BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF047A09

Length=257
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008349859.1|  PREDICTED: NAD(H) kinase 1-like                    171   6e-51   
gb|ACU17681.1|  unknown                                                 168   6e-50   Glycine max [soybeans]
ref|XP_008227337.1|  PREDICTED: NAD(H) kinase 1 isoform X3              172   3e-49   Prunus mume [ume]
gb|AFN88238.1|  NADH kinase                                             167   4e-49   Vigna luteola
ref|XP_008227336.1|  PREDICTED: NAD(H) kinase 1 isoform X2              173   4e-49   Prunus mume [ume]
gb|KHN20637.1|  NAD(H) kinase 1                                         172   4e-49   Glycine soja [wild soybean]
gb|KHN05513.1|  NAD(H) kinase 1                                         172   4e-49   Glycine soja [wild soybean]
ref|XP_008227335.1|  PREDICTED: NAD(H) kinase 1 isoform X1              173   4e-49   Prunus mume [ume]
ref|XP_009374927.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         173   4e-49   
ref|XP_009366085.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         172   6e-49   Pyrus x bretschneideri [bai li]
ref|XP_009374926.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         173   6e-49   
ref|XP_003540253.1|  PREDICTED: NAD(H) kinase 1-like                    172   1e-48   Glycine max [soybeans]
ref|XP_008363346.1|  PREDICTED: NAD(H) kinase 1 isoform X2              172   1e-48   
ref|XP_003537731.1|  PREDICTED: NAD(H) kinase 1                         172   1e-48   Glycine max [soybeans]
ref|XP_011459496.1|  PREDICTED: NAD(H) kinase 1                         172   1e-48   Fragaria vesca subsp. vesca
ref|XP_008363343.1|  PREDICTED: NAD(H) kinase 1 isoform X1              172   1e-48   
ref|XP_009366086.1|  PREDICTED: probable NAD kinase 1 isoform X3        171   1e-48   
ref|XP_011080363.1|  PREDICTED: NAD(H) kinase 1                         171   1e-48   Sesamum indicum [beniseed]
ref|XP_009366084.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         172   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_007214444.1|  hypothetical protein PRUPE_ppa024717mg             169   2e-48   
gb|AFS49950.1|  NADH kinase                                             171   2e-48   Vigna luteola
emb|CDP09273.1|  unnamed protein product                                170   4e-48   Coffea canephora [robusta coffee]
gb|EPS71079.1|  hypothetical protein M569_03679                         170   5e-48   Genlisea aurea
ref|XP_007131550.1|  hypothetical protein PHAVU_011G022700g             169   5e-48   Phaseolus vulgaris [French bean]
ref|XP_006446153.1|  hypothetical protein CICLE_v10014881mg             167   6e-48   
gb|EYU46237.1|  hypothetical protein MIMGU_mgv1a004572mg                170   6e-48   Erythranthe guttata [common monkey flower]
ref|XP_007131551.1|  hypothetical protein PHAVU_011G022700g             169   1e-47   Phaseolus vulgaris [French bean]
ref|XP_002513516.1|  poly(p)/ATP NAD kinase, putative                   168   2e-47   Ricinus communis
ref|XP_004505640.1|  PREDICTED: NAD(H) kinase 1-like                    168   3e-47   Cicer arietinum [garbanzo]
ref|XP_011032051.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         168   3e-47   Populus euphratica
ref|XP_002314082.2|  ATP-NAD kinase family protein                      168   3e-47   Populus trichocarpa [western balsam poplar]
dbj|BAK22410.1|  NAD kinase                                             163   4e-47   Nicotiana benthamiana
ref|XP_011032050.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         168   4e-47   Populus euphratica
ref|XP_006446154.1|  hypothetical protein CICLE_v10014881mg             167   5e-47   
ref|XP_010246729.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         167   7e-47   Nelumbo nucifera [Indian lotus]
gb|KJB55385.1|  hypothetical protein B456_009G073700                    164   1e-46   Gossypium raimondii
gb|KJB55387.1|  hypothetical protein B456_009G073700                    166   1e-46   Gossypium raimondii
ref|XP_010651218.1|  PREDICTED: NAD(H) kinase 1 isoform X2              167   1e-46   Vitis vinifera
ref|XP_010651217.1|  PREDICTED: NAD(H) kinase 1 isoform X1              167   1e-46   Vitis vinifera
ref|XP_010246730.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         166   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_002285357.1|  PREDICTED: NAD(H) kinase 1 isoform X3              166   1e-46   Vitis vinifera
ref|XP_010269768.1|  PREDICTED: probable NAD kinase 1 isoform X4        165   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_004228514.1|  PREDICTED: NAD(H) kinase 1                         166   1e-46   Solanum lycopersicum
ref|XP_006470640.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         167   1e-46   Citrus sinensis [apfelsine]
ref|XP_006365622.1|  PREDICTED: probable NAD kinase 1-like              166   2e-46   Solanum tuberosum [potatoes]
gb|KJB55384.1|  hypothetical protein B456_009G073700                    164   2e-46   Gossypium raimondii
ref|XP_009775830.1|  PREDICTED: NAD(H) kinase 1                         166   2e-46   Nicotiana sylvestris
ref|XP_006470641.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         166   2e-46   Citrus sinensis [apfelsine]
ref|XP_002885418.1|  hypothetical protein ARALYDRAFT_342253             166   2e-46   
ref|XP_010651223.1|  PREDICTED: NAD(H) kinase 1 isoform X4              165   2e-46   Vitis vinifera
emb|CAN64916.1|  hypothetical protein VITISV_023722                     166   2e-46   Vitis vinifera
ref|XP_009618540.1|  PREDICTED: NAD(H) kinase 1                         166   2e-46   Nicotiana tomentosiformis
gb|KJB35761.1|  hypothetical protein B456_006G127100                    165   2e-46   Gossypium raimondii
gb|KJB35763.1|  hypothetical protein B456_006G127100                    164   2e-46   Gossypium raimondii
gb|KFK39415.1|  hypothetical protein AALP_AA3G241900                    165   3e-46   Arabis alpina [alpine rockcress]
ref|XP_010269765.1|  PREDICTED: putative NAD kinase 3 isoform X1        165   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_004139039.1|  PREDICTED: NAD(H) kinase 1-like                    165   4e-46   Cucumis sativus [cucumbers]
ref|XP_007015105.1|  NAD(H) kinase 1 isoform 4                          164   4e-46   
ref|XP_010509651.1|  PREDICTED: NAD(H) kinase 1-like                    165   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008450412.1|  PREDICTED: NAD(H) kinase 1                         165   4e-46   Cucumis melo [Oriental melon]
ref|XP_010488093.1|  PREDICTED: NAD(H) kinase 1                         165   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010673682.1|  PREDICTED: NAD(H) kinase 1                         165   4e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010269767.1|  PREDICTED: putative NAD kinase 3 isoform X3        165   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010269766.1|  PREDICTED: putative NAD kinase 3 isoform X2        165   5e-46   Nelumbo nucifera [Indian lotus]
ref|XP_007015104.1|  NAD kinase 1 isoform 3                             163   5e-46   
ref|XP_010466324.1|  PREDICTED: NAD(H) kinase 1-like                    164   5e-46   Camelina sativa [gold-of-pleasure]
gb|KJB55386.1|  hypothetical protein B456_009G073700                    165   5e-46   Gossypium raimondii
gb|KDP22112.1|  hypothetical protein JCGZ_25943                         165   6e-46   Jatropha curcas
gb|KJB35768.1|  hypothetical protein B456_006G127100                    164   6e-46   Gossypium raimondii
ref|XP_010031772.1|  PREDICTED: NAD(H) kinase 1                         164   9e-46   Eucalyptus grandis [rose gum]
gb|KJB35765.1|  hypothetical protein B456_006G127100                    164   9e-46   Gossypium raimondii
gb|KJB35764.1|  hypothetical protein B456_006G127100                    164   9e-46   Gossypium raimondii
gb|KJB35762.1|  hypothetical protein B456_006G127100                    164   9e-46   Gossypium raimondii
ref|XP_003607363.1|  NAD(H) kinase                                      164   1e-45   Medicago truncatula
