRSKMEMSLADLVVSKIHMGLLHQ  565

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            V+DPVL +  DG+A EGV AVAELAFRCVAADKDDRPDAREV  EL  IRSR R  G
Sbjct  566  VVDPVLAIGDDGDAIEGVDAVAELAFRCVAADKDDRPDAREVVEELSLIRSRTREGG  622



>ref|XP_002520164.1| kinase, putative [Ricinus communis]
 gb|EEF42219.1| kinase, putative [Ricinus communis]
Length=641

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+R+K EM LAD+VV KIQMG LHQ
Sbjct  505  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSRDKREMALADLVVSKIQMGQLHQ  564

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            V+DP+ + DG     EG+ AVAELAFRCVAADKDDRPDA+EV  EL+RIRSR RG
Sbjct  565  VVDPLFINDGREGGNEGIEAVAELAFRCVAADKDDRPDAKEVVEELKRIRSRTRG  619



>gb|KGN51865.1| hypothetical protein Csa_5G604100 [Cucumis sativus]
Length=652

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+RE+ EM LAD+VV KIQMG LHQ
Sbjct  494  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSRERREMALADLVVSKIQMGQLHQ  553

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRTS  350
            V+D VL VDGE  +GV A+AELAFRCVAADKDDRPDA+E+  ELRRIR+  RG      S
Sbjct  554  VVDSVLGVDGEVIDGVEAMAELAFRCVAADKDDRPDAKEIVEELRRIRNCTRGGVRSSIS  613

Query  349  NSS  341
            NS+
Sbjct  614  NST  616



>ref|XP_004300632.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Fragaria vesca subsp. vesca]
Length=621

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++SFRL +KSDVYSFGVV+LELI+G KAVDQ R+K E+ LADM+V KIQMGLLH+
Sbjct  495  LDPDYHKSFRLTDKSDVYSFGVVVLELISGQKAVDQRRDKRELALADMMVSKIQMGLLHE  554

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            V+DPVLVVDG   +GV A AELAFRCVAA+KDDRPDAREV  EL+RIRSR RG
Sbjct  555  VVDPVLVVDGSVTDGVDAAAELAFRCVAAEKDDRPDAREVVEELKRIRSRTRG  607



>ref|XP_004135207.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cucumis sativus]
 ref|XP_004155330.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cucumis sativus]
Length=622

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+RE+ EM LAD+VV KIQMG LHQ
Sbjct  494  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSRERREMALADLVVSKIQMGQLHQ  553

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            V+D VL VDGE  +GV A+AELAFRCVAADKDDRPDA+E+  ELRRIR+  RG
Sbjct  554  VVDSVLGVDGEVIDGVEAMAELAFRCVAADKDDRPDAKEIVEELRRIRNCTRG  606



>ref|XP_008446290.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Cucumis melo]
Length=622

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+RE+ EM LAD+VV KIQMG LHQ
Sbjct  494  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSRERREMALADLVVSKIQMGQLHQ  553

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            V+D VL VDGE  +GV A+AELAFRCVAADKDDRPDA+E+  ELRRIR+  RG
Sbjct  554  VVDSVLGVDGEVIDGVEAMAELAFRCVAADKDDRPDAKEIVEELRRIRNCTRG  606



>ref|XP_010272197.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nelumbo nucifera]
Length=639

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVL ELI+GMKAVD +R+K E+ LADMVV KIQ+G L Q
Sbjct  514  LDPDYHRSFRLTEKSDVYSFGVVLFELISGMKAVDHSRDKREVALADMVVSKIQVGTLQQ  573

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            V+DPVL+V+GE    V AVAELAFRCVAADKDDRPDA+E+ AEL+RIR+R RG
Sbjct  574  VVDPVLMVEGEVTSTVNAVAELAFRCVAADKDDRPDAKEIVAELKRIRNRTRG  626



>ref|XP_011011859.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Populus euphratica]
Length=636

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLEL++G++AVDQ+R+K EM LAD+VV KIQMGLL Q
Sbjct  523  LDPDYHRSFRLTEKSDVYSFGVVLLELVSGLRAVDQSRDKREMALADLVVSKIQMGLLRQ  582

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            V+DPVL VDGE   G+ +VAELAFRCVAADKDDRPD+REV  EL RIRSR  G
Sbjct  583  VVDPVLGVDGETMNGIESVAELAFRCVAADKDDRPDSREVVEELSRIRSRMIG  635



>ref|XP_006483266.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Citrus sinensis]
Length=649

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+REK EM LAD+VV KIQMGLLHQ
Sbjct  518  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSREKREMALADLVVSKIQMGLLHQ  577

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV--LR  356
            V+DPVL +  EA  GV A+AELAFRCVAADKDDRPDA+E+  EL+RI S  RG G   LR
Sbjct  578  VVDPVLALHEEAMNGVDALAELAFRCVAADKDDRPDAKEIVEELKRIGSCVRGGGGGDLR  637

Query  355  TSN  347
             SN
Sbjct  638  GSN  640



>ref|XP_006438552.1| hypothetical protein CICLE_v10030927mg [Citrus clementina]
 gb|ESR51792.1| hypothetical protein CICLE_v10030927mg [Citrus clementina]
Length=649

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVDQ+REK EM LAD+VV KIQMGLLHQ
Sbjct  518  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDQSREKREMALADLVVSKIQMGLLHQ  577

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV--LR  356
            V+DPVL +  EA  GV A+AELAFRCVAADKDDRPDA+E+  EL+RI S  RG G   LR
Sbjct  578  VVDPVLALHEEAMNGVDALAELAFRCVAADKDDRPDAKEIVEELKRIGSCVRGGGGGDLR  637

Query  355  TSN  347
             SN
Sbjct  638  GSN  640



>ref|XP_002268965.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Vitis vinifera]
Length=640

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS GVVLLELI+GMKAVD TR+K +MTLAD++V KIQMGLLHQ
Sbjct  516  LDPDYHRSFRLTEKSDVYSLGVVLLELISGMKAVDHTRDKRDMTLADLMVSKIQMGLLHQ  575

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP+L++D +A  GV AVAELAFRCV  +KDDRPD++EV AEL+RIR+R R
Sbjct  576  VVDPILLLDADAMNGVDAVAELAFRCVQTEKDDRPDSKEVVAELKRIRNRTR  627



>ref|XP_006378174.1| hypothetical protein POPTR_0010s04470g [Populus trichocarpa]
 gb|ERP55971.1| hypothetical protein POPTR_0010s04470g [Populus trichocarpa]
Length=637

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLEL++G++AVDQ+R+K EM LAD+VV KIQMGLL Q
Sbjct  523  LDPDYHRSFRLTEKSDVYSFGVVLLELVSGLRAVDQSRDKREMALADLVVSKIQMGLLRQ  582

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            V+DPVL VD E   G+ +VAELAFRCVAADKDDRPD+REV  EL RIRSR  G
Sbjct  583  VVDPVLGVDEETMNGIESVAELAFRCVAADKDDRPDSREVVEELSRIRSRTIG  635



>ref|XP_010255997.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nelumbo nucifera]
Length=633

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++SF+L EKSDVYSFGVVL ELI+GMKAVD +R+K E+ LADMVV KIQ+G LH 
Sbjct  507  LDPDYHKSFQLTEKSDVYSFGVVLFELISGMKAVDHSRDKREVALADMVVSKIQVGALHL  566

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRT  353
            V+DPVL+++GE    V AVAELAF+CVAADKDDRPDA+E+ AEL RIR+R RG  V  T
Sbjct  567  VVDPVLILEGETMSTVSAVAELAFQCVAADKDDRPDAKELVAELNRIRNRTRGHSVPST  625



>ref|XP_010551637.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Tarenaya hassleriana]
Length=661

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+EL+TGMKAVDQ REK EM LAD+VV KIQMGLL Q
Sbjct  542  LDPDYHRSFRLTEKSDVYSYGVVLMELMTGMKAVDQCREKPEMALADLVVSKIQMGLLDQ  601

Query  529  VLDPVLV--VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            V+DP+LV   DG    GV AVAELAFRCVAADKDDRPD+RE+ A+LRRI SR RG  V +
Sbjct  602  VVDPLLVQMSDGNGG-GVAAVAELAFRCVAADKDDRPDSREIVAQLRRIVSRTRGDDVAK  660



>ref|XP_003519780.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Glycine max]
Length=615

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 5/112 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G++AVDQ R+K EM LAD+VV +IQMG LHQ
Sbjct  502  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLRAVDQNRDKREMALADLVVSRIQMGQLHQ  561

Query  529  VLDPVL-VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            VLDPVL   DG    GV AVAELAFRCVAADKDDRPDAREV  EL+R+R+RA
Sbjct  562  VLDPVLDCADG----GVAAVAELAFRCVAADKDDRPDAREVVEELKRVRNRA  609



>ref|XP_006300627.1| hypothetical protein CARUB_v10019905mg, partial [Capsella rubella]
 gb|EOA33525.1| hypothetical protein CARUB_v10019905mg, partial [Capsella rubella]
Length=674

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 98/120 (82%), Gaps = 6/120 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGMKAVDQ REK +M LAD+VV KIQMGLL Q
Sbjct  547  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMKAVDQRREKRDMALADLVVSKIQMGLLDQ  606

Query  529  VLDPVLVVDGEAKE------GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            V+DPVL +DG+         GV AVAELAFRCVAADKDDRPDA+E+  ELRRIRS  R +
Sbjct  607  VIDPVLALDGDDVAAVTDGFGVAAVAELAFRCVAADKDDRPDAKEIVEELRRIRSHTRAA  666



>gb|EYU28685.1| hypothetical protein MIMGU_mgv1a018084mg, partial [Erythranthe 
guttata]
Length=326

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDYY SFRLNEKSD+YSFGVVLLELITGM+AVDQTRE  EMTLAD+VVPKIQMGLLHQ
Sbjct  209  LDPDYYSSFRLNEKSDIYSFGVVLLELITGMRAVDQTRELREMTLADLVVPKIQMGLLHQ  268

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAEL  398
            V+DPVLVVD  A EGV AVAELAFRC+AADKDDRPDAREV  EL
Sbjct  269  VVDPVLVVDVVAMEGVNAVAELAFRCLAADKDDRPDAREVVVEL  312



>ref|XP_007157572.1| hypothetical protein PHAVU_002G080400g [Phaseolus vulgaris]
 gb|ESW29566.1| hypothetical protein PHAVU_002G080400g [Phaseolus vulgaris]
Length=620

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+GMKAVDQ+R+K EM LAD+VV +IQMG LHQ
Sbjct  507  LDPDYHRSFRLTEKSDVYSFGVVLLELISGMKAVDQSRDKREMALADLVVSRIQMGQLHQ  566

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            VLDP         +GV AVAELAFRCVAADKDDRPD+REV  ELRR+RSR 
Sbjct  567  VLDPAF--KRADSDGVAAVAELAFRCVAADKDDRPDSREVVEELRRVRSRT  615



>ref|XP_010470994.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Camelina sativa]
Length=648

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 97/118 (82%), Gaps = 6/118 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGMKAVDQ REK +M LAD+VV KIQMGLL Q
Sbjct  521  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMKAVDQRREKRDMALADLVVSKIQMGLLDQ  580

Query  529  VLDPVLVVDGEAKE------GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP+L +DG+         GV AVAELAFRCVAADKDDRPDA+E+  ELRRIRS  R
Sbjct  581  VIDPLLALDGDDVAAVTDGFGVAAVAELAFRCVAADKDDRPDAKEIVEELRRIRSHTR  638



>gb|AAG52555.1|AC010675_3 putative protein kinase; 23181-21271 [Arabidopsis thaliana]
Length=625

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 6/118 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGMKAVDQ REK +M LAD+VV KIQMGLL Q
Sbjct  499  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMKAVDQRREKRDMALADLVVSKIQMGLLDQ  558

Query  529  VLDPVLVVDGEAKE------GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP+L +DG+         GV AVAELAFRCVA DKDDRPDA+E+  ELRRIRS  R
Sbjct  559  VIDPLLALDGDDVAAVSDGFGVAAVAELAFRCVATDKDDRPDAKEIVQELRRIRSHTR  616



>ref|NP_177149.2| Protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AEE34997.1| Protein kinase superfamily protein [Arabidopsis thaliana]
Length=636

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 6/118 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGMKAVDQ REK +M LAD+VV KIQMGLL Q
Sbjct  510  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMKAVDQRREKRDMALADLVVSKIQMGLLDQ  569

Query  529  VLDPVLVVDGEAKE------GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP+L +DG+         GV AVAELAFRCVA DKDDRPDA+E+  ELRRIRS  R
Sbjct  570  VIDPLLALDGDDVAAVSDGFGVAAVAELAFRCVATDKDDRPDAKEIVQELRRIRSHTR  627



>ref|XP_010552604.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Tarenaya hassleriana]
Length=643

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 5/120 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGM+AVDQ REK EM LAD+VV KIQMGLL+Q
Sbjct  518  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMRAVDQRREKREMALADLVVSKIQMGLLNQ  577

Query  529  VLDPVLVVDGEAKE-----GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            V+DP+L +D  A       GV A+AELAFRCVAADKDDRP+ARE+ AELRR+    RG G
Sbjct  578  VVDPLLALDAAAMSGGDGGGVPALAELAFRCVAADKDDRPNAREIVAELRRVGRCTRGDG  637



>ref|XP_010512057.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Camelina sativa]
Length=637

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 6/118 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGMKAVDQ REK +M LAD+VV KIQMGLL Q
Sbjct  510  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMKAVDQRREKRDMALADLVVSKIQMGLLDQ  569

Query  529  VLDPVLVVDGEAKE------GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP+L +DG+         GV AVAELAFRCV ADKDDRPDA+E+  ELRRIRS  R
Sbjct  570  VIDPLLALDGDDVAAVTDGFGVAAVAELAFRCVVADKDDRPDAKEIVEELRRIRSHTR  627



>ref|XP_010415660.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Camelina sativa]
Length=641

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 6/118 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGMKAVDQ REK +M LAD+VV KIQMGLL Q
Sbjct  514  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMKAVDQRREKRDMALADLVVSKIQMGLLDQ  573

Query  529  VLDPVLVVDGEAKE------GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP+L +DG+         GV AVAELAFRCV ADKDDRPDA+E+  ELRRIRS  R
Sbjct  574  VIDPLLALDGDDVAAVTDGFGVAAVAELAFRCVVADKDDRPDAKEIVEELRRIRSHTR  631



>ref|XP_004489958.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cicer arietinum]
Length=642

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 2/117 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVD  R+K EM LADMVV +I  G L+Q
Sbjct  521  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDYCRDKREMALADMVVSRIHTGQLNQ  580

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            VLDPVL +  DGEA + V AVAELAFRCVAADKDDRPD+REV  EL+R+R R+  +G
Sbjct  581  VLDPVLDLGNDGEALDAVAAVAELAFRCVAADKDDRPDSREVVGELKRVRLRSSVNG  637



>ref|XP_003613504.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES96462.1| tyrosine kinase family protein [Medicago truncatula]
Length=630

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 3/125 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLELI+G+KAVD  R+K EM LADMVV +I  G L +
Sbjct  507  LDPDYHRSFRLTEKSDVYSFGVVLLELISGLKAVDYCRDKREMALADMVVSRIHTGQLKE  566

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            VLDPVL +  D +A + VGAVAELAFRCVA+DKDDRPD++EV  EL+R+RSR  G G+ R
Sbjct  567  VLDPVLDLGNDNDALDAVGAVAELAFRCVASDKDDRPDSKEVVGELKRVRSRISG-GITR  625

Query  355  TSNSS  341
            + +++
Sbjct  626  SMSTT  630



>gb|KFK41415.1| hypothetical protein AALP_AA2G128000 [Arabis alpina]
Length=627

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSD+YS+GVVL+EL+TGMKAVDQ REK +M LAD+ V K+QMGL+ Q
Sbjct  509  LDPDYHRSFRLTEKSDIYSYGVVLMELMTGMKAVDQRREKRDMALADLFVSKLQMGLIGQ  568

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            V+DP+L V  E   GV AVAELAFRCVA DKDDRPDA+++  ELRRI+SR RG
Sbjct  569  VVDPLLTV--EDNGGVAAVAELAFRCVAVDKDDRPDAKDIVEELRRIKSRTRG  619



>ref|XP_002863111.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39370.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=633

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 95/118 (81%), Gaps = 6/118 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGMKAVDQ REK +M LAD+VV KIQMGLL Q
Sbjct  507  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMKAVDQRREKRDMALADLVVSKIQMGLLDQ  566

Query  529  VLDPVLVVDGEAKE------GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP+L +D +         GV AVAELAFRCVA DKDDRPDA+E+  ELRRIR+  R
Sbjct  567  VIDPLLALDSDDVAAVTDGFGVAAVAELAFRCVAVDKDDRPDAKEIVQELRRIRNHTR  624



>ref|XP_008810583.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Phoenix dactylifera]
Length=619

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 1/111 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLEL+TGMKAVD  R++ E+TLAD+ V KIQ+G LHQ
Sbjct  503  LDPDYHRSFRLTEKSDVYSFGVVLLELVTGMKAVDLGRDRREVTLADLAVAKIQVGALHQ  562

