BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047A21

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009759105.1|  PREDICTED: uncharacterized protein LOC104211710  62.8    4e-08   Nicotiana sylvestris
ref|XP_009594282.1|  PREDICTED: ATP-dependent RNA helicase A-like...  57.4    3e-06   
ref|XP_009594283.1|  PREDICTED: ATP-dependent RNA helicase A-like...  53.9    5e-05   



>ref|XP_009759105.1| PREDICTED: uncharacterized protein LOC104211710 [Nicotiana sylvestris]
Length=429

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 84/158 (53%), Gaps = 7/158 (4%)
 Frame = -2

Query  692  IGVQYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQG  513
            I +Q QQKEEE +SS GN T+   +S V+++ QG  G E+LS LP E E V  E EGV  
Sbjct  270  IAMQSQQKEEECLSSQGNHTNEMHASTVEEIQQGVQG-ENLSELPAEAEEVTPEAEGVNN  328

Query  512  DHHKDVKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvgGAYQNGRSHYSDQ  333
                + KEQQ++P R  + N        G  G   G        G  G+YQNGR+ Y DQ
Sbjct  329  LKDMNFKEQQSVP-RRSYQNQNYRGHHNGDGGGRRGYSNAHGGHGREGSYQNGRNQYYDQ  387

Query  332  PSNYVPR--NSHFrgrggrgG---HYNNHPPGAQVGNY  234
              NY  +  N+++R R GRG    +YN H  G Q  N+
Sbjct  388  SGNYYQKSHNNNYRERCGRGTVGGNYNPHASGGQAANF  425



>ref|XP_009594282.1| PREDICTED: ATP-dependent RNA helicase A-like protein isoform 
X1 [Nicotiana tomentosiformis]
Length=425

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 6/75 (8%)
 Frame = -2

Query  692  IGVQYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQG  513
            I +Q Q KEEE +SS GN+T+  Q+S V ++ QGE G E+LS LP E E V  E EG   
Sbjct  270  IAIQSQHKEEECLSSQGNDTNGIQASSV-EVQQGEQG-ENLSELPAEVEEVTPEAEG--D  325

Query  512  DHHKDV--KEQQNIP  474
            D+ KD+  KEQQ++P
Sbjct  326  DNLKDMNFKEQQSVP  340



>ref|XP_009594283.1| PREDICTED: ATP-dependent RNA helicase A-like protein isoform 
X2 [Nicotiana tomentosiformis]
Length=422

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 9/75 (12%)
 Frame = -2

Query  692  IGVQYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQG  513
            I +Q Q KEEE +SS GN+T+  Q+S V ++ QG    E+LS LP E E V  E EG   
Sbjct  270  IAIQSQHKEEECLSSQGNDTNGIQASSV-EVQQG----ENLSELPAEVEEVTPEAEG--D  322

Query  512  DHHKDV--KEQQNIP  474
            D+ KD+  KEQQ++P
Sbjct  323  DNLKDMNFKEQQSVP  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485