dbj|BAD94003.1|  hypothetical protein                                   159   1e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27547.1|  BnaC01g32300D                                          164   1e-45   Brassica napus [oilseed rape]
ref|XP_010545594.1|  PREDICTED: NAD(H) kinase 1 isoform X1              164   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_007015103.1|  NAD(H) kinase 1 isoform 2                          163   1e-45   
emb|CDY37318.1|  BnaA01g25380D                                          163   1e-45   Brassica napus [oilseed rape]
ref|XP_007015102.1|  NAD kinase 1 isoform 1                             164   1e-45   
ref|XP_006406326.1|  hypothetical protein EUTSA_v10020469mg             163   1e-45   
ref|XP_006297412.1|  hypothetical protein CARUB_v10013436mg             163   1e-45   Capsella rubella
gb|KHG26120.1|  NAD (H) kinase 1 -like protein                          162   1e-45   Gossypium arboreum [tree cotton]
gb|KJB35767.1|  hypothetical protein B456_006G127100                    163   2e-45   Gossypium raimondii
ref|XP_006844879.1|  hypothetical protein AMTR_s00058p00119830          162   3e-45   Amborella trichopoda
emb|CDY06405.1|  BnaC05g31250D                                          162   3e-45   
ref|XP_011013831.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         162   3e-45   Populus euphratica
ref|XP_010545596.1|  PREDICTED: NAD(H) kinase 1 isoform X3              161   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_011045416.1|  PREDICTED: NAD(H) kinase 1-like isoform X3         162   4e-45   Populus euphratica
dbj|BAB01450.1|  unnamed protein product                                162   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010545595.1|  PREDICTED: NAD(H) kinase 1 isoform X2              162   4e-45   Tarenaya hassleriana [spider flower]
ref|XP_010102369.1|  NAD(H) kinase 1                                    162   5e-45   
ref|XP_002298393.2|  hypothetical protein POPTR_0001s26330g             160   6e-45   
ref|XP_011013830.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         162   7e-45   Populus euphratica
ref|XP_011045415.1|  PREDICTED: NAD(H) kinase 1-like isoform X2         162   7e-45   Populus euphratica
ref|XP_011045414.1|  PREDICTED: NAD(H) kinase 1-like isoform X1         162   7e-45   Populus euphratica
ref|XP_009109957.1|  PREDICTED: NAD(H) kinase 1-like                    161   8e-45   Brassica rapa
ref|NP_974347.1|  NAD(H) kinase 1                                       161   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145525.1|  PREDICTED: NAD(H) kinase 1                         161   1e-44   Brassica rapa
ref|XP_006406328.1|  hypothetical protein EUTSA_v10020469mg             161   1e-44   
emb|CDY32402.1|  BnaC03g41860D                                          160   2e-44   Brassica napus [oilseed rape]
ref|NP_188744.3|  NAD(H) kinase 1                                       160   2e-44   
gb|AAM13987.1|  unknown protein                                         160   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001045444.2|  Os01g0957000                                       159   9e-44   
emb|CDX82219.1|  BnaA03g36020D                                          159   9e-44   
gb|EEE56031.1|  hypothetical protein OsJ_04817                          159   1e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72189.1|  hypothetical protein OsI_05264                          159   1e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_006646694.1|  PREDICTED: probable NAD kinase 1-like              157   2e-43   Oryza brachyantha
dbj|BAJ98826.1|  predicted protein                                      157   3e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009135723.1|  PREDICTED: NAD(H) kinase 1-like                    157   4e-43   Brassica rapa
ref|XP_002459132.1|  hypothetical protein SORBIDRAFT_03g046360          155   6e-43   
ref|XP_010938543.1|  PREDICTED: probable NAD kinase 1                   155   1e-42   Elaeis guineensis
ref|XP_009391539.1|  PREDICTED: putative NAD kinase 3                   155   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782033.1|  PREDICTED: probable NAD kinase 1                   154   3e-42   Phoenix dactylifera
gb|EMS47657.1|  putative NAD kinase 1                                   154   3e-42   Triticum urartu
ref|XP_003567496.2|  PREDICTED: probable NAD kinase 1                   154   3e-42   Brachypodium distachyon [annual false brome]
gb|EMT15186.1|  Putative NAD kinase 1                                   154   3e-42   
ref|XP_004962207.1|  PREDICTED: putative NAD kinase 3-like isofor...    154   4e-42   Setaria italica
ref|XP_004971313.1|  PREDICTED: probable NAD kinase 1-like              154   4e-42   Setaria italica
gb|ACG29339.1|  NAD kinase 1                                            154   5e-42   Zea mays [maize]
ref|NP_001278550.1|  NAD kinase 1                                       154   5e-42   Zea mays [maize]
ref|XP_004962206.1|  PREDICTED: putative NAD kinase 3-like isofor...    153   6e-42   Setaria italica
ref|XP_010231463.1|  PREDICTED: putative NAD kinase 3 isoform X1        153   1e-41   Brachypodium distachyon [annual false brome]
ref|XP_003568558.1|  PREDICTED: putative NAD kinase 3 isoform X2        152   2e-41   Brachypodium distachyon [annual false brome]
ref|NP_001151954.1|  NAD kinase 1                                       152   2e-41   Zea mays [maize]
tpg|DAA55769.1|  TPA: NAD kinase 1                                      152   2e-41   
gb|EMS60742.1|  Putative NAD kinase 3                                   150   5e-41   Triticum urartu
gb|EMT20687.1|  Putative NAD kinase 3                                   150   1e-40   
sp|Q60E60.2|NADK3_ORYSJ  RecName: Full=Putative NAD kinase 3            147   8e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655275.1|  PREDICTED: putative NAD kinase 3-like              147   1e-39   Oryza brachyantha
ref|XP_002439730.1|  hypothetical protein SORBIDRAFT_09g019130          145   6e-39   
gb|EEC79147.1|  hypothetical protein OsI_19811                          136   8e-36   Oryza sativa Indica Group [Indian rice]
gb|AAV31342.1|  unknown protein                                         135   9e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EYU31388.1|  hypothetical protein MIMGU_mgv1a004907mg                134   4e-35   Erythranthe guttata [common monkey flower]
gb|KCW51160.1|  hypothetical protein EUGRSUZ_J00752                     131   8e-35   Eucalyptus grandis [rose gum]
ref|XP_010034271.1|  PREDICTED: NAD(H) kinase 1-like                    131   4e-34   
ref|XP_002963632.1|  hypothetical protein SELMODRAFT_80525              125   3e-32   
ref|XP_001762814.1|  predicted protein                                  124   2e-31   
gb|KCW51159.1|  hypothetical protein EUGRSUZ_J00751                     122   2e-31   Eucalyptus grandis [rose gum]
ref|XP_010031774.1|  PREDICTED: putative NAD kinase 3 isoform X2        122   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010031773.1|  PREDICTED: putative NAD kinase 3 isoform X1        122   2e-30   Eucalyptus grandis [rose gum]
ref|XP_001758345.1|  predicted protein                                  120   3e-30   
ref|XP_002949486.1|  hypothetical protein VOLCADRAFT_59341              116   7e-30   Volvox carteri f. nagariensis
ref|XP_002965137.1|  hypothetical protein SELMODRAFT_83370              118   1e-29   
ref|XP_002962223.1|  hypothetical protein SELMODRAFT_76799              118   1e-29   
ref|XP_001765616.1|  predicted protein                                  119   1e-29   
ref|XP_001703150.1|  hypothetical protein CHLREDRAFT_123446           99.8    4e-24   Chlamydomonas reinhardtii
ref|XP_005715738.1|  unnamed protein product                            104   1e-23   Chondrus crispus [carageen]
dbj|BAM19258.1|  poly(p)/ATP NAD kinase                               99.4    1e-22   Papilio polytes
gb|EHJ64249.1|  hypothetical protein KGM_07251                        98.2    3e-22   
ref|XP_004997035.1|  poly(p)/ATP nad kinase                             100   3e-22   Salpingoeca rosetta