Query  529  VLDPVLVVDG-EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
            V+DPVL+  G EA   V AVAELAFRCVA DKDDRPDARE+  EL+RIRSR
Sbjct  563  VVDPVLLRQGKEAMATVEAVAELAFRCVAGDKDDRPDARELVEELKRIRSR  613



>emb|CDY48385.1| BnaA07g24040D [Brassica napus]
Length=599

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+EL+TGMKAVDQ REK +M LA++ V K+QMGLL Q
Sbjct  480  LDPDYHRSFRLTEKSDVYSYGVVLMELMTGMKAVDQRREKRDMALAELFVSKLQMGLLDQ  539

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP++  D + + GV AVAELAFRCVA DKDDRPDA+E+  ELRRI+SR R
Sbjct  540  VVDPLIASDDD-EGGVAAVAELAFRCVAVDKDDRPDAKEIVGELRRIKSRTR  590



>ref|XP_009104977.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Brassica rapa]
Length=622

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+EL+TGMKAVDQ REK +M LA++ V K+QMGLL Q
Sbjct  503  LDPDYHRSFRLTEKSDVYSYGVVLMELMTGMKAVDQRREKRDMALAELFVSKLQMGLLDQ  562

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP++  D + + GV AVAELAFRCVA DKDDRPDA+E+  ELRRI+SR R
Sbjct  563  VVDPLIASDDD-EGGVAAVAELAFRCVAVDKDDRPDAKEIVGELRRIKSRTR  613



>emb|CDY23541.1| BnaC06g25100D [Brassica napus]
Length=599

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+EL+TGMKAVDQ REK +M LA++ V K+QMGLL Q
Sbjct  480  LDPDYHRSFRLTEKSDVYSYGVVLMELMTGMKAVDQRREKRDMALAELFVSKLQMGLLDQ  539

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+DP++  D +   GV AVAELAFRCVA DKDDRPDA+E+  ELRRI+SR R
Sbjct  540  VVDPLIASDDD-DGGVAAVAELAFRCVAVDKDDRPDAKEIVGELRRIKSRTR  590



>ref|XP_010935442.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Elaeis guineensis]
Length=618

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYSFGVVLLEL+TGMKAVD  R++ E+ LAD+ V KIQ+G LHQ
Sbjct  502  LDPDYHRSFRLTEKSDVYSFGVVLLELVTGMKAVDLGRDRREVALADLAVAKIQVGALHQ  561

Query  529  VLDPVLVVDG-EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
            V+DPVL+  G EA   V AVAELAFRCVA DKDDRPDARE+  EL+RIRSR
Sbjct  562  VVDPVLLRQGKEAMATVEAVAELAFRCVAGDKDDRPDARELVEELKRIRSR  612



>ref|XP_010046656.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Eucalyptus grandis]
Length=467

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%), Gaps = 4/108 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL +KSDVYSFGVVLLEL++GMKAVDQ R K+E+ LAD+VV +IQ G+LHQ
Sbjct  328  LDPDYHRSFRLTDKSDVYSFGVVLLELVSGMKAVDQERAKAEVGLADLVVSRIQTGMLHQ  387

Query  529  VLDPVLVVDGEA----KEGVGAVAELAFRCVAADKDDRPDAREVAAEL  398
            V+DP + V G      +EGV AVAELAFRCVAADKDDRPDAREV AEL
Sbjct  388  VVDPAMAVGGGGEAAMEEGVSAVAELAFRCVAADKDDRPDAREVVAEL  435



>ref|XP_009400976.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Musa acuminata subsp. malaccensis]
Length=641

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y+RSFRL EKSDVYSFGVVLLEL+TGMKAVD +R++SEM L DMVV KI +G LHQ
Sbjct  525  LDPEYHRSFRLTEKSDVYSFGVVLLELVTGMKAVDVSRDRSEMALVDMVVSKIHVGALHQ  584

Query  529  VLDPVLVVDG-EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
            V+DPVL+ +G E    V AV ELAFRCVA DKDDRPDARE+  EL+RIRS+
Sbjct  585  VVDPVLLHEGKEVMAMVEAVVELAFRCVAGDKDDRPDARELVQELKRIRSK  635



>gb|EPS60026.1| hypothetical protein M569_14776 [Genlisea aurea]
Length=613

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++SF LNEKSD+YSFGVVL ELITG+KAVD++REK E+ L DM VP+IQMGLLHQ
Sbjct  496  LDPDYHQSFMLNEKSDIYSFGVVLFELITGLKAVDRSREKREVGLVDMAVPRIQMGLLHQ  555

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR-SRARG  371
            ++D  L  DGE    V AVAELAFRCVAA KDDRPDAREVAAEL RIR S  RG
Sbjct  556  LVDRELAGDGEE---VNAVAELAFRCVAACKDDRPDAREVAAELGRIRGSCCRG  606



>ref|XP_010683296.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Beta vulgaris subsp. vulgaris]
Length=644

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 103/132 (78%), Gaps = 4/132 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++SFRL EKSDVYSFGVVLLELITG+KAVDQ REK E+ L DMVV +IQ+GLL Q
Sbjct  512  LDPDYHKSFRLTEKSDVYSFGVVLLELITGLKAVDQRREKREVGLVDMVVARIQIGLLEQ  571

Query  529  VLDPVLVVDGE-AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLRT  353
            V+D  L   G    E V AVAELAF+CVAADKDDRPDAREV AELRRI SR RG   ++ 
Sbjct  572  VVDSTLAAQGPAVAESVAAVAELAFQCVAADKDDRPDAREVVAELRRIWSRIRG---VKG  628

Query  352  SNSSNAVVPDGA  317
            SNS+  VVP  A
Sbjct  629  SNSNVVVVPASA  640



>ref|XP_010418542.1| PREDICTED: probable serine/threonine-protein kinase At1g18390, 
partial [Camelina sativa]
Length=603

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+ELITGMKAVDQ REK +M LAD+VV KIQMGLL Q
Sbjct  500  LDPDYHRSFRLTEKSDVYSYGVVLMELITGMKAVDQRREKRDMALADLVVSKIQMGLLDQ  559

Query  529  VLDPVLVVDGEAKE------GVGAVAELAFRCVAADKDDRPDAR  416
            V+DP+L +DG+         GV AVAELAFRCVAADKDDRPDA+
Sbjct  560  VIDPLLALDGDDVAAVTDGFGVAAVAELAFRCVAADKDDRPDAK  603



>ref|XP_006390949.1| hypothetical protein EUTSA_v10018260mg [Eutrema salsugineum]
 gb|ESQ28235.1| hypothetical protein EUTSA_v10018260mg [Eutrema salsugineum]
Length=634

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSFRL EKSDVYS+GVVL+EL+TGMKAVDQ REK +M LAD+ V K+QMGL+ Q
Sbjct  515  LDPDYHRSFRLTEKSDVYSYGVVLMELMTGMKAVDQRREKRDMALADLFVSKLQMGLIDQ  574

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            V+D  L+   +   GV AVAELAFRCVA DKDDRPDA+E+  EL+RIRSR R
Sbjct  575  VVD-PLLAADDDDGGVAAVAELAFRCVAVDKDDRPDAKEIVGELKRIRSRTR  625



>ref|XP_002466268.1| hypothetical protein SORBIDRAFT_01g004780 [Sorghum bicolor]
 gb|EER93266.1| hypothetical protein SORBIDRAFT_01g004780 [Sorghum bicolor]
Length=440

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSF+L EKSDVYSFGVV+LEL+TG++ VD  RE+ ++TLAD VV KIQ+G L +
Sbjct  320  LDPDYHRSFQLTEKSDVYSFGVVVLELVTGLRPVDVGRERRDVTLADWVVAKIQVGELRE  379

Query  529  VLDPVLVVDGEA-KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            V+DP ++ +G A    V AVAELAFRCVA DKDDRPDAREV AEL+RI++
Sbjct  380  VVDPPVLGEGPAVMASVEAVAELAFRCVAPDKDDRPDAREVLAELKRIQT  429



>ref|XP_004981394.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Setaria italica]
Length=444

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSF+L EKSDVYSFGVV+LEL+TG++ VD  RE+ ++TLAD VV KIQ+G L +
Sbjct  324  LDPDYHRSFQLTEKSDVYSFGVVVLELVTGLRPVDVGRERRDVTLADWVVAKIQVGELRE  383

Query  529  VLDPVLVVDGEA-KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            V+DP ++ +G      V AVAELAFRCVA DKDDRPDAREV AELRRI++
Sbjct  384  VVDPPVLGEGPGVMATVEAVAELAFRCVAPDKDDRPDAREVLAELRRIQT  433



>ref|XP_006842745.1| hypothetical protein AMTR_s00133p00058260 [Amborella trichopoda]
 gb|ERN04420.1| hypothetical protein AMTR_s00133p00058260 [Amborella trichopoda]
Length=590

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 3/107 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RS+ L EKSDVYSFGVVLLELI+G +AVD +R+K E+ LADM V KIQ+G LH+
Sbjct  482  LDPDYHRSYCLTEKSDVYSFGVVLLELISGKRAVDMSRDKREVGLADMAVAKIQVGALHE  541

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            V+DP   V G A   V +VAELAFRCVAADKDDRPD REV AEL RI
Sbjct  542  VVDP--EVQG-AMAAVSSVAELAFRCVAADKDDRPDMREVVAELTRI  585



>gb|EAZ28946.1| hypothetical protein OsJ_12990 [Oryza sativa Japonica Group]
Length=375

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSF+L EKSDVYSFGVV+LEL+TG++ VD  RE+ ++TLAD VV KIQ+G L +
Sbjct  255  LDPDYHRSFQLTEKSDVYSFGVVVLELVTGLRPVDVGRERRDVTLADWVVAKIQVGELRE  314

Query  529  VLD-PVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            V+D PVL         V AVAELAFRCVA DKDDRPDARE  AELRRI+ 
Sbjct  315  VVDQPVLGEGAGVMASVEAVAELAFRCVAPDKDDRPDAREALAELRRIQG  364



>ref|XP_003559287.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Brachypodium distachyon]
Length=445

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSF+L EKSDVYS GVV+LEL+TG++ VD  RE+ ++TLAD VV KIQ+G L +
Sbjct  325  LDPDYHRSFQLTEKSDVYSLGVVVLELVTGLRPVDVGRERRDVTLADWVVSKIQVGELRE  384

Query  529  VLDPVLVVDGEA-KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            V+DP ++ +  A    V AVAELAFRCVA DKDDRPDAREV AELRRI+
Sbjct  385  VVDPPVLDECPAVMPSVEAVAELAFRCVAPDKDDRPDAREVLAELRRIQ  433



>ref|XP_008665609.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Zea mays]
 tpg|DAA51986.1| TPA: putative WAK receptor-like protein kinase family protein 
[Zea mays]
Length=435

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSF+L EKSDVYSFGVV+LEL+TG++ VD  RE+ ++TLAD VV KIQ+G L +
Sbjct  314  LDPDYHRSFQLTEKSDVYSFGVVVLELVTGLRPVDVGRERRDVTLADWVVAKIQVGELRE  373

Query  529  VLDPVLVVDGEA-KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            V+D  ++ +G A    V AVAELAFRCVA DKDDRPDAREV AEL RI++
Sbjct  374  VVDAPVLGEGPAVMASVEAVAELAFRCVAPDKDDRPDAREVVAELARIQT  423



>ref|NP_001173673.1| Os03g0802100 [Oryza sativa Japonica Group]
 gb|AAO72392.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF99399.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH92401.1| Os03g0802100 [Oryza sativa Japonica Group]
Length=435

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSF+L EKSDVYSFGVV+LEL+TG++ VD  RE+ ++TLAD VV KIQ+G L +
Sbjct  315  LDPDYHRSFQLTEKSDVYSFGVVVLELVTGLRPVDVGRERRDVTLADWVVAKIQVGELRE  374

Query  529  VLD-PVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            V+D PVL         V AVAELAFRCVA DKDDRPDARE  AELRRI+ 
Sbjct  375  VVDQPVLGEGAGVMASVEAVAELAFRCVAPDKDDRPDAREALAELRRIQG  424



>dbj|BAJ85037.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87399.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96462.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSF+L EKSDVYSFGVV+LEL+TG++ VD  RE+ ++TLAD VV KIQ+G L +
Sbjct  317  LDPDYHRSFQLTEKSDVYSFGVVVLELVTGLRPVDVGRERRDVTLADWVVSKIQIGELRE  376

Query  529  VLD-PVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            V+D PVL    +    V AVAELAFRCVA DKDDRPDARE  AELRRI+
Sbjct  377  VVDPPVLDELPDVMPSVEAVAELAFRCVAPDKDDRPDAREALAELRRIQ  425



>ref|XP_001774205.1| predicted protein [Physcomitrella patens]
 gb|EDQ60981.1| predicted protein, partial [Physcomitrella patens]
Length=287

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+ S+ L++KSDVYSFGVVL+EL+T  KAVD  RE+ E+ LA + V KI  G LH+
Sbjct  180  LDPDYHESYHLSDKSDVYSFGVVLMELVTAKKAVDMARERKEINLASLAVAKIHSGCLHE  239

Query  529  VLDPVLVVDGE----AKEGVGAVAELAFRCVAADKDDRPDAREVAAEL  398
            +LDP L V        +  V  VAELAFRC+A++KDDRP  +EV AEL
Sbjct  240  ILDPNLTVQFHDNPMMQVMVEQVAELAFRCLASEKDDRPSMKEVLAEL  287



>gb|AEW90969.1| hypothetical protein, partial [Pinus taeda]
Length=121

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ F+L +KSDVYSFGVVL+E+I+   AVD +R + E+ LA+M + KI+ G LH+
Sbjct  12   VDPEYHQCFQLTDKSDVYSFGVVLMEIISAKLAVDISRNRREIVLANMAIAKIKAGALHE  71

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L +D  +  K  V A+AELA RC+A +K+DRPD +E+ A+L +I+
Sbjct  72   LIDPDLEIDSNSDIKAMVIAIAELALRCLAENKEDRPDMKELVAKLEQIK  121



>gb|AEW90971.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90977.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90981.1| hypothetical protein, partial [Pinus taeda]
Length=121

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ F+L +KSDVYSFGVVL+E+I+   AVD +R + E+ LA+M + KI+ G LH+
Sbjct  12   VDPEYHQCFQLTDKSDVYSFGVVLMEIISAKLAVDISRNRREIVLANMAIAKIKAGALHE  71

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L +D  +  K  V A+AELA RC+A +K+DRPD +E+ A+L +I+
Sbjct  72   LIDPDLEIDSNSDTKAMVIAIAELALRCLAENKEDRPDMKELVAKLEQIK  121



>gb|AEW90980.1| hypothetical protein, partial [Pinus taeda]
Length=121

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ F+L +KSDVYSFGVVL+E+I+   AVD +R + E+ LA+M + KI+ G LH+
Sbjct  12   VDPEYHQCFQLTDKSDVYSFGVVLMEIISAKLAVDISRNRREIVLANMAIAKIKAGALHE  71

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L +D  +  K  V A+AELA RC+A +K+DRPD +E+ A+L +I+
Sbjct  72   LIDPDLEIDSNSDIKVMVIAIAELALRCLAENKEDRPDMKELVAKLEKIK  121



>gb|AEW90970.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90973.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90974.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90976.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90978.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90979.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90982.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90983.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90984.1| hypothetical protein, partial [Pinus radiata]
Length=121

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ F+L +KSDVYSFGVVL+E+I+   AVD +R + E+ LA+M + KI+ G LH+
Sbjct  12   VDPEYHQCFQLTDKSDVYSFGVVLMEIISAKLAVDISRNRREIVLANMAIAKIKAGALHE  71

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L +D  +  K  V A+AELA RC+A +K+DRPD +E+ A+L +I+
Sbjct  72   LIDPDLEIDSNSDIKVMVIAIAELALRCLAENKEDRPDMKELVAKLEQIK  121



>gb|AEW90972.1| hypothetical protein, partial [Pinus taeda]
 gb|AEW90975.1| hypothetical protein, partial [Pinus taeda]
Length=121

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ F+L +KSDVYSFGVVL+E+I+   AVD  R + E+ LA+M + KI+ G LH+
Sbjct  12   VDPEYHQCFQLTDKSDVYSFGVVLMEIISAKLAVDINRNRREIVLANMAIAKIKAGALHE  71

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L +D  +  K  V A+AELA RC+A +K+DRPD +E+ A+L +I+
Sbjct  72   LIDPDLEIDSNSNIKVMVIAIAELALRCLAENKEDRPDMKELVAKLEQIK  121



>gb|AEW90968.1| hypothetical protein, partial [Pinus taeda]
Length=121

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ F+L +KSDVYSFGVVL+E+I+   AVD  R + E+ LA+M + KI+ G LH+
Sbjct  12   VDPEYHQCFQLTDKSDVYSFGVVLMEIISAKLAVDINRNRREIVLANMAIAKIKAGALHE  71

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L +D  +  K  V A+AELA RC+A +K+DRPD +E+ A+L +I+
Sbjct  72   LIDPDLEIDSNSDIKVMVIAIAELALRCLAENKEDRPDMKELVAKLEQIK  121



>dbj|BAJ96733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=696

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+ SF L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G +H+
Sbjct  537  VDPEYHHSFHLSDKSDVYSFGVVLLELITAMKVVDFGRPANEVNLACLALDRIGKGRVHE  596