gb|AHK10563.1|  NADK protein 1                                        97.8    3e-22   Bombyx mori [silk moth]
ref|XP_006615114.1|  PREDICTED: NAD kinase-like isoform X10           97.8    4e-22   Apis dorsata [rock honeybee]
ref|XP_004926313.1|  PREDICTED: NAD kinase-like isoform X3            97.4    5e-22   Bombyx mori [silk moth]
ref|XP_006564945.1|  PREDICTED: NAD kinase-like isoform X10           97.4    5e-22   
ref|XP_004926312.1|  PREDICTED: NAD kinase-like isoform X2            97.8    5e-22   Bombyx mori [silk moth]
ref|XP_006564943.1|  PREDICTED: NAD kinase-like isoform X8            97.8    5e-22   Apis mellifera [bee]
gb|KIZ05631.1|  NAD+ kinase                                             100   5e-22   Monoraphidium neglectum
gb|EFX83515.1|  hypothetical protein DAPPUDRAFT_187852                97.1    5e-22   Daphnia pulex
ref|XP_005708614.1|  NAD+ kinase                                      99.8    5e-22   Galdieria sulphuraria
ref|XP_006564944.1|  PREDICTED: NAD kinase-like isoform X9            97.4    5e-22   
gb|AHK10564.1|  NADK protein 2                                        97.1    5e-22   Bombyx mori [silk moth]
ref|XP_004926311.1|  PREDICTED: NAD kinase-like isoform X1            97.8    6e-22   Bombyx mori [silk moth]
ref|XP_001654785.1|  AAEL000278-PA                                    97.1    6e-22   
ref|XP_001868717.1|  poly(p)/ATP NAD kinase                           98.2    6e-22   Culex quinquefasciatus
ref|XP_008470542.1|  PREDICTED: NAD kinase-like isoform X12           96.7    7e-22   
ref|XP_011253168.1|  PREDICTED: NAD kinase isoform X6                 97.1    7e-22   
ref|XP_006564942.1|  PREDICTED: NAD kinase-like isoform X7            97.4    7e-22   
ref|XP_006615106.1|  PREDICTED: NAD kinase-like isoform X2            97.8    7e-22   Apis dorsata [rock honeybee]
ref|XP_006564938.1|  PREDICTED: NAD kinase-like isoform X3            97.8    7e-22   Apis mellifera [bee]
ref|XP_008470541.1|  PREDICTED: NAD kinase-like isoform X11           96.7    8e-22   
ref|XP_011058885.1|  PREDICTED: NAD kinase-like isoform X7            96.7    8e-22   Acromyrmex echinatior
ref|XP_008470539.1|  PREDICTED: NAD kinase-like isoform X9            97.1    8e-22   
ref|XP_004517709.1|  PREDICTED: NAD kinase-like isoform X2            98.6    8e-22   
ref|XP_002063997.1|  GK15608                                          97.8    9e-22   
ref|XP_392018.3|  PREDICTED: NAD kinase-like isoformX1                97.1    9e-22   Apis mellifera [bee]
ref|XP_008470538.1|  PREDICTED: NAD kinase-like isoform X8            96.7    1e-21   Diaphorina citri
ref|XP_008470530.1|  PREDICTED: NAD kinase-like isoform X1            97.8    1e-21   Diaphorina citri
ref|XP_008470540.1|  PREDICTED: NAD kinase-like isoform X10           96.7    1e-21   Diaphorina citri
ref|XP_008470533.1|  PREDICTED: NAD kinase-like isoform X3            97.8    1e-21   Diaphorina citri
ref|XP_011253171.1|  PREDICTED: NAD kinase isoform X9                 95.9    1e-21   
ref|XP_011253169.1|  PREDICTED: NAD kinase isoform X7                 96.3    1e-21   
ref|XP_005833010.1|  hypothetical protein GUITHDRAFT_163085           96.3    1e-21   Guillardia theta CCMP2712
ref|XP_011058884.1|  PREDICTED: NAD kinase-like isoform X6            96.3    1e-21   Acromyrmex echinatior
ref|XP_006564937.1|  PREDICTED: NAD kinase-like isoform X2            97.1    1e-21   
ref|XP_011253167.1|  PREDICTED: NAD kinase isoform X5                 96.3    2e-21   
ref|XP_011253170.1|  PREDICTED: NAD kinase isoform X8                 95.9    2e-21   
ref|XP_011253163.1|  PREDICTED: NAD kinase isoform X1                 96.3    2e-21   
ref|XP_011253164.1|  PREDICTED: NAD kinase isoform X2                 96.3    2e-21   Camponotus floridanus
ref|XP_011058883.1|  PREDICTED: NAD kinase-like isoform X5            95.9    2e-21   Acromyrmex echinatior
ref|XP_011058881.1|  PREDICTED: NAD kinase-like isoform X4            95.9    2e-21   Acromyrmex echinatior
ref|XP_008470537.1|  PREDICTED: NAD kinase-like isoform X7            96.3    2e-21   Diaphorina citri
ref|XP_011058878.1|  PREDICTED: NAD kinase-like isoform X1            96.3    2e-21   Acromyrmex echinatior
ref|XP_011058879.1|  PREDICTED: NAD kinase-like isoform X2            96.3    2e-21   Acromyrmex echinatior
gb|KFM72467.1|  hypothetical protein X975_06244                       95.9    2e-21   Stegodyphus mimosarum
ref|XP_011058880.1|  PREDICTED: NAD kinase-like isoform X3            95.9    2e-21   Acromyrmex echinatior
ref|XP_002424361.1|  NADH kinase, putative                            95.9    3e-21   Pediculus humanus corporis [human body lice]
ref|XP_002405188.1|  sugar kinase, putative                           95.1    3e-21   Ixodes scapularis [blacklegged tick]
ref|XP_001700866.1|  ATP-NAD kinase                                   96.3    3e-21   Chlamydomonas reinhardtii
ref|XP_011253165.1|  PREDICTED: NAD kinase isoform X3                 95.9    3e-21   
gb|KFB51324.1|  AGAP011122-PA-like protein                            97.1    3e-21   Anopheles sinensis
ref|XP_008470531.1|  PREDICTED: NAD kinase-like isoform X2            96.7    3e-21   Diaphorina citri
ref|XP_011253166.1|  PREDICTED: NAD kinase isoform X4                 95.5    3e-21   
ref|XP_008470536.1|  PREDICTED: NAD kinase-like isoform X6            95.5    4e-21   
ref|XP_008470535.1|  PREDICTED: NAD kinase-like isoform X5            95.5    4e-21   Diaphorina citri
ref|XP_008197014.1|  PREDICTED: NAD kinase-like isoform X6            94.7    4e-21   Tribolium castaneum [rust-red flour beetle]
ref|XP_008470534.1|  PREDICTED: NAD kinase-like isoform X4            95.9    5e-21   Diaphorina citri
ref|XP_001942930.2|  PREDICTED: NAD kinase-like isoform X8            95.9    5e-21   Acyrthosiphon pisum
gb|ETN65711.1|  hypothetical protein AND_002517                       97.1    5e-21   Anopheles darlingi [American malaria mosquito]
gb|KDR22109.1|  hypothetical protein L798_02072                       94.0    5e-21   Zootermopsis nevadensis
ref|XP_005537945.1|  hypothetical protein, conserved                  95.9    6e-21   Cyanidioschyzon merolae strain 10D
ref|XP_008188401.1|  PREDICTED: NAD kinase-like isoform X7            94.0    6e-21   
ref|XP_008188400.1|  PREDICTED: NAD kinase-like isoform X6            94.0    8e-21   Acyrthosiphon pisum
ref|XP_008197013.1|  PREDICTED: NAD kinase-like isoform X5            94.0    8e-21   
ref|XP_001621136.1|  hypothetical protein NEMVEDRAFT_v1g145879        91.3    9e-21   Nematostella vectensis
ref|XP_008197011.1|  PREDICTED: NAD kinase-like isoform X3            94.0    1e-20   
ref|XP_008197010.1|  PREDICTED: NAD kinase-like isoform X2            94.4    1e-20   Tribolium castaneum [rust-red flour beetle]
ref|XP_008188399.1|  PREDICTED: NAD kinase-like isoform X5            94.0    1e-20   Acyrthosiphon pisum
ref|XP_003488899.1|  PREDICTED: NAD kinase-like                       94.0    1e-20   Bombus impatiens
ref|XP_004347505.2|  poly(p)/ATP nad kinase                           95.5    1e-20   Capsaspora owczarzaki ATCC 30864
ref|XP_003702819.1|  PREDICTED: NAD kinase-like                       94.0    1e-20   Megachile rotundata
emb|CBN79989.1|  NAD(+) kinase                                        94.4    1e-20   Ectocarpus siliculosus
ref|XP_008197012.1|  PREDICTED: NAD kinase-like isoform X4            93.6    1e-20   
ref|XP_008197009.1|  PREDICTED: NAD kinase-like isoform X1            94.0    1e-20   Tribolium castaneum [rust-red flour beetle]
ref|XP_003248159.1|  PREDICTED: NAD kinase-like isoform X4            93.6    1e-20   Acyrthosiphon pisum
ref|XP_006696003.1|  NAD+ kinase-like protein                         95.5    1e-20   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_008188398.1|  PREDICTED: NAD kinase-like isoform X3            93.6    2e-20   Acyrthosiphon pisum
gb|EHL02566.1|  putative NAD(+) kinase                                92.4    2e-20   Glarea lozoyensis 74030
ref|XP_011297438.1|  PREDICTED: NAD kinase-like isoform X11           92.4    2e-20   Fopius arisanus
ref|XP_003291185.1|  hypothetical protein DICPUDRAFT_155765           95.1    2e-20   Dictyostelium purpureum
ref|XP_011297437.1|  PREDICTED: NAD kinase-like isoform X10           92.4    2e-20   Fopius arisanus
dbj|BAE62131.1|  unnamed protein product                              94.7    2e-20   Aspergillus oryzae RIB40
gb|EFA76375.1|  NAD+ kinase family protein                            94.0    3e-20   Heterostelium album PN500
ref|XP_008188397.1|  PREDICTED: NAD kinase-like isoform X2            93.2    3e-20   Acyrthosiphon pisum
ref|XP_007828670.1|  hypothetical protein PFICI_01898                 94.4    3e-20   Pestalotiopsis fici W106-1
gb|KJE94057.1|  poly(p)/ATP nad kinase                                94.4    3e-20   Capsaspora owczarzaki ATCC 30864
ref|XP_002955100.1|  hypothetical protein VOLCADRAFT_118925           92.4    3e-20   Volvox carteri f. nagariensis
ref|XP_011297433.1|  PREDICTED: NAD kinase-like isoform X6            92.8    3e-20   Fopius arisanus
gb|KFY44809.1|  hypothetical protein V494_01295                       94.4    3e-20   Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_011346928.1|  PREDICTED: NAD kinase-like isoform X6            92.4    3e-20   Ooceraea biroi
ref|XP_001823264.2|  NAD+ kinase Utr1                                 94.4    3e-20   
ref|XP_008605425.1|  hypothetical protein SDRG_01668                  93.2    4e-20   Saprolegnia diclina VS20
ref|XP_011297432.1|  PREDICTED: NAD kinase-like isoform X5            92.8    4e-20   Fopius arisanus
ref|XP_011297431.1|  PREDICTED: NAD kinase-like isoform X4            92.8    4e-20   Fopius arisanus
gb|KDO34538.1|  hypothetical protein SPRG_00601                       93.2    4e-20   Saprolegnia parasitica CBS 223.65
gb|KFY77402.1|  hypothetical protein V499_03200                       94.0    4e-20   Pseudogymnoascus sp. VKM F-103
gb|KFZ22790.1|  hypothetical protein V502_02720                       94.0    4e-20   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFZ08209.1|  hypothetical protein V501_06051                       94.0    4e-20   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|EFA08909.1|  hypothetical protein TcasGA2_TC006614                 93.6    4e-20   
gb|ELR06268.1|  hypothetical protein GMDG_02062                       94.0    4e-20   Pseudogymnoascus destructans 20631-21
ref|XP_011346933.1|  PREDICTED: NAD kinase-like isoform X7            92.0    4e-20   Ooceraea biroi
gb|KFY11582.1|  hypothetical protein V492_04373                       94.4    4e-20   Pseudogymnoascus sp. VKM F-4246
ref|XP_001556213.1|  hypothetical protein BC1G_05737                  92.0    4e-20   
ref|XP_011297428.1|  PREDICTED: NAD kinase-like isoform X3            92.4    4e-20   Fopius arisanus
ref|XP_011297426.1|  PREDICTED: NAD kinase-like isoform X1            92.4    4e-20   Fopius arisanus
gb|KFY10620.1|  hypothetical protein V491_07569                       92.4    4e-20   Pseudogymnoascus sp. VKM F-3775
ref|XP_001749889.1|  hypothetical protein                             93.6    4e-20   Monosiga brevicollis MX1
ref|XP_001637014.1|  predicted protein                                91.7    4e-20   Nematostella vectensis
ref|XP_011297435.1|  PREDICTED: NAD kinase-like isoform X8            92.0    5e-20   Fopius arisanus
ref|XP_011297427.1|  PREDICTED: NAD kinase-like isoform X2            92.4    5e-20   Fopius arisanus
ref|XP_011346911.1|  PREDICTED: NAD kinase-like isoform X4            92.4    5e-20   
ref|XP_011346905.1|  PREDICTED: NAD kinase-like isoform X3            92.4    5e-20   Ooceraea biroi
ref|XP_011297434.1|  PREDICTED: NAD kinase-like isoform X7            92.0    5e-20   Fopius arisanus
ref|XP_011495464.1|  PREDICTED: NAD kinase-like isoform X8            91.7    5e-20   Ceratosolen solmsi marchali
ref|XP_011297436.1|  PREDICTED: NAD kinase-like isoform X9            92.0    5e-20   Fopius arisanus
ref|XP_007918286.1|  putative atp-nad kinase protein                  92.8    5e-20   Phaeoacremonium minimum UCRPA7
gb|KFY85546.1|  hypothetical protein V500_08317                       94.0    6e-20   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_011346883.1|  PREDICTED: NAD kinase-like isoform X1            92.4    6e-20   
ref|XP_011346897.1|  PREDICTED: NAD kinase-like isoform X2            92.0    7e-20   Ooceraea biroi
ref|XP_003426645.1|  PREDICTED: NAD kinase-like isoform X9            91.3    7e-20   Nasonia vitripennis
gb|KFA66303.1|  hypothetical protein S40285_01878                     93.6    7e-20   Stachybotrys chlorohalonata IBT 40285
ref|XP_003656409.1|  hypothetical protein THITE_2120984               93.2    7e-20   Thielavia terrestris NRRL 8126
ref|XP_008206815.1|  PREDICTED: NAD kinase-like isoform X10           91.3    7e-20   Nasonia vitripennis
gb|KFA72619.1|  hypothetical protein S40288_08801                     93.6    7e-20   Stachybotrys chartarum IBT 40288
gb|KEY71069.1|  hypothetical protein S7711_00893                      93.6    7e-20   Stachybotrys chartarum IBT 7711
ref|XP_008188396.1|  PREDICTED: NAD kinase-like isoform X1            92.4    7e-20   Acyrthosiphon pisum
ref|XP_011148642.1|  PREDICTED: NAD kinase-like isoform X9            90.9    7e-20   Harpegnathos saltator
ref|XP_005648089.1|  ATP-NAD kinase                                   91.7    7e-20   Coccomyxa subellipsoidea C-169
ref|XP_011148641.1|  PREDICTED: NAD kinase-like isoform X8            90.9    7e-20   Harpegnathos saltator
ref|XP_011148643.1|  PREDICTED: NAD kinase-like isoform X10           90.9    7e-20   
gb|KFY80036.1|  hypothetical protein V498_08851                       94.0    8e-20   
ref|XP_011495441.1|  PREDICTED: NAD kinase-like isoform X5            91.7    8e-20   
gb|KFY58451.1|  hypothetical protein V496_06133                       94.0    8e-20   
ref|XP_011161171.1|  PREDICTED: NAD kinase-like isoform X7            90.9    9e-20   
gb|KFY18799.1|  hypothetical protein V493_08340                       93.2    9e-20   
ref|XP_011495414.1|  PREDICTED: NAD kinase-like isoform X2            91.7    9e-20   
ref|XP_011495407.1|  PREDICTED: NAD kinase-like isoform X1            91.7    9e-20   
ref|XP_011495448.1|  PREDICTED: NAD kinase-like isoform X6            91.7    9e-20   
ref|XP_011148640.1|  PREDICTED: NAD kinase-like isoform X7            90.9    9e-20   
ref|XP_008550793.1|  PREDICTED: NAD kinase isoform X7                 90.9    1e-19   
ref|XP_008593468.1|  ATP-NAD kinase                                   93.2    1e-19   
ref|XP_008206814.1|  PREDICTED: NAD kinase-like isoform X8            91.3    1e-19   
ref|XP_003426644.1|  PREDICTED: NAD kinase-like isoform X5            91.3    1e-19   
gb|ENN83177.1|  hypothetical protein YQE_00464                        90.5    1e-19   
ref|XP_008087244.1|  NAD kinase                                       92.8    1e-19   
ref|XP_011148639.1|  PREDICTED: NAD kinase-like isoform X6            90.9    1e-19   
ref|XP_008550791.1|  PREDICTED: NAD kinase isoform X6                 90.5    1e-19   
ref|XP_008206813.1|  PREDICTED: NAD kinase-like isoform X7            91.3    1e-19   
ref|XP_011495457.1|  PREDICTED: NAD kinase-like isoform X7            91.3    1e-19   
ref|XP_011495423.1|  PREDICTED: NAD kinase-like isoform X3            91.7    1e-19   
ref|XP_011148637.1|  PREDICTED: NAD kinase-like isoform X5            90.9    1e-19   
ref|XP_008550788.1|  PREDICTED: NAD kinase isoform X3                 91.3    1e-19   
ref|XP_011495432.1|  PREDICTED: NAD kinase-like isoform X4            91.3    1e-19   
ref|XP_008206810.1|  PREDICTED: NAD kinase-like isoform X4            91.3    1e-19   
ref|XP_011161170.1|  PREDICTED: NAD kinase-like isoform X6            90.9    1e-19   
ref|XP_011148636.1|  PREDICTED: NAD kinase-like isoform X4            90.9    1e-19   
ref|XP_008550786.1|  PREDICTED: NAD kinase isoform X1                 91.3    1e-19   
ref|XP_003426646.1|  PREDICTED: NAD kinase-like isoform X2            91.3    1e-19   
ref|XP_001601214.2|  PREDICTED: NAD kinase-like isoform X1            91.3    1e-19   
ref|XP_011161166.1|  PREDICTED: NAD kinase-like isoform X2            91.3    1e-19   
ref|XP_008550787.1|  PREDICTED: NAD kinase isoform X2                 90.9    1e-19   
ref|XP_001596616.1|  hypothetical protein SS1G_02837                  92.4    1e-19   