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L+  GE    E V  V+ELAFRC+A DKD RP   EVAAEL RIR  A  SG+
Sbjct  597  IVDPALLRHGEDWVMESVRHVSELAFRCLAFDKDVRPSMSEVAAELCRIRDAAPDSGI  654



>dbj|BAJ96357.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=696

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+ SF L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G +H+
Sbjct  537  VDPEYHHSFHLSDKSDVYSFGVVLLELITAMKVVDFGRPANEVNLACLALDRIGKGRVHE  596

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L+  GE    E V  V+ELAFRC+A DKD RP   EVAAEL RIR  A  SG+
Sbjct  597  IVDPALLRHGEDWVMESVRHVSELAFRCLAFDKDVRPSMSEVAAELCRIRDAAPDSGI  654



>ref|XP_003577672.1| PREDICTED: wall-associated receptor kinase-like 14 [Brachypodium 
distachyon]
 ref|XP_010237077.1| PREDICTED: wall-associated receptor kinase-like 14 [Brachypodium 
distachyon]
Length=705

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 83/115 (72%), Gaps = 4/115 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++SF L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G +H+
Sbjct  536  VDPEYHQSFHLSDKSDVYSFGVVLLELITAMKVVDLDRPPNEVNLASLALDRIGKGRVHE  595

Query  529  VLDPVLVVDGEAK----EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DPVL+V+   +    E V  V+ELAFRC+A DKD RP   EVAAEL RIR  A
Sbjct  596  IVDPVLLVENGGEEWVMESVRHVSELAFRCLAFDKDVRPSMSEVAAELCRIRDTA  650



>gb|EMS50841.1| Wall-associated receptor kinase-like 14 [Triticum urartu]
Length=317

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++SF L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G + +
Sbjct  64   VDPEYHQSFHLSDKSDVYSFGVVLLELITAMKVVDFARPANEVNLACLALDRIGKGRVEE  123

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L+  GE    E V  V+ELAF+C+A DKD RP   EVAAEL RIR  A  SG+
Sbjct  124  IVDPALLRHGEEWVMESVRHVSELAFQCLAFDKDVRPSMSEVAAELCRIRDAAPDSGM  181



>gb|AAW81731.1| putative Basic helix-loop-helix(bHLH) family protein [Brassica 
oleracea]
Length=172

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY+  ++L++KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   LH+
Sbjct  28   VDPDYHLCYQLSKKSDVYSFAVVLMELISSLPAVDITRTRQEINLSNMAVVKIQSHKLHE  87

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L  D +   KE V AVAELAF+C+ +DKD RP    V   L +I +   GS +  
Sbjct  88   MVDPSLGFDTDTRVKETVIAVAELAFQCLQSDKDLRPCMSHVMETLTKIENNGFGSNMDG  147

Query  355  TSN  347
             SN
Sbjct  148  DSN  150



>ref|XP_009127496.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Brassica rapa]
Length=889

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  726  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  785

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L    D E K  + AVAELAFRC+  +++ RP   E+   L+RI+   R
Sbjct  786  LVDPSLGFAKDPEVKRKMMAVAELAFRCLQQEREVRPSMDEIVEILKRIKGENR  839



>ref|XP_009127495.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Brassica rapa]
Length=946

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  783  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  842

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L    D E K  + AVAELAFRC+  +++ RP   E+   L+RI+   R
Sbjct  843  LVDPSLGFAKDPEVKRKMMAVAELAFRCLQQEREVRPSMDEIVEILKRIKGENR  896



>ref|XP_009127494.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Brassica rapa]
Length=947

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  784  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  843

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L    D E K  + AVAELAFRC+  +++ RP   E+   L+RI+   R
Sbjct  844  LVDPSLGFAKDPEVKRKMMAVAELAFRCLQQEREVRPSMDEIVEILKRIKGENR  897



>emb|CDY12594.1| BnaA02g12620D [Brassica napus]
Length=1113

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = -1

Query  709   LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
             +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  950   VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  1009

Query  529   VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
             ++DP L    D E K  + AVAELAFRC+  +++ RP   E+   L+RI+   R
Sbjct  1010  LVDPSLGFAKDPEVKRKMMAVAELAFRCLQQEREVRPSMDEIVEILKRIKGENR  1063



>emb|CDP07589.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVLLE+ITG+KAVD  R ++E+ LA++ V +I  G LH+
Sbjct  495  LDPQYHQHFHLSDKSDVYSFGVVLLEIITGLKAVDFNRPQNEINLANLAVDRIGKGCLHE  554

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L    D         VAELAFRC+A  +D RP   EVA EL +IR
Sbjct  555  IIDPFLEPHKDPWTISSTHKVAELAFRCLAFHRDMRPSMMEVAIELEQIR  604



>ref|XP_002960238.1| hypothetical protein SELMODRAFT_139490 [Selaginella moellendorffii]
 gb|EFJ37777.1| hypothetical protein SELMODRAFT_139490 [Selaginella moellendorffii]
Length=351

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+ S++L +KSDVYSFGVVLLELI+  KAVD TR+K E+ LA M + +I  G LH+
Sbjct  182  LDPDYHESYQLTDKSDVYSFGVVLLELISRKKAVDMTRDKKEINLASMALARIHSGALHE  241

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            + DP L V  +  + +  + E+AFRC+AA+KDDRP   EV  EL ++
Sbjct  242  LFDPDLSV--KYWKLLTRLVEVAFRCLAAEKDDRPSMVEVVRELEQL  286



>ref|XP_002967476.1| hypothetical protein SELMODRAFT_87751 [Selaginella moellendorffii]
 gb|EFJ32075.1| hypothetical protein SELMODRAFT_87751 [Selaginella moellendorffii]
Length=351

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+ S++L +KSDVYSFGVVLLELI+  KAVD TR+K E+ LA M + +I  G LH+
Sbjct  182  LDPDYHESYQLTDKSDVYSFGVVLLELISRKKAVDMTRDKKEINLASMALARIHSGALHE  241

Query  529  VLDPVLVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            + DP L V  +  + +  + E+AFRC+AA+KDDRP   EV  EL ++
Sbjct  242  LFDPDLSV--KYWKLLTRLVEVAFRCLAAEKDDRPSMVEVVRELEQL  286



>ref|XP_009127497.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Brassica rapa]
Length=699

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  536  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  595

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L    D E K  + AVAELAFRC+  +++ RP   E+   L+RI+   R
Sbjct  596  LVDPSLGFAKDPEVKRKMMAVAELAFRCLQQEREVRPSMDEIVEILKRIKGENR  649



>ref|XP_006293370.1| hypothetical protein CARUB_v10022765mg [Capsella rubella]
 gb|EOA26268.1| hypothetical protein CARUB_v10022765mg [Capsella rubella]
Length=693

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI+ G L Q
Sbjct  500  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIRSGCLDQ  559

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+  L +D      +  VAELAFRC+A   D RP   EVA EL +IR
Sbjct  560  IIDPILDLELDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIR  609



>ref|XP_009347440.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Pyrus x bretschneideri]
Length=653

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y + ++L  KSDVYSFGVVL+ELI+ M AVD TR + E+ L+ M + KIQ   LH+
Sbjct  495  VDPEYNQCYQLTSKSDVYSFGVVLIELISSMPAVDITRHRHEINLSTMAINKIQNHTLHE  554

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D   ++ + AVAELAFRC+ +DKD RP   EV  EL+RI+S
Sbjct  555  LVDPYLGFESDSRTRKMIIAVAELAFRCLNSDKDLRPSMIEVLNELKRIQS  605



>emb|CDX96118.1| BnaA07g26130D [Brassica napus]
Length=168

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 88/147 (60%), Gaps = 18/147 (12%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   +H+
Sbjct  9    VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDVNLANMAVSKIQNNAVHE  68

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR----------  386
            ++DP L    D E K  + +VAELAFRC+  +++ RP   E+   L+ I+          
Sbjct  69   LVDPSLGFEKDPEVKRMMVSVAELAFRCLQQEREARPSMDEIMETLKGIKGEKCRKLPDV  128

Query  385  -----SRARGSGVLRTSNSSNAVVPDG  320
                 SR    G+LR S+    V PD 
Sbjct  129  VDIVVSRGDDVGLLRHSDPP-PVSPDA  154



>ref|XP_008674033.1| PREDICTED: WAK-like kinase isoform X1 [Zea mays]
Length=720

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+++F L++KSDVYSFGVVLLEL+T MK VD  R  +E+ LA + + +I  G + +
Sbjct  542  VDPEYHQNFHLSDKSDVYSFGVVLLELVTAMKVVDFDRPPAEVNLASLALDRIGKGQVAE  601

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP L+  GE      V  V+ELAFRC+A  KD RP  REVAAEL+RIRS A
Sbjct  602  IVDPALLGAGEDWVMGSVRHVSELAFRCLAFQKDVRPSMREVAAELQRIRSAA  654



>tpg|DAA47345.1| TPA: putative WAK-related receptor-like protein kinase family 
protein [Zea mays]
Length=720

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+++F L++KSDVYSFGVVLLEL+T MK VD  R  +E+ LA + + +I  G + +
Sbjct  542  VDPEYHQNFHLSDKSDVYSFGVVLLELVTAMKVVDFDRPPAEVNLASLALDRIGKGQVAE  601

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP L+  GE      V  V+ELAFRC+A  KD RP  REVAAEL+RIRS A
Sbjct  602  IVDPALLGAGEDWVMGSVRHVSELAFRCLAFQKDVRPSMREVAAELQRIRSAA  654



>ref|XP_006391445.1| hypothetical protein EUTSA_v10018045mg [Eutrema salsugineum]
 gb|ESQ28731.1| hypothetical protein EUTSA_v10018045mg [Eutrema salsugineum]
Length=888

 Score =   115 bits (287),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA M V KIQ   LH+
Sbjct  728  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLASMAVSKIQNNALHE  787

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L    D E ++ + +VAELAFRC+  +++ RP   E+   LRRI+
Sbjct  788  LVDPSLGFEKDPEVRKRMMSVAELAFRCLQQEREVRPSMDEIVEILRRIK  837



>ref|XP_010540002.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Tarenaya hassleriana]
Length=675

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++ ++L  KSDV+SFGVVL+ELI+ M AVD TR + E+ L+ M + KIQ   LH+
Sbjct  514  LDPDYHQCYQLTSKSDVFSFGVVLMELISSMPAVDITRHRHEINLSKMAIVKIQSHSLHE  573

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++D  L  + +AK  + V +VAELAF+C+ +DKD RPD  +V   L RIR+
Sbjct  574  MVDSTLGFETDAKVRDSVSSVAELAFQCLQSDKDLRPDISQVLETLTRIRN  624



>ref|NP_001147438.1| WAK-like kinase precursor [Zea mays]
 gb|ACG27516.1| WAK-like kinase [Zea mays]
Length=727

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+++F L++KSDVYSFGVVLLEL+T MK VD  R  +E+ LA + + +I  G + +
Sbjct  542  VDPEYHQNFHLSDKSDVYSFGVVLLELVTAMKVVDFDRPPAEVNLASLALDRIGKGQVAE  601

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP L+  GE      V  V+ELAFRC+A  KD RP  REVAAEL+RIRS A
Sbjct  602  IVDPALLGAGEDWVMGSVRHVSELAFRCLAFQKDVRPSMREVAAELQRIRSAA  654



>ref|XP_010540003.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Tarenaya hassleriana]
Length=664

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 79/111 (71%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++ ++L  KSDV+SFGVVL+ELI+ M AVD TR + E+ L+ M + KIQ   LH+
Sbjct  503  LDPDYHQCYQLTSKSDVFSFGVVLMELISSMPAVDITRHRHEINLSKMAIVKIQSHSLHE  562

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++D  L  + +AK  + V +VAELAF+C+ +DKD RPD  +V   L RIR+
Sbjct  563  MVDSTLGFETDAKVRDSVSSVAELAFQCLQSDKDLRPDISQVLETLTRIRN  613



>emb|CDY61885.1| BnaCnng38660D [Brassica napus]
Length=659

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 87/128 (68%), Gaps = 3/128 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ +RLNEKSDVYSFGVVL+ELI+  +AVD TR+  ++ LA M V KIQ   LH+
Sbjct  531  VDPEYFQCYRLNEKSDVYSFGVVLVELISSKEAVDITRQSHDVNLAKMAVAKIQSNALHE  590

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP+L    D E +  + +VAELAFRC+  +++ RP   E+   LR IR R+R + +  
Sbjct  591  LVDPILGFEKDPEVRRKMMSVAELAFRCLQHEREMRPTMDEILKILRGIR-RSRSARIKS  649

Query  355  TSNSSNAV  332
            TS    A+
Sbjct  650  TSEDMEAI  657



>ref|XP_006391446.1| hypothetical protein EUTSA_v10018045mg [Eutrema salsugineum]
 gb|ESQ28732.1| hypothetical protein EUTSA_v10018045mg [Eutrema salsugineum]
Length=1083

 Score =   115 bits (287),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = -1

Query  709   LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
             +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA M V KIQ   LH+
Sbjct  923   VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLASMAVSKIQNNALHE  982

Query  529   VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
             ++DP L    D E ++ + +VAELAFRC+  +++ RP   E+   LRRI+
Sbjct  983   LVDPSLGFEKDPEVRKRMMSVAELAFRCLQQEREVRPSMDEIVEILRRIK  1032



>ref|XP_008374780.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Malus domestica]
Length=652

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y   ++L  KSDVYSFGVVL+ELI+ M AVD TR + E+ L+ M + KIQ   LH+
Sbjct  494  VDPEYNECYQLTSKSDVYSFGVVLIELISSMPAVDITRHRHEINLSTMAINKIQKQTLHE  553

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D   ++ + AVAELAFRC+ +DKD RP   EV  EL+RI+S
Sbjct  554  LVDPYLGFESDSRTRKMIIAVAELAFRCLNSDKDLRPSMIEVLNELKRIQS  604



>emb|CDY50595.1| BnaC02g16920D [Brassica napus]
Length=522

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  360  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  419

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L    D E K  + AVAELAFRC+  +++ RP   E+   L+ I+   R
Sbjct  420  LVDPSLGFAKDPEVKRKMMAVAELAFRCLQQEREVRPSMDEIVEILKGIKGENR  473



>ref|XP_006430730.1| hypothetical protein CICLE_v10011179mg [Citrus clementina]
 gb|ESR43970.1| hypothetical protein CICLE_v10011179mg [Citrus clementina]
Length=716

 Score =   114 bits (284),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 54/116 (47%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ ++L +KSDVYSFGVVL+ELI+G++AVD +R + ++ L++M + KIQ G L++
Sbjct  557  VDPDYFQCYKLTDKSDVYSFGVVLIELISGLQAVDTSRHRHDINLSNMAINKIQNGALNE  616

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP L    D   +  V +VAELAFRCV  D+D RP  +EV   LR  +    G+
Sbjct  617  LVDPSLGFEKDYAVRNMVTSVAELAFRCVQQDRDMRPTMKEVLEILRETKDSNLGT  672



>ref|XP_008374779.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Malus domestica]
Length=671

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y   ++L  KSDVYSFGVVL+ELI+ M AVD TR + E+ L+ M + KIQ   LH+
Sbjct  513  VDPEYNECYQLTSKSDVYSFGVVLIELISSMPAVDITRHRHEINLSTMAINKIQKQTLHE  572

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D   ++ + AVAELAFRC+ +DKD RP   EV  EL+RI+S
Sbjct  573  LVDPYLGFESDSRTRKMIIAVAELAFRCLNSDKDLRPSMIEVLNELKRIQS  623



>ref|XP_009117279.1| PREDICTED: wall-associated receptor kinase-like 14 [Brassica 
rapa]
Length=699

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G L +
Sbjct  504  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCLDE  563

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DPV  L +D      + +VAELAFRC+A   D RP   EVA EL +IR
Sbjct  564  IIDPVLDLNLDAWTLSSIHSVAELAFRCLAFHSDMRPTMTEVADELEQIR  613



>emb|CDY68677.1| BnaCnng60020D, partial [Brassica napus]
Length=700

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G L +
Sbjct  510  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCLDE  569

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DPV  L +D      + +VAELAFRC+A   D RP   EVA EL +IR
Sbjct  570  IIDPVLDLNLDAWTLSSIHSVAELAFRCLAFHSDMRPTMTEVADELEQIR  619



>ref|XP_007158796.1| hypothetical protein PHAVU_002G182500g [Phaseolus vulgaris]
 gb|ESW30790.1| hypothetical protein PHAVU_002G182500g [Phaseolus vulgaris]
Length=664

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+  + L +KSDVYSFGVVL+EL++ M AVD +R + E+ L++M + KIQ G LH+
Sbjct  510  VDPEYHEYYHLTDKSDVYSFGVVLIELVSSMHAVDISRRRHEINLSNMAIKKIQSGALHE  569

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L  D + K  + + AVAELAF+C+ + KD RP   EV   L  IRS  +
Sbjct  570  IVDPTLGFDSDFKVRKMINAVAELAFQCLQSSKDARPSMAEVLDRLEDIRSDGK  623



>ref|XP_004963056.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X2 [Setaria italica]
Length=713

 Score =   113 bits (282),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 6/130 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ F L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G + +
Sbjct  539  VDPEYHQCFHLSDKSDVYSFGVVLLELITAMKVVDFDRPAAEVNLASLALDRIGKGRVGE  598