ref|XP_003426643.1|  PREDICTED: NAD kinase-like isoform X3            91.3    2e-19   
ref|XP_011148633.1|  PREDICTED: NAD kinase-like isoform X2            90.9    2e-19   
ref|XP_011148630.1|  PREDICTED: NAD kinase-like isoform X1            90.9    2e-19   
ref|XP_004354275.1|  NAD+ kinase family protein                       92.4    2e-19   
ref|XP_011346919.1|  PREDICTED: NAD kinase-like isoform X5            90.9    2e-19   
ref|XP_011161165.1|  PREDICTED: NAD kinase-like isoform X1            90.9    2e-19   
ref|XP_003400589.1|  PREDICTED: LOW QUALITY PROTEIN: NAD kinase-like  90.9    2e-19   
gb|EFZ17327.1|  hypothetical protein SINV_04986                       90.5    2e-19   
dbj|GAM20126.1|  hypothetical protein SAMD00019534_033010             90.9    2e-19   
ref|XP_008550789.1|  PREDICTED: NAD kinase isoform X4                 90.5    2e-19   
ref|XP_001221073.1|  hypothetical protein CHGG_01852                  92.4    2e-19   
ref|XP_011161169.1|  PREDICTED: NAD kinase-like isoform X5            90.9    2e-19   
gb|ENN83176.1|  hypothetical protein YQE_00464                        89.7    2e-19   
ref|XP_004342289.1|  NAD(+)/NADH kinase                               92.8    2e-19   
gb|EWM23511.1|  nad kinase 2                                          91.7    2e-19   
gb|KEZ44173.1|  Nad+ kinase                                           92.0    2e-19   
ref|XP_008550790.1|  PREDICTED: NAD kinase isoform X5                 90.1    2e-19   
ref|XP_008206812.1|  PREDICTED: NAD kinase-like isoform X6            90.1    2e-19   
ref|XP_002291199.1|  inorganic polyphosphate/ATP-NAD kinase           89.0    2e-19   
ref|XP_011161167.1|  PREDICTED: NAD kinase-like isoform X3            90.5    3e-19   
gb|ENN71205.1|  hypothetical protein YQE_12134                        90.1    3e-19   
gb|EJK44266.1|  hypothetical protein THAOC_37212                      90.9    3e-19   
ref|XP_011148634.1|  PREDICTED: NAD kinase-like isoform X3            90.1    3e-19   
gb|EFN78480.1|  NAD kinase                                            90.5    3e-19   
ref|XP_964420.2|  NAD+ kinase Utr1                                    91.7    3e-19   
ref|XP_010095445.1|  NAD kinase 2                                     92.0    3e-19   
ref|XP_009856187.1|  hypothetical protein NEUTE1DRAFT_90967           91.3    4e-19   
ref|XP_011161168.1|  PREDICTED: NAD kinase-like isoform X4            90.1    4e-19   
ref|XP_002058882.1|  GJ19672                                          90.1    4e-19   
gb|EGZ77369.1|  ATP-NAD kinase                                        91.3    4e-19   
gb|KGQ11915.1|  NAD(+) kinase                                         91.3    4e-19   
ref|XP_003658410.1|  hypothetical protein MYCTH_2294143               91.3    4e-19   
emb|CCD48077.1|  similar to NAD+ kinase Utr1                          90.9    5e-19   
gb|ESZ95854.1|  ATP-NAD kinase                                        90.9    5e-19   
ref|XP_007795812.1|  putative atp-nad kinase protein                  89.7    5e-19   
gb|KFX95885.1|  hypothetical protein O988_05568                       91.3    5e-19   
ref|XP_002590542.1|  hypothetical protein BRAFLDRAFT_124524           89.4    5e-19   
gb|KFY41477.1|  hypothetical protein V495_04915                       90.9    6e-19   
ref|XP_007593202.1|  ATP-NAD kinase                                   90.9    6e-19   
gb|KFX96642.1|  hypothetical protein V490_03217                       90.9    7e-19   
gb|KDB13468.1|  NAD kinase associated with ferric reductase           89.7    7e-19   
ref|XP_004160722.1|  PREDICTED: LOW QUALITY PROTEIN: NAD kinase 2...  90.9    8e-19   
ref|XP_001995437.1|  GH22631                                          89.4    8e-19   
ref|XP_001912417.1|  hypothetical protein                             90.1    9e-19   
ref|XP_007571273.1|  PREDICTED: NAD kinase isoform X2                 88.2    9e-19   
ref|XP_008466760.1|  PREDICTED: NAD kinase 2, chloroplastic isofo...  90.9    9e-19   
ref|XP_006662794.1|  PREDICTED: probable NAD kinase 2, chloroplas...  90.5    1e-18   
gb|EEC67832.1|  hypothetical protein OsI_35426                        90.5    1e-18   
emb|CDP10994.1|  unnamed protein product                              89.4    1e-18   
gb|EQL04265.1|  NAD kinase associated with ferric reductase           89.7    1e-18   
gb|EFQ29227.1|  ATP-NAD kinase                                        90.1    1e-18   
gb|EPY52761.1|  NAD/NADH kinase                                       89.4    1e-18   
ref|XP_003348490.1|  hypothetical protein SMAC_02984                  90.1    1e-18   
ref|XP_002981035.1|  hypothetical protein SELMODRAFT_50862            90.1    1e-18   
gb|EEE51792.1|  hypothetical protein OsJ_33250                        90.5    1e-18   
ref|XP_007019202.1|  Poly(P)/ATP NAD kinase, putative isoform 1       90.5    1e-18   
ref|XP_007019203.1|  Poly(P)/ATP NAD kinase, putative isoform 2       90.5    1e-18   
gb|ENH87704.1|  nad+ kinase                                           89.7    1e-18   
gb|KDN70143.1|  putative ATP-NAD kinase                               89.7    1e-18   
ref|XP_002982512.1|  hypothetical protein SELMODRAFT_50863            90.1    1e-18   
ref|NP_001067415.1|  Os11g0191400                                     90.1    1e-18   
ref|XP_007137471.1|  hypothetical protein PHAVU_009G129600g           87.0    1e-18   
ref|XP_007019205.1|  Poly(P)/ATP NAD kinase, putative isoform 4       90.1    1e-18   
ref|XP_009838022.1|  hypothetical protein H257_12499                  89.0    1e-18   
ref|XP_011436211.1|  PREDICTED: NAD kinase-like isoform X4            87.4    1e-18   
ref|XP_010243482.1|  PREDICTED: NAD kinase 2, chloroplastic-like      89.7    2e-18   
gb|EHK50055.1|  hypothetical protein TRIATDRAFT_234537                88.6    2e-18   
ref|XP_007019206.1|  Poly(P)/ATP NAD kinase, putative isoform 5       89.7    2e-18   
dbj|BAK22411.1|  NAD kinase                                           86.3    2e-18   
ref|XP_002180250.1|  predicted protein                                86.3    2e-18   
ref|XP_006671383.1|  NAD+ kinase Utr1, putative                       89.4    2e-18   
ref|XP_004149440.1|  PREDICTED: NAD kinase 2, chloroplastic-like      89.7    2e-18   
ref|XP_011401621.1|  putative NAD kinase 1                            89.4    2e-18   
gb|KHN95322.1|  NAD kinase associated with ferric reductase           89.0    2e-18   
ref|XP_004180404.1|  hypothetical protein TBLA_0D03860                88.6    2e-18   
gb|KFG87009.1|  NAD kinase associated with ferric reductase           89.0    2e-18   
ref|XP_005709105.1|  NAD+ kinase                                      88.6    2e-18   
gb|EHK17578.1|  hypothetical protein TRIVIDRAFT_42780                 88.2    2e-18   
gb|KID88054.1|  NAD kinase associated with ferric reductase           89.0    2e-18   
emb|CEP63099.1|  LALA0S07e02366g1_1                                   88.6    2e-18   
ref|XP_002113841.1|  hypothetical protein TRIADDRAFT_26765            86.7    2e-18   
gb|KGN47690.1|  hypothetical protein Csa_6G381800                     89.4    2e-18   
gb|KID77372.1|  NAD kinase associated with ferric reductase           89.0    2e-18   
gb|KJB59309.1|  hypothetical protein B456_009G248800                  89.4    3e-18   
ref|XP_007820163.1|  ATP-NAD kinase                                   89.0    3e-18   
ref|XP_007811596.1|  NAD kinase associated with ferric reductase      89.0    3e-18   
gb|KJB59308.1|  hypothetical protein B456_009G248800                  89.4    3e-18   
ref|XP_007225382.1|  hypothetical protein PRUPE_ppa000775mg           89.4    3e-18   
ref|XP_008669783.1|  PREDICTED: probable NAD kinase 2, chloroplas...  89.4    3e-18   
ref|XP_008669784.1|  PREDICTED: probable NAD kinase 2, chloroplas...  89.4    3e-18   
ref|XP_011436210.1|  PREDICTED: NAD kinase-like isoform X3            87.4    3e-18   
ref|XP_010677593.1|  PREDICTED: NAD kinase 2, chloroplastic           89.4    3e-18   
ref|XP_009838023.1|  hypothetical protein, variant                    87.4    3e-18   
ref|XP_002006911.1|  GI21327                                          87.4    3e-18   
gb|KIE01995.1|  NAD kinase associated with ferric reductase           88.6    3e-18   
gb|EPX72660.1|  NAD/NADH kinase                                       88.2    3e-18   
ref|XP_003577753.1|  PREDICTED: probable NAD kinase 2, chloroplastic  89.4    3e-18   
ref|XP_002306654.2|  ATP-NAD kinase family protein                    89.0    3e-18   
ref|XP_629620.1|  NAD+ kinase family protein                          89.0    3e-18   
ref|XP_008219583.1|  PREDICTED: NAD kinase 2, chloroplastic           89.0    3e-18   
ref|XP_009785910.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  89.0    4e-18   
ref|XP_006847192.1|  hypothetical protein AMTR_s00017p00249490        89.0    4e-18   
gb|EMS60307.1|  putative NAD kinase 2, chloroplastic                  89.0    4e-18   
dbj|BAJ87225.1|  predicted protein                                    89.0    4e-18   
ref|XP_003003404.1|  NAD(H) kinase                                    88.2    4e-18   
gb|KJB59307.1|  hypothetical protein B456_009G248800                  89.0    4e-18   
gb|EKC35723.1|  NAD kinase                                            87.0    4e-18   
ref|XP_008867885.1|  hypothetical protein H310_05052                  87.8    4e-18   
gb|EYE91284.1|  ATP-NAD kinase                                        88.6    4e-18   
gb|KJB59306.1|  hypothetical protein B456_009G248800                  89.0    4e-18   
gb|EMT29717.1|  Putative NAD kinase 2, chloroplastic                  89.0    4e-18   
ref|XP_008411301.1|  PREDICTED: NAD kinase isoform X2                 86.7    4e-18   
ref|XP_009655168.1|  ATP NAD kinase                                   88.2    4e-18   
ref|XP_010063433.1|  PREDICTED: NAD kinase 2, chloroplastic           89.0    4e-18   
ref|XP_010269059.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  89.0    4e-18   
gb|KIN04119.1|  hypothetical protein OIDMADRAFT_40209                 87.8    4e-18   
ref|XP_001216784.1|  hypothetical protein ATEG_08163                  87.0    4e-18   
gb|KJB80622.1|  hypothetical protein B456_013G107600                  88.6    5e-18   
gb|KJB80618.1|  hypothetical protein B456_013G107600                  88.6    5e-18   
ref|XP_006963009.1|  predicted protein                                87.4    5e-18   
gb|KHG20456.1|  NAD kinase 2, chloroplastic -like protein             88.6    5e-18   
gb|KJB59305.1|  hypothetical protein B456_009G248800                  88.2    5e-18   
ref|XP_006351121.1|  PREDICTED: NAD kinase 2, chloroplastic-like      88.6    5e-18   
gb|ERT02209.1|  hypothetical protein HMPREF1624_00507                 88.2    5e-18   
ref|XP_011102264.1|  PREDICTED: NAD kinase 2, chloroplastic           88.6    5e-18   
gb|KHG20961.1|  NAD kinase 2, chloroplastic                           88.2    6e-18   
ref|XP_004517712.1|  PREDICTED: NAD kinase-like isoform X5            86.3    6e-18   
gb|KHG20960.1|  NAD kinase 2, chloroplastic                           88.2    6e-18   
ref|XP_005800196.1|  PREDICTED: NAD kinase-like                       86.3    6e-18   
ref|XP_004978897.1|  PREDICTED: probable NAD kinase 2, chloroplas...  88.2    6e-18   
ref|XP_004978898.1|  PREDICTED: probable NAD kinase 2, chloroplas...  88.2    6e-18   
ref|XP_004502534.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  88.2    6e-18   
ref|XP_010496320.1|  PREDICTED: NAD kinase 2, chloroplastic-like      88.2    6e-18   
ref|XP_010930698.1|  PREDICTED: probable NAD kinase 2, chloroplas...  88.2    7e-18   
ref|XP_003686250.1|  hypothetical protein TPHA_0F03350                87.4    7e-18   
ref|XP_010459879.1|  PREDICTED: NAD kinase 2, chloroplastic isofo...  88.2    7e-18   
ref|XP_010459878.1|  PREDICTED: NAD kinase 2, chloroplastic isofo...  88.2    7e-18   
gb|EYU32502.1|  hypothetical protein MIMGU_mgv1a001318mg              88.2    7e-18   
ref|XP_007571271.1|  PREDICTED: NAD kinase isoform X1                 86.7    7e-18   
ref|XP_004517710.1|  PREDICTED: NAD kinase-like isoform X3            87.0    8e-18   
ref|XP_003856422.1|  hypothetical protein MYCGRDRAFT_66507            86.7    8e-18   
ref|XP_004502533.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  88.2    8e-18   
ref|XP_004502532.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  88.2    8e-18   
ref|XP_009390073.1|  PREDICTED: probable NAD kinase 2, chloroplastic  88.2    8e-18   
ref|XP_002520312.1|  poly(p)/ATP NAD kinase, putative                 88.2    8e-18   
ref|XP_004517711.1|  PREDICTED: NAD kinase-like isoform X4            86.7    8e-18   
ref|XP_008346162.1|  PREDICTED: NAD kinase 2, chloroplastic isofo...  88.2    8e-18   
ref|XP_003542143.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.8    8e-18   
ref|XP_004292723.2|  PREDICTED: NAD kinase 2, chloroplastic           87.8    8e-18   
ref|XP_009341032.1|  PREDICTED: NAD kinase 2, chloroplastic-like      87.8    8e-18   
ref|XP_010498617.1|  PREDICTED: NAD kinase 2, chloroplastic-like      87.8    8e-18   
ref|XP_002907643.1|  NAD kinase, putative                             87.0    9e-18   
ref|XP_009345587.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.8    9e-18   
ref|XP_005714258.1|  unnamed protein product                          86.3    9e-18   
emb|CAK49161.1|  unnamed protein product                              86.7    9e-18   
ref|XP_010270284.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.8    9e-18   
ref|XP_008679651.1|  PREDICTED: probable NAD kinase 2, chloroplastic  87.8    1e-17   
ref|XP_001265695.1|  NAD+ kinase Utr1, putative                       87.4    1e-17   
ref|XP_008781613.1|  PREDICTED: probable NAD kinase 2, chloroplas...  87.8    1e-17   
ref|XP_004498361.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.8    1e-17   
ref|XP_010270285.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.8    1e-17   
ref|XP_008781614.1|  PREDICTED: probable NAD kinase 2, chloroplas...  87.8    1e-17   
ref|XP_002552370.1|  KLTH0C03322p                                     86.7    1e-17   
ref|XP_009517150.1|  hypothetical protein PHYSODRAFT_467235           87.0    1e-17   
ref|XP_011179409.1|  PREDICTED: NAD kinase isoform X3                 86.7    1e-17   
ref|XP_006365541.1|  PREDICTED: NAD kinase 2, chloroplastic-like      87.8    1e-17   
ref|XP_011436208.1|  PREDICTED: NAD kinase-like isoform X1            86.3    1e-17   
gb|KEY82195.1|  NAD+ kinase Utr1                                      87.0    1e-17   
ref|XP_011002431.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.4    1e-17   
gb|KFK44265.1|  hypothetical protein AALP_AA1G235800                  87.4    1e-17   
ref|XP_749271.1|  NAD+ kinase Utr1                                    87.0    1e-17   
ref|XP_011436209.1|  PREDICTED: NAD kinase-like isoform X2            86.3    1e-17   
gb|KEH35344.1|  NAD/NADH kinase family protein                        87.4    1e-17   
ref|XP_011002433.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.4    1e-17   
ref|XP_011002430.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.4    1e-17   
ref|XP_011002428.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.4    1e-17   
ref|XP_006416282.1|  hypothetical protein EUTSA_v10006690mg           87.4    1e-17   
ref|XP_010534748.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.4    1e-17   
ref|XP_001644185.1|  hypothetical protein Kpol_1059p17                86.3    1e-17   
gb|KIW62580.1|  hypothetical protein PV04_10741                       87.0    1e-17   
ref|XP_011002429.1|  PREDICTED: NAD kinase 2, chloroplastic-like ...  87.4    1e-17   
ref|XP_011027454.1|  PREDICTED: NAD kinase 2, chloroplastic isofo...  87.4    1e-17   
emb|CEJ90759.1|  Putative NAD( ) kinase                               87.0    1e-17   
ref|XP_002302220.1|  ATP-NAD kinase family protein                    87.4    1e-17   
ref|XP_004242047.1|  PREDICTED: NAD kinase 2, chloroplastic           87.4    1e-17   
gb|EHA21275.1|  hypothetical protein ASPNIDRAFT_191587                87.0    1e-17   
emb|CBI18969.3|  unnamed protein product                              87.4    1e-17   
ref|XP_010521304.1|  PREDICTED: NAD kinase 2, chloroplastic-like      87.4    1e-17   