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP ++  GE    E V  V+ELAFRC+A  KD RP   EVAAEL RIR  A  S    
Sbjct  599  IVDPAILGGGEEWVMESVRHVSELAFRCLAFHKDVRPAMCEVAAELHRIRDAAPDS----  654

Query  355  TSNSSNAVVP  326
             S+S + + P
Sbjct  655  DSDSGSGLRP  664



>gb|AEW07680.1| hypothetical protein 0_8683_01, partial [Pinus lambertiana]
Length=147

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+  F+L EKSDVYSFGVVL+ELI+   AVD  R++ E+ LA M + KIQ G LH+
Sbjct  50   VDPEYHECFQLTEKSDVYSFGVVLVELISAKLAVDINRKRGEINLAFMAISKIQEGALHE  109

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRP  425
            ++DP L +  + E K  V AVAEL FRC+A++ DDRP
Sbjct  110  LVDPQLEIEKNDEVKAMVSAVAELIFRCLASEGDDRP  146



>emb|CDX89573.1| BnaC04g35920D [Brassica napus]
Length=683

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+KAVD TR  S++ LA + V KI  G L +
Sbjct  496  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKAVDFTRPHSQINLAALAVDKIGSGCLDE  555

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L V  D      +  VAELAFRC++   D RP   EVA EL +IR
Sbjct  556  IIDPILDVRLDAWTLSSMHTVAELAFRCLSFHSDMRPTMSEVADELEQIR  605



>emb|CDX96120.1| BnaA07g26110D [Brassica napus]
Length=735

 Score =   113 bits (282),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   +H+
Sbjct  575  VDPEYYQCYRLNEKSDVYSFGVVLAELISSKEAVDITRHRHDINLANMAVSKIQNNAVHE  634

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            +LDP L    D E K  + +VAELAFRC+  +++ RP   E+   L+ I+   R
Sbjct  635  LLDPSLGFSKDPEVKRMMVSVAELAFRCLQQEREGRPSMDEIVEILKGIKGENR  688



>emb|CDY65028.1| BnaC05g50050D [Brassica napus]
Length=449

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY+  ++L++KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   LH+
Sbjct  305  VDPDYHLCYQLSKKSDVYSFAVVLMELISSLPAVDITRTRQEINLSNMAVVKIQSHKLHE  364

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L  D +   KE V AVAELAF+C+ +DKD RP    V   L +I +   GS +  
Sbjct  365  MVDPSLGFDRDTRVKETVIAVAELAFQCLQSDKDLRPCMSHVMETLTKIENNGFGSNMDG  424

Query  355  TSN  347
             SN
Sbjct  425  DSN  427



>gb|KDO63212.1| hypothetical protein CISIN_1g013686mg [Citrus sinensis]
Length=438

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ ++L +KSDVYSFGVVL+ELI+G++AVD +R + ++ L++M   KIQ G L++
Sbjct  279  VDPDYFQCYKLTDKSDVYSFGVVLIELISGLEAVDTSRHRHDINLSNMATNKIQNGALNE  338

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP L    D   +  V +VAELAFRCV  D+D RP  +EV   LR  +    G+
Sbjct  339  LVDPSLGFEKDYAVRNMVTSVAELAFRCVQQDRDMRPTMKEVLEILRETKDSNLGT  394



>ref|XP_006482215.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X2 [Citrus sinensis]
Length=484

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ ++L +KSDVYSFGVVL+ELI+G++AVD +R + ++ L++M   KIQ G L++
Sbjct  325  VDPDYFQCYKLTDKSDVYSFGVVLIELISGLEAVDTSRHRHDINLSNMATNKIQNGALNE  384

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP L    D   +  V +VAELAFRCV  D+D RP  +EV   LR  +    G+
Sbjct  385  LVDPSLGFEKDYAVRNMVTSVAELAFRCVQQDRDMRPSMKEVLEILRETKDSNLGT  440



>ref|XP_006482214.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X1 [Citrus sinensis]
Length=714

 Score =   113 bits (282),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 54/116 (47%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ ++L +KSDVYSFGVVL+ELI+G++AVD +R + ++ L++M   KIQ G L++
Sbjct  555  VDPDYFQCYKLTDKSDVYSFGVVLIELISGLEAVDTSRHRHDINLSNMATNKIQNGALNE  614

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP L    D   +  V +VAELAFRCV  D+D RP  +EV   LR  +    G+
Sbjct  615  LVDPSLGFEKDYAVRNMVTSVAELAFRCVQQDRDMRPSMKEVLEILRETKDSNLGT  670



>ref|XP_010106074.1| Wall-associated receptor kinase-like 14 [Morus notabilis]
 gb|EXC07344.1| Wall-associated receptor kinase-like 14 [Morus notabilis]
Length=373

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+ITG+KAVD +R ++E+ LA +   +I  G L +
Sbjct  200  LDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFSRPQNEVNLAALATDRIGKGCLDE  259

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            ++DP++    D      V  VAELAFRC+A  +D RP   EVAAEL + R R+R  G
Sbjct  260  IIDPLIEPHRDAWTLWSVHRVAELAFRCLAFHRDMRPSMTEVAAELDQTR-RSRSWG  315



>ref|XP_010415223.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Camelina sativa]
Length=722

 Score =   112 bits (281),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  558  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  617

Query  529  VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L  D   + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  618  LVDPSLGFDKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVD  677

Query  355  TSN  347
            +++
Sbjct  678  SAD  680



>emb|CDY46073.1| BnaA09g41970D [Brassica napus]
Length=735

 Score =   112 bits (281),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 84/134 (63%), Gaps = 10/134 (7%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G L +
Sbjct  540  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCLDE  599

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR--------SR  380
            ++DPV  L +D      + +VAELAFRC+A   D RP   EVA EL +IR        S 
Sbjct  600  IIDPVLDLNLDAWTLSSIHSVAELAFRCLAFHSDMRPTMTEVADELEQIRLSGWIPNMSL  659

Query  379  ARGSGVLRTSNSSN  338
               +G LR+S+  +
Sbjct  660  DSPTGSLRSSDQGS  673



>ref|XP_002510319.1| kinase, putative [Ricinus communis]
 gb|EEF52506.1| kinase, putative [Ricinus communis]
Length=627

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+IT +K VD +R+ +E+ LA +   +I  G L +
Sbjct  428  LDPQYHQNFHLSDKSDVYSFGVVLIEIITALKVVDFSRQYNEVNLAALATDRIGKGRLAE  487

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L +  D      V  VAELAFRC+A DKD RP   EVAAEL ++R
Sbjct  488  IIDPLLDIHCDAWTFSTVHKVAELAFRCLAFDKDTRPSMMEVAAELEQLR  537



>ref|XP_009360135.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Pyrus x bretschneideri]
Length=522

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y + ++L  KSDVYSFGVVL+ELI+ M AVD TR + E+ L+ M + KI+   LH+
Sbjct  357  VDPEYNQCYQLTSKSDVYSFGVVLIELISSMPAVDITRHRHEINLSTMAINKIKNHTLHE  416

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D   ++ + AVAELAFRC+  DKD RP   EV  EL++I+S
Sbjct  417  LVDPYLGFESDSTTQKMIIAVAELAFRCLQTDKDVRPSMVEVLNELKQIQS  467



>ref|XP_008347440.1| PREDICTED: wall-associated receptor kinase-like 14 [Malus domestica]
Length=406

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+ITG+KAVD TR ++E+ LA +   +I  G L++
Sbjct  248  LDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALATDRIGRGCLNE  307

Query  529  VLDPV---LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP    L+ D      V  VAELAFRC+A  +D RP   EV AEL  I+
Sbjct  308  IIDPFLEPLLDDAWPLSSVHKVAELAFRCLAFQRDMRPTMIEVTAELELIK  358



>gb|AAL91622.1| At2g23450/F26B6.10 [Arabidopsis thaliana]
 gb|AAN33192.1| At2g23450/F26B6.10 [Arabidopsis thaliana]
Length=708

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G + +
Sbjct  515  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDE  574

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L +D +A     +  VAELAFRC+A   D RP   EVA EL +IR
Sbjct  575  IIDPILDLDLDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIR  624



>ref|NP_565552.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana]
 ref|NP_850041.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana]
 sp|Q8RY67.2|WAKLO_ARATH RecName: Full=Wall-associated receptor kinase-like 14; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC23760.2| putative protein kinase [Arabidopsis thaliana]
 gb|AEC07456.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana]
 gb|AEC07457.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana]
Length=708

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G + +
Sbjct  515  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDE  574

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L +D +A     +  VAELAFRC+A   D RP   EVA EL +IR
Sbjct  575  IIDPILDLDLDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIR  624



>gb|KHN40934.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=238

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 12/146 (8%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L  KSDVYSFGVVL+ELI+ M AVD  R K E+ L+++ + KIQ   L +
Sbjct  66   VDPEYHQCYQLTSKSDVYSFGVVLIELISSMPAVDMNRHKDEINLSNLAIKKIQERALSE  125

Query  529  VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS---------  383
            ++DP L  D   E K  +    ELAF+C+  D++ RP   EV   L+RI S         
Sbjct  126  LVDPYLGFDSDTEVKRMIIEATELAFQCLQQDRELRPSMDEVLEVLKRIESGKDELKHLE  185

Query  382  -RARGSGVLRTSNSSNAVVPDGAGLI  308
                GSGV   +N + +   D AGL+
Sbjct  186  EAVHGSGVSHNNNVTTSTELDEAGLL  211



>emb|CDY38944.1| BnaA04g13650D [Brassica napus]
Length=681

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+KAVD TR  +++ LA + V KI  G L +
Sbjct  494  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKAVDFTRPHTQINLAALAVDKIGSGCLDE  553

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L V  D      +  VAELAFRC++   D RP   EVA EL +IR
Sbjct  554  IIDPILDVSLDAWTLSSMHTVAELAFRCLSFHSDMRPTMTEVADELEQIR  603



>ref|XP_007142946.1| hypothetical protein PHAVU_007G0307001g, partial [Phaseolus vulgaris]
 gb|ESW14940.1| hypothetical protein PHAVU_007G0307001g, partial [Phaseolus vulgaris]
Length=381

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y++ +RL +KSDVYSFGVVL+ELI+ M AVD  RE+ E+ LA++ + KIQ G L +
Sbjct  203  LDPEYFQCYRLTDKSDVYSFGVVLMELISSMPAVDAARERDEVNLANLCMKKIQKGKLGE  262

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP    + +   K  V +VAELAFRCV  D + RP   +V   L++I+S       L 
Sbjct  263  LVDPSFGFESDQVVKRMVTSVAELAFRCVQGDNELRPSMDQVLEALKKIQSGNYEYENLE  322

Query  355  TSNSSNAVVP  326
              +    V+P
Sbjct  323  KGDDGGNVIP  332



>ref|XP_009140464.1| PREDICTED: wall-associated receptor kinase-like 14 [Brassica 
rapa]
Length=681

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+KAVD TR  +++ LA + V KI  G L +
Sbjct  494  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKAVDFTRPHTQINLAALAVDKIGSGCLDE  553

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L V  D      +  VAELAFRC++   D RP   EVA EL +IR
Sbjct  554  IIDPILDVSLDAWTLSSMHTVAELAFRCLSFHSDMRPTMTEVADELEQIR  603



>emb|CDY01771.1| BnaC06g28110D [Brassica napus]
Length=634

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  KAVD TR++ ++ LA+MVV KI+   +H+
Sbjct  475  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKKAVDITRQRHDINLANMVVSKIKNNAVHE  534

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            ++DP L    D E K  + +VAELAFRC+  +++ RP   E+   L+ I+    G
Sbjct  535  LVDPSLGFEKDPEVKRMMISVAELAFRCLQQEREGRPWMDEIVEILKGIKGEKAG  589



>ref|XP_010415222.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Camelina sativa]
Length=731

 Score =   111 bits (278),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  567  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  626

Query  529  VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L  D   + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  627  LVDPSLGFDKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVD  686

Query  355  TSN  347
            +++
Sbjct  687  SAD  689



>emb|CDY01770.1| BnaC06g28100D [Brassica napus]
Length=631

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  KAVD TR++ ++ LA+MVV KI+   +H+
Sbjct  472  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKKAVDITRQRHDINLANMVVSKIKNNAVHE  531

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARG  371
            ++DP L    D E K  + +VAELAFRC+  +++ RP   E+   L+ I+    G
Sbjct  532  LVDPSLGFEKDPEVKRMMISVAELAFRCLQQEREGRPWMDEIVEILKGIKGEKAG  586



>emb|CDX81871.1| BnaC08g37300D [Brassica napus]
Length=642

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+ S++L+ KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   L +
Sbjct  496  VDPEYHLSYQLSNKSDVYSFAVVLMELISSLPAVDMTRPRQEINLSNMAVLKIQNRKLQE  555

Query  529  VLDPVLVVD--GEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L  D   E ++ V AVAELAF+C+ +DKD RP    V   L RI++   GSG+
Sbjct  556  MVDPSLGFDTNTEVRQTVIAVAELAFQCLQSDKDLRPCMTHVTETLTRIQNNGFGSGM  613



>ref|XP_009105240.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Brassica rapa]
Length=700

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   +H+
Sbjct  540  VDPEYYQCYRLNEKSDVYSFGVVLAELISSKEAVDITRHRHDINLANMAVSKIQNNAVHE  599

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            +LDP L    D E K  + +VAELAFRC+  +++ RP   E+   L+ I+   R
Sbjct  600  LLDPSLGFSKDPEVKRMMVSVAELAFRCLQQEREGRPSMDEIVEILKGIKGENR  653



>ref|XP_004512900.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X2 [Cicer arietinum]
Length=707

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ ++L EKSDVYSFGVV++ELI+ + AVD TR + E+ LA+M + +IQ   LH+
Sbjct  550  VDPDYHQCYQLTEKSDVYSFGVVMIELISSLPAVDITRHRHEINLANMAINRIQNQALHE  609

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L    D + K+ + AVAELAF+C+ + K+ RP   EV   L+ I+S  +
Sbjct  610  LVDPTLGFESDPKVKKMINAVAELAFQCLQSSKEMRPYMDEVLETLKDIQSDGK  663



>ref|XP_009360133.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Pyrus x bretschneideri]
Length=682

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y + ++L  KSDVYSFGVVL+ELI+ M AVD TR + E+ L+ M + KI+   LH+
Sbjct  517  VDPEYNQCYQLTSKSDVYSFGVVLIELISSMPAVDITRHRHEINLSTMAINKIKNHTLHE  576

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D   ++ + AVAELAFRC+  DKD RP   EV  EL++I+S
Sbjct  577  LVDPYLGFESDSTTQKMIIAVAELAFRCLQTDKDVRPSMVEVLNELKQIQS  627



>tpg|DAA38848.1| TPA: putative WAK receptor-like protein kinase family protein 
[Zea mays]
Length=365

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y++ ++L EKSDVYSFGVVL+EL++   AVD  R  SE+ LA+M + +IQ   + Q
Sbjct  202  VDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQ  261

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    DGE K  +  VAELAFRC+  ++D RP  +EV   L RIR+
Sbjct  262  LVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIRN  312



>ref|XP_004512901.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X3 [Cicer arietinum]
Length=680

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ ++L EKSDVYSFGVV++ELI+ + AVD TR + E+ LA+M + +IQ   LH+
Sbjct  523  VDPDYHQCYQLTEKSDVYSFGVVMIELISSLPAVDITRHRHEINLANMAINRIQNQALHE  582

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L    D + K+ + AVAELAF+C+ + K+ RP   EV   L+ I+S  +
Sbjct  583  LVDPTLGFESDPKVKKMINAVAELAFQCLQSSKEMRPYMDEVLETLKDIQSDGK  636



>ref|XP_002880505.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56764.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=705

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G + +
Sbjct  512  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDE  571

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L +D +A     +  VAEL FRC+A   D RP   EVA EL +IR
Sbjct  572  IIDPILDLDLDAWTLSSIHTVAELTFRCLAFHSDMRPTMTEVADELEQIR  621



>emb|CDY52891.1| BnaC06g27840D [Brassica napus]
Length=699

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   +H+
Sbjct  539  VDPEYYQCYRLNEKSDVYSFGVVLAELISSKEAVDITRHRHDINLANMAVSKIQNNAVHE  598

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            +LDP L    D E K  + +VAELAFRC+  +++ RP   E+   L+ I+   R
Sbjct  599  LLDPSLGFSKDPEVKRMMVSVAELAFRCLQQEREGRPSMDEIVEILKGIKGENR  652



>ref|XP_003592612.1| hypothetical protein MTR_1g110130 [Medicago truncatula]
Length=879

 Score =   111 bits (277),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 54/111 (49%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ +RL  KSDVYSFGVVL+ELI+ M AVD +R+K E+ LA++ + KIQ   +H+
Sbjct  467  MDPEYHQCYRLTSKSDVYSFGVVLVELISSMPAVDMSRDKDEINLANLAIRKIQKSKIHE  526

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D + K  +  +AELAF+C+  DK+ RP   EV   LRRI S
Sbjct  527  LVDPSLGFESDKDVKRKIVLIAELAFQCLQRDKELRPSMDEVLDVLRRIDS  577



>gb|KDP29455.1| hypothetical protein JCGZ_18376 [Jatropha curcas]
Length=187

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 2/112 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY  ++L +KSDVYSFGVVL+ELI+ M AVD TR   E+ LA++ + +IQ     +
Sbjct  66   VDPEYYLCYQLTDKSDVYSFGVVLVELISSMPAVDITRHSQEINLANLALNRIQRCAFDE  125

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
            ++DP L    D E K    +VAELAF C+  DK+ RP   EV  EL+RI SR
Sbjct  126  LMDPNLGYQSDEEVKRMTTSVAELAFLCLQQDKEMRPPMDEVLEELKRIESR  177



>ref|XP_010922259.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Elaeis guineensis]
Length=418

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y++ ++L +KSDVYSFGVVL+ELI+   AVD TR + E+ LA M + KIQ   L Q
Sbjct  258  LDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRHEINLASMAINKIQNCQLEQ  317

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP LV   D   K+ +  VAELAFRC+ +D D RP  +EV   LR I
Sbjct  318  LVDPDLVYQSDWAIKKTITMVAELAFRCLQSDGDMRPPIKEVLEVLREI  366



>ref|XP_004512899.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X1 [Cicer arietinum]
Length=737

 Score =   110 bits (276),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 58/132 (44%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ ++L EKSDVYSFGVV++ELI+ + AVD TR + E+ LA+M + +IQ   LH+
Sbjct  580  VDPDYHQCYQLTEKSDVYSFGVVMIELISSLPAVDITRHRHEINLANMAINRIQNQALHE  639

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG---  365
            ++DP L    D + K+ + AVAELAF+C+ + K+ RP   EV   L+ I+S  +      
Sbjct  640  LVDPTLGFESDPKVKKMINAVAELAFQCLQSSKEMRPYMDEVLETLKDIQSDGKHKSQPE  699

Query  364  VLRTSNSSNAVV  329
            VL  S+S++  V
Sbjct  700  VLDISSSADDAV  711



>ref|XP_004963055.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X1 [Setaria italica]
Length=759

 Score =   110 bits (276),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ F L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G + +
Sbjct  585  VDPEYHQCFHLSDKSDVYSFGVVLLELITAMKVVDFDRPAAEVNLASLALDRIGKGRVGE  644

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP ++  GE    E V  V+ELAFRC+A  KD RP   EVAAEL RIR  A
Sbjct  645  IVDPAILGGGEEWVMESVRHVSELAFRCLAFHKDVRPAMCEVAAELHRIRDAA  697



>ref|XP_010922266.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X5 [Elaeis guineensis]
Length=408

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y++ ++L +KSDVYSFGVVL+ELI+   AVD TR + E+ LA M + KIQ   L Q
Sbjct  248  LDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRHEINLASMAINKIQNCQLEQ  307

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP LV   D   K+ +  VAELAFRC+ +D D RP  +EV   LR I
Sbjct  308  LVDPDLVYQSDWAIKKTITMVAELAFRCLQSDGDMRPPIKEVLEVLREI  356



>gb|KJB17856.1| hypothetical protein B456_003G019500 [Gossypium raimondii]
 gb|KJB17857.1| hypothetical protein B456_003G019500 [Gossypium raimondii]
Length=699

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL+E+IT +K VD +R  SE+ LA +   +I  G + +
Sbjct  498  LDPQYHQYFHLSDKSDVYSFGVVLVEIITALKVVDFSRPHSEVNLAALATDRIGKGCVDE  557

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP L +DG+A     +  VAELAFRC+A   D RP   EVA EL RIR  A
Sbjct  558  IIDPYLDLDGDAWTLSSIHKVAELAFRCLAFHPDMRPTMLEVAEELERIRLSA  610



>ref|XP_008671496.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Zea mays]
Length=437

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y++ ++L EKSDVYSFGVVL+EL++   AVD  R  SE+ LA+M + +IQ   + Q
Sbjct  274  VDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQ  333

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    DGE K  +  VAELAFRC+  ++D RP  +EV   L RIR+
Sbjct  334  LVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIRN  384



>ref|XP_006404832.1| hypothetical protein EUTSA_v10000066mg [Eutrema salsugineum]
 gb|ESQ46285.1| hypothetical protein EUTSA_v10000066mg [Eutrema salsugineum]
Length=694

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI    L +
Sbjct  499  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSNCLDE  558

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L   +D      +  VAELAFRC+A   D RP   EVA EL +IR
Sbjct  559  IIDPILDSNLDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIR  608



>emb|CDY21708.1| BnaA09g44590D [Brassica napus]
Length=651

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+ S++L+ KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   L +
Sbjct  504  VDPEYHLSYQLSNKSDVYSFAVVLMELISSLPAVDMTRPRQEINLSNMAVLKIQNRRLQE  563

Query  529  VLDPVLVVD--GEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L  D   E ++ V AVAELAF+C+ +DKD RP    V   L RI++   GSG+
Sbjct  564  MVDPSLGFDTNTEVRQTVIAVAELAFQCLQSDKDLRPCMTHVMETLTRIQNNGFGSGM  621



>ref|XP_009365635.1| PREDICTED: wall-associated receptor kinase-like 14 [Pyrus x bretschneideri]
Length=697

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+ITG+KAVD TR ++E+ LA +   +I  G L++
Sbjct  497  LDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALATDRIGRGCLNE  556

Query  529  VLDPV---LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP    L+ D      V  VAELAFRC+A  +D RP   EV AEL  I+
Sbjct  557  IIDPFLEPLLDDAWTLSSVHKVAELAFRCLAFQRDMRPTMIEVTAELELIK  607



>ref|XP_008377371.1| PREDICTED: wall-associated receptor kinase-like 14 [Malus domestica]
Length=694

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+ITG+KAVD TR ++E+ LA +   +I  G L++
Sbjct  494  LDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALATDRIGRGCLNE  553

Query  529  VLDPV---LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP    L+ D      V  VAELAFRC+A  +D RP   EV AEL  I+
Sbjct  554  IIDPFLEPLLDDAWXLSSVHKVAELAFRCLAFQRDMRPTMIEVTAELELIK  604



>ref|XP_004291924.1| PREDICTED: wall-associated receptor kinase-like 14 [Fragaria 
vesca subsp. vesca]
Length=704

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+ITG+KAVD +R ++E+ LA +   KI  G L++
Sbjct  503  LDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFSRPQNEVNLAALATVKIGKGCLNE  562

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L    D      +  VAELAFRC+A  +D RP   EV AEL  I+
Sbjct  563  IIDPSLEPFEDDWTASSIHKVAELAFRCLAFHRDARPSMMEVKAELEDIK  612



>ref|XP_006605928.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Glycine max]
Length=670

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+R +RL +KSDVYSFGVVL+ELI+ M AVD  RE+ E+ LA++ + KI  G L +
Sbjct  500  VDPEYFRCYRLTDKSDVYSFGVVLMELISSMPAVDTVRERDEVNLANLAMKKIHKGKLSE  559

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP      D + K  + +VAELAFRC+ AD D RP   EV   L+ I
Sbjct  560  LVDPSFGFETDQQVKRVITSVAELAFRCIQADNDLRPSMDEVLEALKNI  608



>gb|KDO76913.1| hypothetical protein CISIN_1g0479691mg, partial [Citrus sinensis]
Length=366

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L +KSDVYSFGVVL+ELI+ M AVD  R + E+ LA++ + KIQ     +
Sbjct  192  VDPEYHQCYQLTDKSDVYSFGVVLIELISSMPAVDMNRHRHEINLANLAINKIQKCAFDE  251

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D E K    +VAELAF C+  +K+ RP   EV AEL+RI+S
Sbjct  252  LIDPCLGFESDEEVKRMTTSVAELAFLCLQQNKELRPSMEEVLAELQRIKS  302



>ref|XP_009117614.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Brassica rapa]
Length=681

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+ S++L+ KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   L +
Sbjct  504  VDPEYHLSYQLSNKSDVYSFAVVLMELISSLPAVDMTRPRQEINLSNMAVLKIQNRRLQE  563

Query  529  VLDPVLVVD--GEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L  D   E ++ V AVAELAF+C+ +DKD RP    V   L RI++   GSG+
Sbjct  564  MVDPSLGFDTNTEVRQTVIAVAELAFQCLQSDKDLRPCMTHVMETLTRIQNNGFGSGM  621



>ref|XP_010472340.1| PREDICTED: wall-associated receptor kinase-like 14 [Camelina 
sativa]
Length=686

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G + +
Sbjct  493  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDE  552

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+  L +D      +  VAEL FRC+A   D RP   EVA EL +IR
Sbjct  553  IIDPILDLELDAWTLSSIHTVAELTFRCLAFHSDMRPTMTEVADELEQIR  602



>ref|NP_001067182.1| Os12g0595800 [Oryza sativa Japonica Group]
 gb|ABA99191.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30201.1| Os12g0595800 [Oryza sativa Japonica Group]
 gb|EAZ21095.1| hypothetical protein OsJ_36737 [Oryza sativa Japonica Group]
Length=725

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y+++F L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G +  
Sbjct  551  LDPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFARPAAEVNLASLALDRIGKGRVDD  610

Query  529  VLDPVLV--VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP LV   D      V  V+ELAFRC+A  KD RP   EVAAEL RIR  A  S
Sbjct  611  IVDPALVDRADEWVMRSVRHVSELAFRCLAFQKDVRPAMSEVAAELARIRDAAPAS  666



>ref|XP_010417096.1| PREDICTED: wall-associated receptor kinase-like 14 [Camelina 
sativa]
Length=687

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G + +
Sbjct  494  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDE  553

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+  L +D      +  VAEL FRC+A   D RP   EVA EL +IR
Sbjct  554  IIDPILDLELDAWTLSSIHTVAELTFRCLAFHSDMRPTMTEVADELEQIR  603



>gb|EAY83755.1| hypothetical protein OsI_38972 [Oryza sativa Indica Group]
Length=725

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y+++F L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G +  
Sbjct  551  LDPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFARPAAEVNLASLALDRIGKGRVDD  610

Query  529  VLDPVLV--VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP LV   D      V  V+ELAFRC+A  KD RP   EVAAEL RIR  A  S
Sbjct  611  IVDPALVDRADEWVMRSVRHVSELAFRCLAFQKDVRPAMSEVAAELARIRDAAPAS  666



>gb|ABG22068.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG92968.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y+++F L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G +  
Sbjct  554  LDPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFARPAAEVNLASLALDRIGKGRVDD  613

Query  529  VLDPVLV--VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP LV   D      V  V+ELAFRC+A  KD RP   EVAAEL RIR  A  S
Sbjct  614  IVDPALVDRADEWVMRSVRHVSELAFRCLAFQKDVRPAMSEVAAELARIRDAAPAS  669



>ref|XP_006448414.1| hypothetical protein CICLE_v10014492mg [Citrus clementina]
 gb|ESR61654.1| hypothetical protein CICLE_v10014492mg [Citrus clementina]
Length=679

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L +KSDVYSFGVVL+ELI+ M AVD  R + E+ LA++ + KIQ     +
Sbjct  505  VDPEYHQCYQLTDKSDVYSFGVVLIELISSMPAVDMNRHRHEINLANLAINKIQKCAFDE  564

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D E K    +VAELAF C+  DK+ RP   EV AEL+RI+S
Sbjct  565  LIDPCLGFESDEEVKRMTTSVAELAFLCLQQDKELRPSMEEVFAELQRIKS  615



>ref|XP_010429293.1| PREDICTED: wall-associated receptor kinase-like 14 [Camelina 
sativa]
Length=689

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL E+ITG+K VD TR  +E+ LA + V KI  G + +
Sbjct  496  LDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDE  555

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+  L +D      +  VAEL FRC+A   D RP   EVA EL +IR
Sbjct  556  IIDPILDLELDAWTLSSIHTVAELTFRCLAFHSDMRPTMTEVADELEQIR  605



>ref|XP_006416610.1| hypothetical protein EUTSA_v10007020mg [Eutrema salsugineum]
 gb|ESQ34963.1| hypothetical protein EUTSA_v10007020mg [Eutrema salsugineum]
Length=656

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY+  ++L+ KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   LH+
Sbjct  513  VDPDYHLCYQLSNKSDVYSFAVVLMELISSLPAVDITRPRQEINLSNMAVVKIQNHKLHE  572

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP L  D +   ++ V AVAELAF+C+ +DKD RP    V   L RI++   GS
Sbjct  573  MVDPSLGFDTDTRVRQTVIAVAELAFQCLLSDKDLRPCMSHVQETLTRIQNNGFGS  628



>ref|XP_009622953.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana tomentosiformis]
Length=695

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ LA+M V KIQ   +H+
Sbjct  551  VDPEYYQCYQLTEKSDVYSFGVVLIELISSLQAVDTNRHRHDINLANMAVNKIQTHSVHE  610

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    +   +     VAELAFRC+  ++D RP  REV   LR I++
Sbjct  611  LVDPSLGFTTNSSVRRMTTLVAELAFRCLQQERDMRPSMREVLETLRGIQN  661



>ref|XP_010316315.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Solanum lycopersicum]
Length=722

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 60/141 (43%), Positives = 89/141 (63%), Gaps = 12/141 (9%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ L++M V KIQ   +H+
Sbjct  577  VDPEYYQCYQLTEKSDVYSFGVVLVELISSLEAVDTNRHRHDINLSNMAVNKIQGHSIHE  636

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR---SRARGSG  365
            ++DP L    +   +     VAELAFRC+  ++D RP  +EV   LR I+   S+A  + 
Sbjct  637  LVDPTLGFSTNSSVRRMTTLVAELAFRCLQQERDLRPSMQEVLETLRGIQNGESKAHNAE  696

Query  364  VLRTSNSSNAVVPDGAGLIID  302
            VL        +V D AGL+ D
Sbjct  697  VLD-------IVVDDAGLLKD  710



>ref|XP_011021277.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Populus euphratica]
Length=713

 Score =   109 bits (273),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L  KSDVYSFGVVL+ELI+ ++AVD  R + ++ L++M V KIQ   L++
Sbjct  551  VDPEYYQCYQLTNKSDVYSFGVVLIELISSLQAVDTNRHRHDINLSNMAVNKIQNHALNE  610

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            ++DP L  D +   +  V +VAELAFRC+  D++ RP   EV   L+RI     G+G
Sbjct  611  LVDPSLGFDKDIVVRRMVTSVAELAFRCLQQDREMRPAMEEVLEALKRIEKENYGAG  667



>ref|XP_010415226.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X5 [Camelina sativa]
Length=680

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 2/119 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  516  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  575

Query  529  VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVL  359
            ++DP L  D   + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+
Sbjct  576  LVDPSLGFDKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVV  634



>gb|KHG05164.1| Wall-associated receptor kinase-like 14 [Gossypium arboreum]
Length=700

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL+E+IT +K VD +R  SE+ LA +   +I  G + +
Sbjct  499  LDPQYHQYFHLSDKSDVYSFGVVLVEIITALKVVDFSRPHSEVNLAALATDRIGKGCVDE  558

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP L +DG+A     +  VAELAFRC+A   D RP   EVA EL RIR  A
Sbjct  559  IIDPYLDLDGDAWTLSSIHKVAELAFRCLAFHPDMRPTMLEVAEELERIRLSA  611



>ref|XP_006842370.1| hypothetical protein AMTR_s00079p00188790 [Amborella trichopoda]
 gb|ERN04045.1| hypothetical protein AMTR_s00079p00188790 [Amborella trichopoda]
Length=554

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ ++L +KSDVYSFGVVL ELI+G  AVD  R + E+ LA M + KIQ   LH+
Sbjct  397  VDPDYHQCYQLTDKSDVYSFGVVLAELISGKPAVDIARHRHEINLATMAINKIQNRALHE  456

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
            ++DP +  + +   K+ V  VAEL FRC++ +KD RP   EVAA LR I S 
Sbjct  457  LVDPEIGFESDPLVKKMVTLVAELTFRCLSLEKDLRPTMEEVAAALRLIESN  508



>ref|XP_009149279.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Brassica rapa]
Length=648

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 80/118 (68%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY+  ++L++KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   LH+
Sbjct  508  VDPDYHLCYQLSKKSDVYSFAVVLMELISSLPAVDITRTRQEINLSNMAVVKIQSHKLHE  567

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L  D +   +E V AVAELAF+C+ +DKD RP    V   L +I +   GS +
Sbjct  568  MVDPSLGFDTDTRVRETVIAVAELAFQCLQSDKDLRPCMSHVMDTLTKIENNGFGSNM  625



>ref|XP_009622954.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Nicotiana tomentosiformis]
Length=693

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ LA+M V KIQ   +H+
Sbjct  549  VDPEYYQCYQLTEKSDVYSFGVVLIELISSLQAVDTNRHRHDINLANMAVNKIQTHSVHE  608

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    +   +     VAELAFRC+  ++D RP  REV   LR I++
Sbjct  609  LVDPSLGFTTNSSVRRMTTLVAELAFRCLQQERDMRPSMREVLETLRGIQN  659



>ref|XP_006301694.1| hypothetical protein CARUB_v10022151mg [Capsella rubella]
 gb|EOA34592.1| hypothetical protein CARUB_v10022151mg [Capsella rubella]
Length=1292

 Score =   110 bits (275),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -1

Query  709   LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
             +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  1127  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  1186