>ref|XP_008349859.1| PREDICTED: NAD(H) kinase 1-like [Malus domestica]
Length=228

 Score =   171 bits (432),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIR+ AKN++ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  41   NITLRHRLQCHVIREAAKNKYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  100

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  101  DGLILSTTSGSTAYSLAAGGSMVHP  125



>gb|ACU17681.1| unknown [Glycine max]
Length=228

 Score =   168 bits (425),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  41   SITLRHRLQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  100

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  101  DGLILSTTSGSTAYSLAAGGSMVHP  125



>ref|XP_008227337.1| PREDICTED: NAD(H) kinase 1 isoform X3 [Prunus mume]
Length=487

 Score =   172 bits (437),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  300  SITLRHRLQCHVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  359

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  360  DGLILSTTSGSTAYSLAAGGSMVHP  384



>gb|AFN88238.1| NADH kinase, partial [Vigna luteola]
Length=250

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETE PMLVLNEVTIDRGISSFLTNLECYCD+SFVTCVQG
Sbjct  63   SITLRHRLQCHVIREAAKNEYETEEPMLVLNEVTIDRGISSFLTNLECYCDDSFVTCVQG  122

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  123  DGLILSTTSGSTAYSLAAGGSMVHP  147



>ref|XP_008227336.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Prunus mume]
Length=516

 Score =   173 bits (438),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  329  SITLRHRLQCHVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  388

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  389  DGLILSTTSGSTAYSLAAGGSMVHP  413



>gb|KHN20637.1| NAD(H) kinase 1 [Glycine soja]
Length=508

 Score =   172 bits (437),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  321  SITLRHRLQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  380

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  381  DGLILSTTSGSTAYSLAAGGSMVHP  405



>gb|KHN05513.1| NAD(H) kinase 1 [Glycine soja]
Length=508

 Score =   172 bits (437),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  321  SITLRHRLQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  380

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  381  DGLILSTTSGSTAYSLAAGGSMVHP  405



>ref|XP_008227335.1| PREDICTED: NAD(H) kinase 1 isoform X1 [Prunus mume]
Length=520

 Score =   173 bits (438),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  333  SITLRHRLQCHVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  392

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  393  DGLILSTTSGSTAYSLAAGGSMVHP  417



>ref|XP_009374927.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Pyrus x bretschneideri]
Length=519

 Score =   173 bits (438),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIR+ AKNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVT VQG
Sbjct  332  NITLRHRLQCHVIREAAKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTSVQG  391

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  392  DGLILSTTSGSTAYSLAAGGSMVHP  416



>ref|XP_009366085.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Pyrus x bretschneideri]
Length=519

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIR+  KNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  332  NITLRHRLQCHVIREATKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  391

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  392  DGLILSTTSGSTAYSLAAGGSMVHP  416



>ref|XP_009374926.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Pyrus x bretschneideri]
Length=565

 Score =   173 bits (438),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIR+ AKNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVT VQG
Sbjct  378  NITLRHRLQCHVIREAAKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTSVQG  437

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  438  DGLILSTTSGSTAYSLAAGGSMVHP  462



>ref|XP_003540253.1| PREDICTED: NAD(H) kinase 1-like [Glycine max]
Length=521

 Score =   172 bits (435),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  334  SITLRHRLQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  393

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  394  DGLILSTTSGSTAYSLAAGGSMVHP  418



>ref|XP_008363346.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Malus domestica]
Length=519

 Score =   172 bits (435),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIR+ AKNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVT VQG
Sbjct  332  NITLRHRLQCHVIREAAKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTSVQG  391

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  392  DGLILSTTSGSTAYSLAAGGSMVHP  416



>ref|XP_003537731.1| PREDICTED: NAD(H) kinase 1 [Glycine max]
Length=521

 Score =   172 bits (435),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  334  SITLRHRLQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  393

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  394  DGLILSTTSGSTAYSLAAGGSMVHP  418



>ref|XP_011459496.1| PREDICTED: NAD(H) kinase 1 [Fragaria vesca subsp. vesca]
Length=519

 Score =   172 bits (435),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  332  SITLRHRLQCHVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  391

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  392  DGLILSTTSGSTAYSLAAGGSMVHP  416



>ref|XP_008363343.1| PREDICTED: NAD(H) kinase 1 isoform X1 [Malus domestica]
Length=565

 Score =   172 bits (436),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIR+ AKNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVT VQG
Sbjct  378  NITLRHRLQCHVIREAAKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTSVQG  437

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  438  DGLILSTTSGSTAYSLAAGGSMVHP  462



>ref|XP_009366086.1| PREDICTED: probable NAD kinase 1 isoform X3 [Pyrus x bretschneideri]
Length=486

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIR+  KNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  299  NITLRHRLQCHVIREATKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  358

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  359  DGLILSTTSGSTAYSLAAGGSMVHP  383



>ref|XP_011080363.1| PREDICTED: NAD(H) kinase 1 [Sesamum indicum]
Length=534

 Score =   171 bits (434),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD AK+E+E EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  347  SITLRHRLQCHIIRDEAKSEYENEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  406

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  407  DGLILSTTSGSTAYSLAAGGSMVHP  431



>ref|XP_009366084.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Pyrus x bretschneideri]
Length=565

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIR+  KNE+ETEGPMLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  378  NITLRHRLQCHVIREATKNEYETEGPMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  437

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  438  DGLILSTTSGSTAYSLAAGGSMVHP  462



>ref|XP_007214444.1| hypothetical protein PRUPE_ppa024717mg, partial [Prunus persica]
 gb|EMJ15643.1| hypothetical protein PRUPE_ppa024717mg, partial [Prunus persica]
Length=419

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETEGP+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  232  SITLRHRLQCHVIREAAKNEYETEGPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  291

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  292  DGLILSTTSGSTAYSLAAGGSMVHP  316



>gb|AFS49950.1| NADH kinase [Vigna luteola]
Length=522

 Score =   171 bits (433),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETE PMLVLNEVTIDRGISSFLTNLECYCD+SFVTCVQG
Sbjct  335  SITLRHRLQCHVIREAAKNEYETEEPMLVLNEVTIDRGISSFLTNLECYCDDSFVTCVQG  394

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  395  DGLILSTTSGSTAYSLAAGGSMVHP  419



>emb|CDP09273.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   170 bits (431),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQC+VIRD AK E+E EGP+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  340  SITLRHRLQCYVIRDAAKTEYENEGPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  399

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  400  DGLILSTTSGSTAYSLAAGGSMVHP  424



>gb|EPS71079.1| hypothetical protein M569_03679, partial [Genlisea aurea]
Length=506

 Score =   170 bits (430),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 79/86 (92%), Positives = 84/86 (98%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGP-MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +ITLRHRLQCH+IRD AK+E+E+EGP MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ
Sbjct  318  SITLRHRLQCHIIRDEAKSEYESEGPPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  377

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  378  GDGLILSTTSGSTAYSLAAGGSMVHP  403



>ref|XP_007131550.1| hypothetical protein PHAVU_011G022700g [Phaseolus vulgaris]
 gb|ESW03544.1| hypothetical protein PHAVU_011G022700g [Phaseolus vulgaris]
Length=480

 Score =   169 bits (428),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCD+SFVTCVQG
Sbjct  293  SITLRHRLQCHVIREAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDDSFVTCVQG  352

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  353  DGLILSTTSGSTAYSLAAGGSMVHP  377



>ref|XP_006446153.1| hypothetical protein CICLE_v10014881mg [Citrus clementina]
 gb|ESR59393.1| hypothetical protein CICLE_v10014881mg [Citrus clementina]
Length=371

 Score =   167 bits (422),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AKNE E E P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  183  SITLRNRLQCHVIRDAAKNEIEIEDPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  242

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  243  DGLILSTTSGSTAYSLAAGGSMVHP  267



>gb|EYU46237.1| hypothetical protein MIMGU_mgv1a004572mg [Erythranthe guttata]
Length=520

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD AK+E+E EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  333  SITLRHRLQCHIIRDEAKSEYENEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  392

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  393  DGLILSTTSGSTAYSLAAGGSMVHP  417



>ref|XP_007131551.1| hypothetical protein PHAVU_011G022700g [Phaseolus vulgaris]
 gb|ESW03545.1| hypothetical protein PHAVU_011G022700g [Phaseolus vulgaris]
Length=568

 Score =   169 bits (429),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AKNE+ETE P+LVLNEVTIDRGISSFLTNLECYCD+SFVTCVQG
Sbjct  381  SITLRHRLQCHVIREAAKNEYETEEPILVLNEVTIDRGISSFLTNLECYCDDSFVTCVQG  440

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  441  DGLILSTTSGSTAYSLAAGGSMVHP  465



>ref|XP_002513516.1| poly(p)/ATP NAD kinase, putative [Ricinus communis]
 gb|EEF48919.1| poly(p)/ATP NAD kinase, putative [Ricinus communis]
Length=532

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AKNE ETE P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  345  SITLRHRLQCHVIRDAAKNEVETEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>ref|XP_004505640.1| PREDICTED: NAD(H) kinase 1-like [Cicer arietinum]
Length=524