Query  529   VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
             ++DP L  D   E +  + +VAELAFRC+  +++ RP   E+   L+ I+   +
Sbjct  1187  LVDPSLGFDKDPEIRRKMMSVAELAFRCLQQEREVRPAMDEIVEILKGIKDEEK  1240



>gb|AES73970.2| wall associated kinase-like protein [Medicago truncatula]
Length=727

 Score =   109 bits (273),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y++ + L++KSDVYSFGVVL+E+ITG+K VD +R  +E+ LA + V +I+ GLL  
Sbjct  504  VDPQYHQDYHLSDKSDVYSFGVVLVEIITGLKVVDFSRPHNEVNLASLAVDRIRKGLLDD  563

Query  529  VLDPVLVVDGEA-KEG-----VGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP++ +  +A  EG     +  VAELAFRC+A  +D RP   EVA EL ++R
Sbjct  564  IIDPIIFLHSQATSEGWTLSSIHKVAELAFRCLAFHRDMRPCMTEVATELEQLR  617



>gb|ABA99190.2| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=613

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y+++F L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G +  
Sbjct  439  LDPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFARPAAEVNLASLALDRIGKGRVDD  498

Query  529  VLDPVLV--VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP LV   D      V  V+ELAFRC+A  KD RP   EVAAEL RIR  A  S
Sbjct  499  IVDPALVDRADEWVMRSVRHVSELAFRCLAFQKDVRPAMSEVAAELARIRDAAPAS  554



>ref|XP_010415225.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Camelina sativa]
Length=696

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 2/119 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  532  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  591

Query  529  VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVL  359
            ++DP L  D   + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+
Sbjct  592  LVDPSLGFDKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVV  650



>ref|XP_009149280.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Brassica rapa]
Length=634

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 80/118 (68%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY+  ++L++KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   LH+
Sbjct  494  VDPDYHLCYQLSKKSDVYSFAVVLMELISSLPAVDITRTRQEINLSNMAVVKIQSHKLHE  553

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L  D +   +E V AVAELAF+C+ +DKD RP    V   L +I +   GS +
Sbjct  554  MVDPSLGFDTDTRVRETVIAVAELAFQCLQSDKDLRPCMSHVMDTLTKIENNGFGSNM  611



>gb|AAG50588.1|AC083891_2 wall-associated kinase, putative [Arabidopsis thaliana]
Length=907

 Score =   110 bits (274),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++LNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  745  VDPEYYQCYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  804

Query  529  VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++D  L  D   E +  + AVAELAFRC+  ++D RP   E+   LR I+
Sbjct  805  LVDSSLGYDNDPEVRRKMMAVAELAFRCLQQERDVRPAMDEIVEILRGIK  854



>ref|XP_006664705.1| PREDICTED: wall-associated receptor kinase-like 14-like [Oryza 
brachyantha]
Length=574

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y+++F L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G +  
Sbjct  401  LDPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFARPAAEVNLASLALDRIGKGRVDD  460

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP LV  G+      V  V+ELAFRC+A  KD RP   EVAAEL RIR  A  S
Sbjct  461  IVDPALVDRGDEWVMLSVRHVSELAFRCLAFQKDVRPCMSEVAAELSRIRDAAPAS  516



>gb|AFG66670.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66674.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
Length=147

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+  F+L EKSDVYSFGVVL+E+I+   AVD  R++ E+ LA M + KIQ G LH+
Sbjct  50   VDPEYHECFQLTEKSDVYSFGVVLVEIISAKLAVDINRKRGEINLAFMAMSKIQEGALHE  109

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRP  425
            +LDP L +  + + +  V AVAEL FRC+A++ DDRP
Sbjct  110  LLDPQLEIEKNDQVEAMVSAVAELIFRCLASEGDDRP  146



>ref|XP_006468738.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Citrus sinensis]
Length=682

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L +KSDVYSFGVVL+ELI+ M AVD  R + E+ LA++ + KIQ     +
Sbjct  508  VDPEYHQCYQLTDKSDVYSFGVVLIELISSMPAVDMNRHRHEINLANLAINKIQKCAFDE  567

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D E K    +VAELAF C+  DK+ RP   EV AEL+RI+S
Sbjct  568  LIDPCLGFESDEEVKRMTTSVAELAFLCLQQDKELRPSMEEVFAELQRIKS  618



>ref|XP_002527016.1| wall-associated kinase, putative [Ricinus communis]
 gb|EEF35388.1| wall-associated kinase, putative [Ricinus communis]
Length=628

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY  ++L EKSDVYSFGVVL+ELI+ M AVD TRE+ E+ LA++ + KIQ     +
Sbjct  502  VDPEYYHCYQLTEKSDVYSFGVVLVELISSMPAVDITRERHEINLANLAINKIQRSAFDE  561

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D E +     VAELAF C+  DK+ RP   EV  EL+RI S
Sbjct  562  LIDPFLGYQSDEEVQRMTVLVAELAFLCLQKDKEMRPAMHEVLEELKRIES  612



>gb|KJB31466.1| hypothetical protein B456_005G193100 [Gossypium raimondii]
Length=679

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L EKSDVYSFGVVL+ELI+ M AVD  R + E+ LA++ + KIQ     +
Sbjct  505  VDPEYHQCYQLTEKSDVYSFGVVLIELISSMPAVDINRHRHEINLANLAISKIQKCAFDE  564

Query  529  VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L      +       VAELAFRC+  +K+ RP   EV  EL+RI+S A  S  ++
Sbjct  565  LVDPNLGYKSCEQVARMTTLVAELAFRCLQQEKELRPSMEEVLEELQRIKSEAYESENVQ  624

Query  355  TSNSSNAVVPDGAG  314
                S++ VP   G
Sbjct  625  QEEHSDSEVPMSVG  638



>ref|XP_009622952.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana tomentosiformis]
Length=698

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ LA+M V KIQ   +H+
Sbjct  554  VDPEYYQCYQLTEKSDVYSFGVVLIELISSLQAVDTNRHRHDINLANMAVNKIQTHSVHE  613

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    +   +     VAELAFRC+  ++D RP  REV   LR I++
Sbjct  614  LVDPSLGFTTNSSVRRMTTLVAELAFRCLQQERDMRPSMREVLETLRGIQN  664



>ref|XP_010511593.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Camelina sativa]
Length=667

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 2/122 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  505  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  564

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  565  LVDPSLGFEKDLDVRREMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  624

Query  355  TS  350
            ++
Sbjct  625  ST  626



>ref|XP_009802455.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana sylvestris]
Length=686

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ LA+M V KIQ   +H+
Sbjct  542  VDPEYYQCYQLTEKSDVYSFGVVLIELISSLEAVDTNRHRQDINLANMAVNKIQTHSVHE  601

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    +   +     VAELAFRC+  ++D RP  +EV   LR I+S
Sbjct  602  LVDPSLGFTTNSSVRRMTTLVAELAFRCLQQERDMRPSMQEVLETLRGIQS  652



>ref|XP_006375036.1| hypothetical protein POPTR_0014s03810g [Populus trichocarpa]
 gb|ERP52833.1| hypothetical protein POPTR_0014s03810g [Populus trichocarpa]
Length=686

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++K+DVYSFGVVL+E+IT  K +D +R + E+ LA + + KI  GLL +
Sbjct  485  LDPQYHQNFHLSDKTDVYSFGVVLIEIITAKKVLDFSRPQDEVNLASLAIDKIGRGLLDE  544

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP L +  +A     V  VAELAFRC+A  KD RP   EVAAEL +I
Sbjct  545  IIDPFLDLHSDAWTFSSVHKVAELAFRCLAFHKDIRPSMMEVAAELEQI  593



>ref|XP_011031055.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X4 
[Populus euphratica]
Length=684

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++K+DVYSFGVVL+E+IT  K +D +R + E+ LA + + KI  GLL +
Sbjct  483  LDPQYHQNFHLSDKTDVYSFGVVLIEIITAKKVLDFSRPQDEVNLASLAIDKIGRGLLDE  542

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP L +  +A     V  VAELAFRC+A  KD RP   EVAAEL +I
Sbjct  543  IIDPFLDLHSDAWTFSSVHKVAELAFRCLAFHKDIRPSMMEVAAELEQI  591



>gb|KGN63838.1| hypothetical protein Csa_1G024230 [Cucumis sativus]
Length=472

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L++KSDV+SFGVVL+ELI+ M AVD TR + E+ L +M + KIQ   LH+
Sbjct  312  VDPEYHQCYQLSDKSDVFSFGVVLVELISSMPAVDITRHRQEINLFNMAINKIQNSTLHE  371

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
             +DP L  + + K  E + +VAELAFRC+ + KD+RP   EV   L  I+ +
Sbjct  372  FVDPSLGFESDYKIQEMITSVAELAFRCLQSMKDERPTMMEVLDTLNIIKKQ  423



>ref|XP_006366440.1| PREDICTED: wall-associated receptor kinase-like 14-like [Solanum 
tuberosum]
Length=677

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F+L++KSDVYSFGVVL E+ITG+KAVD  R + E+ LA + + +I  G L +
Sbjct  489  LDPQYHQNFQLSDKSDVYSFGVVLAEIITGLKAVDFARPQDEINLAALAIDRIGKGNLDE  548

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP   L +D      +  VAELAFRC+A  +D RP   EVA EL ++R
Sbjct  549  IIDPFIELHMDAWTLSSIHKVAELAFRCLAFHRDMRPSMMEVAIELEQLR  598



>ref|XP_009391159.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Musa acuminata subsp. malaccensis]
Length=435

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 79/119 (66%), Gaps = 6/119 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY++ F+L +KSDVYSFGVVL ELI+   AVD TR++ ++ LA M + KIQ   L Q
Sbjct  277  VDPDYHQCFQLTDKSDVYSFGVVLAELISSKPAVDVTRQRHDINLATMAISKIQNQELEQ  336

Query  529  VLDPVLVVD--GEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR----SRARG  371
            ++DP L     GE +  +  VAE+AFRC+ A+ + RP  +EV   L+ I+    SRA+G
Sbjct  337  LVDPTLWCQSKGETRTMIEQVAEVAFRCLQAETEIRPTMKEVLEALKAIQDEGCSRAKG  395



>gb|AAG60067.1|AC013288_1 protein kinase, putative [Arabidopsis thaliana]
Length=1286

 Score =   110 bits (274),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709   LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
             +DP+YY+ ++LNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  1124  VDPEYYQCYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  1183

Query  529   VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
             ++D  L  D   E +  + AVAELAFRC+  ++D RP   E+   LR I+
Sbjct  1184  LVDSSLGYDNDPEVRRKMMAVAELAFRCLQQERDVRPAMDEIVEILRGIK  1233



>ref|XP_010511592.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Camelina sativa]
Length=679

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 2/122 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  517  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  576

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  577  LVDPSLGFEKDLDVRREMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  636

Query  355  TS  350
            ++
Sbjct  637  ST  638



>ref|NP_176860.2| serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AEE34567.1| serine/threonine protein kinase [Arabidopsis thaliana]
Length=1296

 Score =   110 bits (274),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709   LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
             +DP+YY+ ++LNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  1134  VDPEYYQCYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  1193

Query  529   VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
             ++D  L  D   E +  + AVAELAFRC+  ++D RP   E+   LR I+
Sbjct  1194  LVDSSLGYDNDPEVRRKMMAVAELAFRCLQQERDVRPAMDEIVEILRGIK  1243



>ref|XP_010511594.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Camelina sativa]
Length=651

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 2/122 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  489  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  548

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  549  LVDPSLGFEKDLDVRREMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  608

Query  355  TS  350
            ++
Sbjct  609  ST  610



>gb|KDP38442.1| hypothetical protein JCGZ_04367 [Jatropha curcas]
Length=681

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+ITG+K VD  R  +++ LA +   +I  G L +
Sbjct  485  LDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKVVDFNRPTNDVNLAALATDRIGKGKLEE  544

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L V  D      V  VAE+AFRC+A D+D RP   EVAAEL +IR
Sbjct  545  IIDPFLDVHNDNWTLSSVYKVAEVAFRCLAFDRDVRPSMIEVAAELDQIR  594



>ref|XP_011031029.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X1 
[Populus euphratica]
 ref|XP_011031039.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X2 
[Populus euphratica]
 ref|XP_011031047.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X3 
[Populus euphratica]
Length=686

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++K+DVYSFGVVL+E+IT  K +D +R + E+ LA + + KI  GLL +
Sbjct  485  LDPQYHQNFHLSDKTDVYSFGVVLIEIITAKKVLDFSRPQDEVNLASLAIDKIGRGLLDE  544

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP L +  +A     V  VAELAFRC+A  KD RP   EVAAEL +I
Sbjct  545  IIDPFLDLHSDAWTFSSVHKVAELAFRCLAFHKDIRPSMMEVAAELEQI  593



>gb|KCW64692.1| hypothetical protein EUGRSUZ_G02280 [Eucalyptus grandis]
Length=456

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 83/134 (62%), Gaps = 7/134 (5%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L EKSDVYSFGVVL+ELI+ M+AVD +R++ E+ LA++   KI+     +
Sbjct  284  VDPEYHQCYQLTEKSDVYSFGVVLVELISSMRAVDISRDRHEINLANLATSKIRNHEFRE  343

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L   +D E    + AVAELAFRC+  DKD RP    V  EL+ I      SG L 
Sbjct  344  LMDPNLGFELDPEINRMIMAVAELAFRCLQQDKDMRPSMETVLEELKAI-----SSGTLE  398

Query  355  TSNSSNAVVPDGAG  314
               S +    + AG
Sbjct  399  PDKSKDVSYDNSAG  412



>ref|XP_010415224.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Camelina sativa]
Length=707

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  543  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  602

Query  529  VLDPVLVVDG--EAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L  D   + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  603  LVDPSLGFDKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVD  662

Query  355  TSN  347
            +++
Sbjct  663  SAD  665



>ref|XP_010470565.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X5 [Camelina sativa]
Length=672

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  509  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  568

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  569  LVDPSLGFEKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  628

Query  355  T  353
            +
Sbjct  629  S  629



>ref|XP_010470566.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X6 [Camelina sativa]
Length=656

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  493  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  552

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  553  LVDPSLGFEKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  612

Query  355  T  353
            +
Sbjct  613  S  613



>ref|XP_006856200.1| hypothetical protein AMTR_s00059p00192290 [Amborella trichopoda]
 gb|ERN17667.1| hypothetical protein AMTR_s00059p00192290 [Amborella trichopoda]
Length=698

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+IT +K VD  R +SE+ LA + + KI  GL+ +
Sbjct  496  LDPQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFNRSQSEVNLAALAIDKIGKGLVDE  555

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L    +A     V  VAELAFRC+A  +D RP   EV+ EL +IR
Sbjct  556  IIDPFLEPHSDAWTLSSVHKVAELAFRCLAFHRDVRPSMMEVSTELDQIR  605



>ref|XP_010470564.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Camelina sativa]
Length=681

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  518  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  577

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  578  LVDPSLGFEKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  637

Query  355  T  353
            +
Sbjct  638  S  638



>ref|XP_006383414.1| hypothetical protein POPTR_0005s15270g [Populus trichocarpa]
 gb|ERP61211.1| hypothetical protein POPTR_0005s15270g [Populus trichocarpa]
Length=694

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L  KSDVYSFGVVL+ELI+ ++AVD  R + ++ L++M V KIQ   L++
Sbjct  532  VDPEYYQCYQLTNKSDVYSFGVVLIELISSLQAVDTNRHRHDINLSNMAVNKIQNHALNE  591

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            ++DP L  D +   +  V +VAELAFRC+  D++ RP   EV   L+RI     G+G
Sbjct  592  LVDPFLGFDKDIVVRRMVTSVAELAFRCLQQDREMRPAMEEVLEALKRIEKENYGAG  648



>ref|XP_010922240.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Elaeis guineensis]
Length=696

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y++ ++L +KSDVYSFGVVL+ELI+   AVD TR + E+ LA M + KIQ   L Q
Sbjct  536  LDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRHEINLASMAINKIQNCQLEQ  595

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP LV   D   K+ +  VAELAFRC+ +D D RP  +EV   LR I
Sbjct  596  LVDPDLVYQSDWAIKKTITMVAELAFRCLQSDGDMRPPIKEVLEVLREI  644



>ref|XP_010316317.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Solanum lycopersicum]
Length=684

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 89/141 (63%), Gaps = 12/141 (9%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ L++M V KIQ   +H+
Sbjct  539  VDPEYYQCYQLTEKSDVYSFGVVLVELISSLEAVDTNRHRHDINLSNMAVNKIQGHSIHE  598

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR---SRARGSG  365
            ++DP L    +   +     VAELAFRC+  ++D RP  +EV   LR I+   S+A  + 
Sbjct  599  LVDPTLGFSTNSSVRRMTTLVAELAFRCLQQERDLRPSMQEVLETLRGIQNGESKAHNAE  658

Query  364  VLRTSNSSNAVVPDGAGLIID  302
            VL        +V D AGL+ D
Sbjct  659  VLD-------IVVDDAGLLKD  672



>gb|KJB38887.1| hypothetical protein B456_007G1836001, partial [Gossypium raimondii]
Length=426

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 4/138 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ + L EKSDVYSFGVVL+ELI+  KAVD +R + ++ LA+M + +IQ   LH+
Sbjct  267  VDPEYHQCYHLTEKSDVYSFGVVLVELISAKKAVDISRHRHDINLANMAISRIQNQALHE  326

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV--  362
            ++DP L  + +   K  V AVA LAFRC+  ++D RP   EV   L  I+    GS V  
Sbjct  327  LVDPSLGFENDFVVKNTVTAVAGLAFRCLQQERDMRPSMEEVLEALEEIKGVRSGSDVVD  386

Query  361  LRTSNSSNAVVPDGAGLI  308
            +R+      +  D  GL+
Sbjct  387  IRSGTEVVDIKSDDVGLL  404



>ref|XP_009802454.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana sylvestris]
Length=693

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ LA+M V KIQ   +H+
Sbjct  549  VDPEYYQCYQLTEKSDVYSFGVVLIELISSLEAVDTNRHRQDINLANMAVNKIQTHSVHE  608

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    +   +     VAELAFRC+  ++D RP  +EV   LR I+S
Sbjct  609  LVDPSLGFTTNSSVRRMTTLVAELAFRCLQQERDMRPSMQEVLETLRGIQS  659



>ref|XP_010511591.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Camelina sativa]
Length=706

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 2/122 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  544  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  603

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  604  LVDPSLGFEKDLDVRREMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  663

Query  355  TS  350
            ++
Sbjct  664  ST  665



>gb|ACU23279.1| unknown [Glycine max]
Length=188

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y+++F L++KSDVYSFGVVL+E+IT MK VD  R +SE+ LA + V +I+ G +  
Sbjct  18   VDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEINLAALAVDRIKKGCIDD  77

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L    D      +  VAELAFRC+A   D RP   EVA EL  IR
Sbjct  78   IIDPFLEPHRDAWTLYSINKVAELAFRCLAFHSDMRPTMIEVAEELDLIR  127



>ref|XP_004232335.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Solanum lycopersicum]
Length=701

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 89/141 (63%), Gaps = 12/141 (9%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ L++M V KIQ   +H+
Sbjct  556  VDPEYYQCYQLTEKSDVYSFGVVLVELISSLEAVDTNRHRHDINLSNMAVNKIQGHSIHE  615

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR---SRARGSG  365
            ++DP L    +   +     VAELAFRC+  ++D RP  +EV   LR I+   S+A  + 
Sbjct  616  LVDPTLGFSTNSSVRRMTTLVAELAFRCLQQERDLRPSMQEVLETLRGIQNGESKAHNAE  675

Query  364  VLRTSNSSNAVVPDGAGLIID  302
            VL        +V D AGL+ D
Sbjct  676  VLD-------IVVDDAGLLKD  689



>ref|XP_004238203.1| PREDICTED: wall-associated receptor kinase-like 14 [Solanum lycopersicum]
Length=679

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F+L++KSDVYSFGVVL E+ITG+KAVD  R + E+ LA + + +I  G L +
Sbjct  489  LDPQYHQNFQLSDKSDVYSFGVVLAEIITGLKAVDFARPQDEINLAALAIDRIGKGNLDE  548

Query  529  VLDPV--LVVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP   L +D      +  VAELAFRC+A  +D RP   EVA EL ++R
Sbjct  549  IIDPFIELHMDAWTLSSIHRVAELAFRCLAFHRDMRPSMMEVAIELEQLR  598



>ref|XP_010316316.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Solanum lycopersicum]
Length=698

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 89/141 (63%), Gaps = 12/141 (9%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+ ++AVD  R + ++ L++M V KIQ   +H+
Sbjct  553  VDPEYYQCYQLTEKSDVYSFGVVLVELISSLEAVDTNRHRHDINLSNMAVNKIQGHSIHE  612

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR---SRARGSG  365
            ++DP L    +   +     VAELAFRC+  ++D RP  +EV   LR I+   S+A  + 
Sbjct  613  LVDPTLGFSTNSSVRRMTTLVAELAFRCLQQERDLRPSMQEVLETLRGIQNGESKAHNAE  672

Query  364  VLRTSNSSNAVVPDGAGLIID  302
            VL        +V D AGL+ D
Sbjct  673  VLD-------IVVDDAGLLKD  686



>gb|KCW83895.1| hypothetical protein EUGRSUZ_B00747 [Eucalyptus grandis]
 gb|KCW83896.1| hypothetical protein EUGRSUZ_B00747 [Eucalyptus grandis]
Length=324

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y + ++L EKSDVYSFGVVL+ELI+ + AVD TR + E+ L+ + + KIQ   LH+
Sbjct  199  IDPEYLQCYQLTEKSDVYSFGVVLMELISSLPAVDITRHRHEINLSALAINKIQSHALHE  258

Query  529  VLDPVLVVDGEAKEG--VGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP L  D + + G  + AVAEL F+C+    D RP   EV   L+ I++R 
Sbjct  259  LVDPNLGFDTDYRTGEMITAVAELGFQCLEQGHDMRPSMEEVLKTLKEIQNRG  311



>ref|XP_002442442.1| hypothetical protein SORBIDRAFT_08g020100 [Sorghum bicolor]
 gb|EES16280.1| hypothetical protein SORBIDRAFT_08g020100 [Sorghum bicolor]
Length=743

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+++F L++KSDVYSFGVVLLELIT MK VD  R  +E+ LA + + +I  G + +
Sbjct  562  VDPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFDRPPAEVNLASLALDRIGKGRVSE  621

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L+   E      V  V+ELAFRC+A  KD RP   EVAAEL RIR
Sbjct  622  IVDPALLAGDEDWVMGSVRLVSELAFRCLAFQKDVRPSMSEVAAELHRIR  671



>ref|XP_010470563.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Camelina sativa]
Length=707

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  544  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  603

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  604  LVDPSLGFEKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  663

Query  355  T  353
            +
Sbjct  664  S  664



>ref|XP_010470561.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Camelina sativa]
 ref|XP_010470562.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Camelina sativa]
Length=707

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL ELI+  +AVD TR + ++ LA+M V KIQ   LH+
Sbjct  544  VDPEYYQCYRLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHE  603

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L    D + +  + +VAELAFRC+  +++ RP   E+   L+ I+   +  GV+ 
Sbjct  604  LVDPSLGFEKDLDVRRKMMSVAELAFRCLQQEREVRPSMDEIVEILKGIKDGEKRVGVVE  663

Query  355  T  353
            +
Sbjct  664  S  664



>ref|XP_010922245.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Elaeis guineensis]
Length=657

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y++ ++L +KSDVYSFGVVL+ELI+   AVD TR + E+ LA M + KIQ   L Q
Sbjct  497  LDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRHEINLASMAINKIQNCQLEQ  556

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP LV   D   K+ +  VAELAFRC+ +D D RP  +EV   LR I
Sbjct  557  LVDPDLVYQSDWAIKKTITMVAELAFRCLQSDGDMRPPIKEVLEVLREI  605



>emb|CDY26166.1| BnaA06g12510D [Brassica napus]
Length=868

 Score =   108 bits (271),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 80/118 (68%), Gaps = 2/118 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DPDY+  ++L++KSDVYSF VVL+ELI+ + AVD TR + E+ L++M V KIQ   LH+
Sbjct  728  VDPDYHLCYQLSKKSDVYSFAVVLMELISSLPAVDITRTRQEINLSNMAVVKIQSHKLHE  787

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV  362
            ++DP L  D +   +E V AVAELAF+C+ +DKD RP    V   L +I +   GS +
Sbjct  788  MVDPSLGFDTDTRVRETVIAVAELAFQCLQSDKDLRPCMSHVMDTLTKIENNGFGSNM  845



>gb|KDO84381.1| hypothetical protein CISIN_1g007442mg [Citrus sinensis]
Length=603

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+IT +K VD +R  +E+ LA +   +I  G L +
Sbjct  431  LDPQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFSRPPNEVNLAALAADRISKGRLDE  490

Query  529  VLDPVLV-----VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP+++      D      V  VAELAFRC+A  +D RP   EVA EL  IR+R 
Sbjct  491  IIDPLIIEHRGHSDAGTLASVHKVAELAFRCLAFHRDMRPSMTEVATELEHIRTRT  546



>ref|XP_010922253.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Elaeis guineensis]
Length=647

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y++ ++L +KSDVYSFGVVL+ELI+   AVD TR + E+ LA M + KIQ   L Q
Sbjct  487  LDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRHEINLASMAINKIQNCQLEQ  546

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP LV   D   K+ +  VAELAFRC+ +D D RP  +EV   LR I
Sbjct  547  LVDPDLVYQSDWAIKKTITMVAELAFRCLQSDGDMRPPIKEVLEVLREI  595



>ref|XP_011021278.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Populus euphratica]
Length=694

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L  KSDVYSFGVVL+ELI+ ++AVD  R + ++ L++M V KIQ   L++
Sbjct  532  VDPEYYQCYQLTNKSDVYSFGVVLIELISSLQAVDTNRHRHDINLSNMAVNKIQNHALNE  591

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            ++DP L  D +   +  V +VAELAFRC+  D++ RP   EV   L+RI     G+G
Sbjct  592  LVDPSLGFDKDIVVRRMVTSVAELAFRCLQQDREMRPAMEEVLEALKRIEKENYGAG  648



>ref|XP_002968448.1| hypothetical protein SELMODRAFT_89809, partial [Selaginella moellendorffii]
 ref|XP_002970614.1| hypothetical protein SELMODRAFT_93241, partial [Selaginella moellendorffii]
 gb|EFJ28744.1| hypothetical protein SELMODRAFT_93241, partial [Selaginella moellendorffii]
 gb|EFJ30702.1| hypothetical protein SELMODRAFT_89809, partial [Selaginella moellendorffii]
Length=341

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY++S++L +KSDVYS GVVL+EL++  +AVD  RE+ E+ LA + V +IQ G L +
Sbjct  180  LDPDYHQSYQLTDKSDVYSLGVVLMELVSSQRAVDMARERKEINLAALAVSRIQCGELDK  239

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRAR  374
            ++DP L    D   +  V  VAEL F C+A +K+DRP  ++VAA LR I    +
Sbjct  240  LVDPRLGAGEDSVRQRMVECVAELGFECLATEKEDRPCMKDVAARLRAIEEEGK  293



>ref|NP_001167990.1| uncharacterized LOC100381711 precursor [Zea mays]
 gb|ACN26749.1| unknown [Zea mays]
 gb|AFW79985.1| putative WAK receptor-like protein kinase family protein [Zea 
mays]
Length=644

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y++ ++L EKSDVYSFGVVL+EL++   AVD  R  SE+ LA+M + +IQ   + Q
Sbjct  481  VDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQ  540

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    DGE K  +  VAELAFRC+  ++D RP  +EV   L RIR+
Sbjct  541  LVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIRN  591



>ref|XP_006473409.1| PREDICTED: wall-associated receptor kinase-like 14-like [Citrus 
sinensis]
Length=674

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+IT +K VD +R  +E+ LA +   +I  G L +
Sbjct  502  LDPQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFSRPPNEVNLAALAADRISKGRLDE  561

Query  529  VLDPVLV-----VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP+++      D      V  VAELAFRC+A  +D RP   EVA EL  IR+R 
Sbjct  562  IIDPLIIEHRGHSDAGTLASVHKVAELAFRCLAFHRDMRPSMTEVATELEHIRTRT  617



>ref|XP_002516765.1| wall-associated kinase, putative [Ricinus communis]
 gb|EEF45663.1| wall-associated kinase, putative [Ricinus communis]
Length=685

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L +KSDVYSFGVVL+ELI+ ++AVD  R + ++ LA+M V KIQ   +++
Sbjct  524  VDPEYYQCYQLTDKSDVYSFGVVLVELISSLQAVDTNRHRLDINLANMAVNKIQNHAINE  583

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP+L  D +   ++   +VAELAFRC+  +KD RP   EV   L++I S   GS
Sbjct  584  LVDPMLGYDKDYAVRKMTTSVAELAFRCLQQEKDMRPTMAEVLEALKKIESEDYGS  639



>ref|XP_006434895.1| hypothetical protein CICLE_v10000511mg [Citrus clementina]
 gb|ESR48135.1| hypothetical protein CICLE_v10000511mg [Citrus clementina]
Length=673

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+IT +K VD +R  +E+ LA +   +I  G L +
Sbjct  501  LDPQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFSRPPNEVNLAALAADRISKGRLDE  560

Query  529  VLDPVLV-----VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRA  377
            ++DP+++      D      V  VAELAFRC+A  +D RP   EVA EL  IR+R 
Sbjct  561  IIDPLIIEHRGHSDAGTLASVHKVAELAFRCLAFHRDMRPSMTEVATELEHIRTRT  616



>ref|XP_009108191.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Brassica rapa]
Length=668

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 80/119 (67%), Gaps = 2/119 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ +RLNEKSDVYSFGVVL+ELI+  +AVD TR+  ++ LA M V KIQ   LH+
Sbjct  511  VDPEYFQCYRLNEKSDVYSFGVVLIELISSKEAVDITRKSHDVNLAKMAVAKIQSNALHE  570

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVL  359
            ++DP L    D E +  + +VAELAFRC+  +++ RP   E+   LR I+    G  V+
Sbjct  571  LVDPSLGFEKDPEVRRKMMSVAELAFRCLQHEREMRPTMDEILKILRGIKEEQIGQDVV  629



>gb|AEW07681.1| hypothetical protein 0_8683_01, partial [Pinus radiata]
 gb|AFG66663.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66664.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66665.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66666.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66668.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66669.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66671.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66672.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66677.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66679.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
Length=147

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+  F+L EKSDVYSFGVVL+E+I+   AVD  R++ E+ LA M + KIQ G LH+
Sbjct  50   VDPEYHECFQLTEKSDVYSFGVVLVEIISAKLAVDINRKRGEINLAFMAMSKIQEGALHE  109

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRP  425
            ++DP L +  + + +  V AVAEL FRC+A++ DDRP
Sbjct  110  LVDPQLEIEKNDQVEAMVSAVAELIFRCLASEGDDRP  146



>ref|XP_009394439.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Musa acuminata subsp. malaccensis]
Length=354

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y++ F+L +KSDVYSFGVVL ELIT   AVD TR +SE+ LA+M + +IQ G L Q
Sbjct  196  LDPEYHQCFQLTDKSDVYSFGVVLFELITSKPAVDMTRNRSEINLANMAITRIQRGELEQ  255

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++D  L    D   ++ +  VAE+AFRC+ +D D RP  +EV   L+ I S
Sbjct  256  LVDAALGYQSDEVTRKMITMVAEVAFRCLQSDGDMRPPIKEVLEVLQAIES  306



>gb|AES75438.2| wall associated kinase-like protein [Medicago truncatula]
Length=635

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 81/127 (64%), Gaps = 2/127 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y + ++L  KSDVYSFGVV++ELI+ + AVD TR + ++ L+ M + KIQ   LH+
Sbjct  478  VDPEYNQFYQLTHKSDVYSFGVVMIELISSLPAVDMTRHRDDINLSTMAMNKIQNQALHE  537

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L  D ++  KE +  VAELAFRC+ + KD RP   EV   L+ I+          
Sbjct  538  LVDPTLGYDSDSKVKEMINDVAELAFRCLQSSKDMRPCMDEVLKTLQDIQGAGANESQRE  597

Query  355  TSNSSNA  335
            T+N SN+
Sbjct  598  TANISNS  604



>ref|XP_007033202.1| Kinase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY04128.1| Kinase family protein, putative isoform 1 [Theobroma cacao]
Length=992

 Score =   108 bits (270),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 74/110 (67%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ ++L EKSDVYSFGVVL+ELI+  +AVD  R + ++ LA+M V +IQ   LH+
Sbjct  824  VDPEYYQCYQLTEKSDVYSFGVVLIELISSKQAVDTNRHRLDINLANMAVSRIQNHALHE  883

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L    D   K  +  VAELAFRC+  ++D RP   EV   LR IR
Sbjct  884  LVDPSLGFEDDYAVKTRMTGVAELAFRCLQQERDVRPSMEEVLETLRGIR  933



>ref|XP_007139177.1| hypothetical protein PHAVU_008G007900g [Phaseolus vulgaris]
 gb|ESW11171.1| hypothetical protein PHAVU_008G007900g [Phaseolus vulgaris]
Length=683

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L  KSDVYSFGVVL+ELI+ ++AVD  R +S++ LA+M V +IQ   LH+
Sbjct  525  VDPEYHQCYQLTYKSDVYSFGVVLVELISSLQAVDINRNRSDVNLANMFVKRIQNQELHE  584

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            ++DP L    D   +  + AVAELAFRC+  ++D RP   EV   LR I+    G+G
Sbjct  585  LIDPCLGFEKDDATRRMITAVAELAFRCLQQERDMRPSMNEVVEILRGIKRGGVGAG  641



>gb|AFG66675.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66676.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
Length=147

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+  F+L EKSDVYSFGVVL+E+I+   AVD  R++ E+ LA M   KIQ G LH+
Sbjct  50   VDPEYHECFQLTEKSDVYSFGVVLVEIISAKLAVDINRKRGEINLAFMATSKIQEGALHE  109

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRP  425
            ++DP L +  + + +  V AVAEL FRC+A++ DDRP
Sbjct  110  LVDPQLEIEKNDQVEAMVSAVAELIFRCLASEGDDRP  146



>ref|XP_003619220.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
Length=624

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 81/127 (64%), Gaps = 2/127 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y + ++L  KSDVYSFGVV++ELI+ + AVD TR + ++ L+ M + KIQ   LH+
Sbjct  467  VDPEYNQFYQLTHKSDVYSFGVVMIELISSLPAVDMTRHRDDINLSTMAMNKIQNQALHE  526

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L  D ++  KE +  VAELAFRC+ + KD RP   EV   L+ I+          
Sbjct  527  LVDPTLGYDSDSKVKEMINDVAELAFRCLQSSKDMRPCMDEVLKTLQDIQGAGANESQRE  586

Query  355  TSNSSNA  335
            T+N SN+
Sbjct  587  TANISNS  593



>ref|XP_003592617.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
Length=714

 Score =   107 bits (268),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+Y++ ++L+EKSDVYSFGVVL+ELI+ M  +D  RE+ E+ LA++   KI+ G + +
Sbjct  544  LDPEYFQLYKLSEKSDVYSFGVVLIELISSMTVIDSAREREEVNLANLAAKKIRNGAVGE  603

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP L    D E    V +VAELAF+CV  D + RP   EV  EL++I
Sbjct  604  LVDPSLGFESDSEVNRMVTSVAELAFQCVLGDMELRPSMDEVLQELKKI  652



>gb|AFG66662.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66667.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66673.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
 gb|AFG66678.1| hypothetical protein 0_8683_01, partial [Pinus taeda]
Length=147

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y+  F+L EKSDVYSFGVVL+E+I+   AVD  R++ E+ LA M   KIQ G LH+
Sbjct  50   VDPEYHECFQLTEKSDVYSFGVVLVEIISAKLAVDINRKRGEINLAVMATSKIQEGALHE  109

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRP  425
            ++DP L +  + + +  V AVAEL FRC+A++ DDRP
Sbjct  110  LVDPQLEIEKNDQVEAMVSAVAELIFRCLASEGDDRP  146



>gb|KHN22281.1| Wall-associated receptor kinase-like 14 [Glycine soja]
Length=629

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y++ F L++KSDVYS GVVL+E+ITG+K VD +R  +E+ LA +   KI  GLL++
Sbjct  424  VDPQYHQDFHLSDKSDVYSLGVVLVEIITGLKVVDFSRPHNEVNLASLAADKIGKGLLNE  483

Query  529  VLDPVLV----VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L      D      +  VAELAFRC+A  +D RP   EVA+EL ++R
Sbjct  484  IIDPFLEPEVRSDAWTLSSIHKVAELAFRCIAFHRDMRPSMTEVASELEQLR  535



>ref|XP_003527703.1| PREDICTED: wall-associated receptor kinase-like 14-like [Glycine 
max]
Length=709

 Score =   107 bits (268),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y++ F L++KSDVYS GVVL+E+ITG+K VD +R  +E+ LA +   KI  GLL++
Sbjct  504  VDPQYHQDFHLSDKSDVYSLGVVLVEIITGLKVVDFSRPHNEVNLASLAADKIGKGLLNE  563

Query  529  VLDPVLV----VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L      D      +  VAELAFRC+A  +D RP   EVA+EL ++R
Sbjct  564  IIDPFLEPEVRSDAWTLSSIHKVAELAFRCIAFHRDMRPSMTEVASELEQLR  615



>ref|XP_003611850.1| Kinase-like protein [Medicago truncatula]
 gb|AES94808.1| wall associated kinase-like protein [Medicago truncatula]
Length=700

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y+++F L++KSDVYSFGVVL+E+IT MK VD  R +SE+ LA + V +I+ G + +
Sbjct  497  VDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFGRPQSEINLAALAVDRIRRGSVDE  556

Query  529  VLDPVLVVDGEAKE--GVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGS  368
            ++DP L  + +A     +  VAELAFRC+A   D RP   EVA EL  IR RA  +
Sbjct  557  IVDPFLEPNRDAWTLYSIHKVAELAFRCLAFHSDTRPTMMEVAEELEYIRRRAWAT  612



>gb|EEC76354.1| hypothetical protein OsI_13937 [Oryza sativa Indica Group]
Length=459

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDPDY+RSF+L EKSDVYSFGVV+LEL+TG++ VD  RE+ ++TLAD VV KIQ+G L +
Sbjct  278  LDPDYHRSFQLTEKSDVYSFGVVVLELVTGLRPVDVGRERRDVTLADWVVAKIQVGELRE  337

Query  529  VLD-PVLVVDGEAKEGVGAVAELAFRCV  449
            V+D PVL         V AVAELAFRCV
Sbjct  338  VVDQPVLGEGAGVMASVEAVAELAFRCV  365



>gb|KDP35040.1| hypothetical protein JCGZ_09328 [Jatropha curcas]
Length=607

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY  ++L +KSDVYSFGVVL+ELI+ M AVD TR + E+ LA++ + +IQ     +
Sbjct  486  VDPEYYHCYQLTDKSDVYSFGVVLVELISSMPAVDITRHRQEINLANLALNRIQRCAFDE  545

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
            ++DP L    D E K    +VAELAF C+  DK+ RP   EV  EL+RI SR
Sbjct  546  LIDPNLGYQSDEEVKRMTTSVAELAFLCLQQDKEMRPPMDEVLEELKRIESR  597



>ref|XP_009412515.1| PREDICTED: wall-associated receptor kinase-like 14 [Musa acuminata 
subsp. malaccensis]
Length=693

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y+++F L++KSDVYS+GVVL+E+IT MK VD  R  SE+ LA +   KI  GL+  
Sbjct  514  VDPQYHQNFHLSDKSDVYSYGVVLVEMITAMKVVDFRRAASEVNLASLAADKIGKGLVED  573

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRI  389
            ++DP++    +G+ +  V  VAELAFRC+A  +D RP   EVA EL +I
Sbjct  574  IVDPIIKENWNGQTRASVQKVAELAFRCLAFHRDARPSMAEVAEELEKI  622



>gb|AES62863.2| wall associated kinase-like protein [Medicago truncatula]
Length=639

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ +RL  KSDVYSFGVVL+ELI+ M AVD +R+K E+ LA++ + KIQ   +H+
Sbjct  456  MDPEYHQCYRLTSKSDVYSFGVVLVELISSMPAVDMSRDKDEINLANLAIRKIQKSKIHE  515

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    D + K  +  +AELAF+C+  DK+ RP   EV   LRRI S
Sbjct  516  LVDPSLGFESDKDVKRKIVLIAELAFQCLQRDKELRPSMDEVLDVLRRIDS  566



>gb|KJB38886.1| hypothetical protein B456_007G1836001 [Gossypium raimondii]
Length=505

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 4/138 (3%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ + L EKSDVYSFGVVL+ELI+  KAVD +R + ++ LA+M + +IQ   LH+
Sbjct  346  VDPEYHQCYHLTEKSDVYSFGVVLVELISAKKAVDISRHRHDINLANMAISRIQNQALHE  405

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGV--  362
            ++DP L  + +   K  V AVA LAFRC+  ++D RP   EV   L  I+    GS V  
Sbjct  406  LVDPSLGFENDFVVKNTVTAVAGLAFRCLQQERDMRPSMEEVLEALEEIKGVRSGSDVVD  465

Query  361  LRTSNSSNAVVPDGAGLI  308
            +R+      +  D  GL+
Sbjct  466  IRSGTEVVDIKSDDVGLL  483



>ref|XP_009616014.1| PREDICTED: wall-associated receptor kinase-like 14 [Nicotiana 
tomentosiformis]
Length=683

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F+L++KSDVYSFGVVL E+ITG+KAVD  R + E+ LA + + +I  G L +
Sbjct  492  LDPQYHQNFQLSDKSDVYSFGVVLAEIITGLKAVDFARPQDEINLAALAIDRIGKGNLDE  551

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            V+DP +   +D      V  VAELAFRC+A  +D RP   EVA EL ++R
Sbjct  552  VIDPSIEPHMDAWTLSSVHKVAELAFRCLAFHRDMRPSMMEVAIELEQLR  601



>ref|XP_011083766.1| PREDICTED: wall-associated receptor kinase-like 14 [Sesamum indicum]
Length=684

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYSFGVVL+E+IT +K VD +R ++E+ LA + V +I  G L +
Sbjct  491  LDPQYHQHFHLSDKSDVYSFGVVLIEIITALKVVDFSRPQNEVNLAALAVDRIGRGHLDE  550

Query  529  VLDPVLVVDGEAKE--GVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L    +A     V  VAELAFRC+A  KD RP   EVA EL +IR
Sbjct  551  IIDPFLETTDDAWTLLSVQKVAELAFRCLAFHKDMRPSMMEVAIELEQIR  600



>ref|XP_009794572.1| PREDICTED: wall-associated receptor kinase-like 14 [Nicotiana 
sylvestris]
Length=682

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F+L++KSDVYSFGVVL E+ITG+KAVD  R + E+ LA + + +I  G L +
Sbjct  492  LDPQYHQNFQLSDKSDVYSFGVVLAEIITGLKAVDFARPQDEINLAALAIDRIGKGNLDE  551

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            V+DP +   +D      V  VAELAFRC+A  +D RP   EVA EL ++R
Sbjct  552  VIDPSIEPHMDAWTLSSVHKVAELAFRCLAFHRDMRPSMMEVAIELEQLR  601



>ref|XP_003619214.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES75432.1| wall-associated kinase-like protein [Medicago truncatula]
Length=652

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP+YY    L  KSDVYSFGVV++ELI+ + AVD TR + ++ L+ M + KIQ   LH+
Sbjct  499  LDPEYYAHSHLTHKSDVYSFGVVMIELISSLPAVDMTRPRDDINLSTMAMNKIQNQALHE  558

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSGVLR  356
            ++DP L  D + K  E + AVAELAFRC+   KD RP   EV   L+ I+          
Sbjct  559  LVDPSLGFDTDLKVNEMINAVAELAFRCLQISKDMRPRMDEVFKTLQDIQGAGANESQCE  618

Query  355  TSNSSNA  335
             +N SN+
Sbjct  619  AANISNS  625



>ref|XP_008240314.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Prunus mume]
Length=838

 Score =   107 bits (268),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y + ++L  KSDVYSFGVV++ELI+ + AVD TR + E+ L++M + KIQ   LH+
Sbjct  680  VDPEYNQCYQLTSKSDVYSFGVVMIELISSLPAVDITRHRHEINLSNMAINKIQNHALHE  739

Query  529  VLDPVLVVDGE--AKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
            ++D  L  + +   ++ + AVAELAFRC+ +DKD RP   +V  EL+RI+S+
Sbjct  740  LVDTCLGFESDYRIRKMIIAVAELAFRCLQSDKDVRPSMPDVLDELKRIQSK  791



>ref|XP_008220730.1| PREDICTED: wall-associated receptor kinase-like 14 [Prunus mume]
Length=707

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+ITG+KAVD  R ++E+ LA +   +I  G L++
Sbjct  505  LDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFNRPQNEVNLAALATDRIGRGCLNE  564

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L   +D      V  V ELAFRC+A  +D RP   EV AEL  I+
Sbjct  565  IIDPFLEPHMDAWTLLSVHKVGELAFRCLAFHRDMRPSMMEVTAELELIK  614



>emb|CDY52892.1| BnaC06g27850D [Brassica napus]
Length=697

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+YY+ +RLNEKSDVYSFGVVL E+I+  +AVD TR + ++ LA+M V KIQ   +H+
Sbjct  538  VDPEYYQCYRLNEKSDVYSFGVVLTEIISSKEAVDITRHRHDVNLANMAVSKIQNNAVHE  597

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP L    D E K  + +VAELAFRC+  +++ RP   E+   L+ I+
Sbjct  598  LVDPSLGFEKDPEVKRMMVSVAELAFRCLQQEREARPSMDEIMEILKGIK  647



>ref|XP_010908096.1| PREDICTED: wall-associated receptor kinase-like 14 [Elaeis guineensis]
Length=648

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y++ F L++KSDVYS GVVL+E+ITGMK VD  R  +E+ LA + V +I  G + +
Sbjct  487  LDPQYHQDFHLSDKSDVYSLGVVLVEMITGMKVVDFGRAPTEVNLAALAVDRIGKGRIEE  546

Query  529  VLDPVLVVDGEAKEGVG--AVAELAFRCVAADKDDRPDAREVAAEL  398
            ++DPV+ VDG+    V    VAELAFRC+A  KD RP  +EVA EL
Sbjct  547  IIDPVIKVDGDEWTLVSIRKVAELAFRCLAFHKDVRPSMKEVAEEL  592



>gb|ACN33695.1| unknown [Zea mays]
 gb|AFW79986.1| putative WAK receptor-like protein kinase family protein [Zea 
mays]
Length=654

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP Y++ ++L EKSDVYSFGVVL+EL++   AVD  R  SE+ LA+M + +IQ   + Q
Sbjct  491  VDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNHEVGQ  550

Query  529  VLDPVLV--VDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L    DGE K  +  VAELAFRC+  ++D RP  +EV   L RIR+
Sbjct  551  LVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIRN  601



>ref|XP_004160450.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cucumis sativus]
Length=668

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L++KSDV+SFGVVL+ELI+ M AVD TR + E+ L +M + KIQ   LH+
Sbjct  508  VDPEYHQCYQLSDKSDVFSFGVVLVELISSMPAVDITRHRQEINLFNMAINKIQNSTLHE  567

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
             +DP L  + + K  E + +VAELAFRC+ + KD+RP   EV   L  I+ +
Sbjct  568  FVDPSLGFESDYKIQEMITSVAELAFRCLQSMKDERPTMMEVLDTLNIIKKQ  619



>ref|XP_007226546.1| hypothetical protein PRUPE_ppa024936mg, partial [Prunus persica]
 gb|EMJ27745.1| hypothetical protein PRUPE_ppa024936mg, partial [Prunus persica]
Length=663

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            LDP Y+++F L++KSDVYSFGVVL+E+ITG+KAVD  R ++E+ LA +   +I  G L++
Sbjct  461  LDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFKRPQNEVNLAALATDRIGRGCLNE  520

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIR  386
            ++DP+L   +D      V  V ELAFRC+A  +D RP   EV AEL  I+
Sbjct  521  IIDPLLEPHMDAWTLLSVHKVGELAFRCLAFHRDMRPSMMEVTAELELIK  570



>ref|XP_007139178.1| hypothetical protein PHAVU_008G007900g [Phaseolus vulgaris]
 gb|ESW11172.1| hypothetical protein PHAVU_008G007900g [Phaseolus vulgaris]
Length=675

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L  KSDVYSFGVVL+ELI+ ++AVD  R +S++ LA+M V +IQ   LH+
Sbjct  517  VDPEYHQCYQLTYKSDVYSFGVVLVELISSLQAVDINRNRSDVNLANMFVKRIQNQELHE  576

Query  529  VLDPVLVV--DGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSRARGSG  365
            ++DP L    D   +  + AVAELAFRC+  ++D RP   EV   LR I+    G+G
Sbjct  577  LIDPCLGFEKDDATRRMITAVAELAFRCLQQERDMRPSMNEVVEILRGIKRGGVGAG  633



>gb|KHN12475.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=651

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y   ++L +KSDVYSFGVVL+ELI+ M AVD +R + E+ L++M + KIQ G LH+
Sbjct  494  VDPEYNEYYQLTDKSDVYSFGVVLIELISSMPAVDISRRRHEINLSNMAIKKIQSGALHE  553

Query  529  VLDPVL--VVDGEAKEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++D  L    D + ++ + AVAELAF+C+ + KD RP   EV   L  IRS
Sbjct  554  IVDTTLGFETDFKVRKMISAVAELAFQCLQSSKDVRPSMAEVLDRLEDIRS  604



>ref|XP_004137545.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cucumis sativus]
Length=668

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ ++L++KSDV+SFGVVL+ELI+ M AVD TR + E+ L +M + KIQ   LH+
Sbjct  508  VDPEYHQCYQLSDKSDVFSFGVVLVELISSMPAVDITRHRQEINLFNMAINKIQNSTLHE  567

Query  529  VLDPVLVVDGEAK--EGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRSR  380
             +DP L  + + K  E + +VAELAFRC+ + KD+RP   EV   L  I+ +
Sbjct  568  FVDPSLGFESDYKIQEMITSVAELAFRCLQSMKDERPTMMEVLDTLNIIKKQ  619



>ref|XP_004497060.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cicer arietinum]
Length=656

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = -1

Query  709  LDPDYYRSFRLNEKSDVYSFGVVLLELITGMKAVDQTREKSEMTLADMVVPKIQMGLLHQ  530
            +DP+Y++ +RL  KSDVYSFGVVL+ELI+ M AVD +R+K E+ LA++ + KIQ   + +
Sbjct  472  MDPEYHQCYRLTSKSDVYSFGVVLVELISSMPAVDMSRDKDEINLANLAIRKIQKSAISE  531

Query  529  VLDPVLVVDGEA--KEGVGAVAELAFRCVAADKDDRPDAREVAAELRRIRS  383
            ++DP L  D ++  K  + ++AELAF+C+  DK+ RP   EV   LRRI S
Sbjct  532  LVDPSLGFDSDSDVKRKIVSIAELAFQCLQRDKELRPSMDEVLEVLRRIDS  582



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365