 Score =   168 bits (425),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL CHVIRD AKNEFET  P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  337  SITLRHRLLCHVIRDAAKNEFETGEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  396

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  397  DGLILSTTSGSTAYSLAAGGSMVHP  421



>ref|XP_011032051.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Populus euphratica]
Length=532

 Score =   168 bits (425),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQC+VIRD AKNE+E E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  345  SITLRHRLQCYVIRDAAKNEYEMEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>ref|XP_002314082.2| ATP-NAD kinase family protein [Populus trichocarpa]
 gb|EEE88037.2| ATP-NAD kinase family protein [Populus trichocarpa]
Length=532

 Score =   168 bits (425),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQC+VIRD AKNE+E E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  345  SITLRHRLQCYVIRDAAKNEYEMEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>dbj|BAK22410.1| NAD kinase [Nicotiana benthamiana]
Length=299

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK++ ETE P+LVLNEVTIDRGISSFL+NLECYCDNSFVTCVQG
Sbjct  112  SITLRHRLQCHVIRDAAKSDLETEEPILVLNEVTIDRGISSFLSNLECYCDNSFVTCVQG  171

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  172  DGLILSTTSGSTAYSLAAGGSMVHP  196



>ref|XP_011032050.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Populus euphratica]
Length=575

 Score =   168 bits (425),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQC+VIRD AKNE+E E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  388  SITLRHRLQCYVIRDAAKNEYEMEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  447

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  448  DGLILSTTSGSTAYSLAAGGSMVHP  472



>ref|XP_006446154.1| hypothetical protein CICLE_v10014881mg [Citrus clementina]
 gb|ESR59394.1| hypothetical protein CICLE_v10014881mg [Citrus clementina]
Length=530

 Score =   167 bits (424),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AKNE E E P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  342  SITLRNRLQCHVIRDAAKNEIEIEDPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  401

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  402  DGLILSTTSGSTAYSLAAGGSMVHP  426



>ref|XP_010246729.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Nelumbo nucifera]
Length=527

 Score =   167 bits (422),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK+E ETE P+L LNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  339  SITLRHRLQCHVIRDAAKDELETEEPILALNEVTIDRGISSYLTNLECYCDNSFVTCVQG  398

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  399  DGLILSTTSGSTAYSLAAGGSMVHP  423



>gb|KJB55385.1| hypothetical protein B456_009G073700 [Gossypium raimondii]
Length=411

 Score =   164 bits (416),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C VIRD AKNE+ETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  218  SITLRHRLLCRVIRDAAKNEYETEEPLLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  277

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  278  DGLILSTTSGSTAYSLAAGGSMVHP  302



>gb|KJB55387.1| hypothetical protein B456_009G073700 [Gossypium raimondii]
Length=486

 Score =   166 bits (420),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C VIRD AKNE+ETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  293  SITLRHRLLCRVIRDAAKNEYETEEPLLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  352

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  353  DGLILSTTSGSTAYSLAAGGSMVHP  377



>ref|XP_010651218.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Vitis vinifera]
 ref|XP_010651219.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Vitis vinifera]
 ref|XP_010651221.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Vitis vinifera]
 ref|XP_010651222.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Vitis vinifera]
 emb|CBI16350.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   167 bits (422),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQG
Sbjct  376  SITLRHRLQCHVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQG  435

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  436  DGLILSTTSGSTAYSLAAGGSMVHP  460



>ref|XP_010651217.1| PREDICTED: NAD(H) kinase 1 isoform X1 [Vitis vinifera]
Length=565

 Score =   167 bits (422),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQG
Sbjct  378  SITLRHRLQCHVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQG  437

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  438  DGLILSTTSGSTAYSLAAGGSMVHP  462



>ref|XP_010246730.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Nelumbo nucifera]
Length=503

 Score =   166 bits (420),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK+E ETE P+L LNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  315  SITLRHRLQCHVIRDAAKDELETEEPILALNEVTIDRGISSYLTNLECYCDNSFVTCVQG  374

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  375  DGLILSTTSGSTAYSLAAGGSMVHP  399



>ref|XP_002285357.1| PREDICTED: NAD(H) kinase 1 isoform X3 [Vitis vinifera]
Length=522

 Score =   166 bits (420),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQG
Sbjct  335  SITLRHRLQCHVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQG  394

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  395  DGLILSTTSGSTAYSLAAGGSMVHP  419



>ref|XP_010269768.1| PREDICTED: probable NAD kinase 1 isoform X4 [Nelumbo nucifera]
Length=463

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRDTAK+E ETE P+LVLNEVTIDRGISS+LTNLECYCDNSF+TCVQG
Sbjct  343  SITLRHRLQCHVIRDTAKDELETEDPILVLNEVTIDRGISSYLTNLECYCDNSFMTCVQG  402

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  403  DGLIISTTSGSTAYSLAAGGSMVHP  427



>ref|XP_004228514.1| PREDICTED: NAD(H) kinase 1 [Solanum lycopersicum]
Length=531

 Score =   166 bits (420),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD+AK++ ++E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  344  SITLRHRLQCHVIRDSAKSDLDSEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  403

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  404  DGLILSTTSGSTAYSLAAGGSMVHP  428



>ref|XP_006470640.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Citrus sinensis]
 gb|KDO61211.1| hypothetical protein CISIN_1g008048mg [Citrus sinensis]
Length=579

 Score =   167 bits (422),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AKNE E E P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  391  SITLRNRLQCHVIRDAAKNEIEIEDPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  450

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  451  DGLILSTTSGSTAYSLAAGGSMVHP  475



>ref|XP_006365622.1| PREDICTED: probable NAD kinase 1-like [Solanum tuberosum]
Length=531

 Score =   166 bits (420),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD+AK++ ++E P+LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG
Sbjct  344  SITLRHRLQCHVIRDSAKSDLDSEEPILVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  403

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  404  DGLILSTTSGSTAYSLAAGGSMVHP  428



>gb|KJB55384.1| hypothetical protein B456_009G073700 [Gossypium raimondii]
Length=435

 Score =   164 bits (416),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C VIRD AKNE+ETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  242  SITLRHRLLCRVIRDAAKNEYETEEPLLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  301

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  302  DGLILSTTSGSTAYSLAAGGSMVHP  326



>ref|XP_009775830.1| PREDICTED: NAD(H) kinase 1 [Nicotiana sylvestris]
Length=528

 Score =   166 bits (420),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK++ ETE P+LVLNEVTIDRGISSFL+NLECYCDNSFVTCVQG
Sbjct  341  SITLRHRLQCHVIRDAAKSDLETEEPILVLNEVTIDRGISSFLSNLECYCDNSFVTCVQG  400

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  401  DGLILSTTSGSTAYSLAAGGSMVHP  425



>ref|XP_006470641.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Citrus sinensis]
 gb|KDO61212.1| hypothetical protein CISIN_1g008048mg [Citrus sinensis]
Length=533

 Score =   166 bits (420),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AKNE E E P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  345  SITLRNRLQCHVIRDAAKNEIEIEDPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>ref|XP_002885418.1| hypothetical protein ARALYDRAFT_342253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61677.1| hypothetical protein ARALYDRAFT_342253 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   166 bits (419),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A NE+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  317  SITLRHRLQCHIIRDKATNEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  376

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  377  DGLILSTTSGSTAYSLAAGGSMVHP  401



>ref|XP_010651223.1| PREDICTED: NAD(H) kinase 1 isoform X4 [Vitis vinifera]
Length=474

 Score =   165 bits (418),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQG
Sbjct  287  SITLRHRLQCHVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQG  346

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  347  DGLILSTTSGSTAYSLAAGGSMVHP  371



>emb|CAN64916.1| hypothetical protein VITISV_023722 [Vitis vinifera]
Length=500

 Score =   166 bits (419),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK+E+E+EGP+LVLNEVTIDRGISSFLTNLECY D SFVTCVQG
Sbjct  222  SITLRHRLQCHVIRDAAKSEYESEGPILVLNEVTIDRGISSFLTNLECYSDGSFVTCVQG  281

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  282  DGLILSTTSGSTAYSLAAGGSMVHP  306



>ref|XP_009618540.1| PREDICTED: NAD(H) kinase 1 [Nicotiana tomentosiformis]
Length=528

 Score =   166 bits (420),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD AK++ ETE P+LVLNEVTIDRGISSFL+NLECYCDNSFVTCVQG
Sbjct  341  SITLRHRLQCHVIRDAAKSDLETEEPILVLNEVTIDRGISSFLSNLECYCDNSFVTCVQG  400

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  401  DGLILSTTSGSTAYSLAAGGSMVHP  425



>gb|KJB35761.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=487

 Score =   165 bits (418),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  298  SITLRHRLLCRVVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  357

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  358  DGLILSTTSGSTAYSLAAGGSMVHP  382



>gb|KJB35763.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=429

 Score =   164 bits (415),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  240  SITLRHRLLCRVVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  299

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  300  DGLILSTTSGSTAYSLAAGGSMVHP  324



>gb|KFK39415.1| hypothetical protein AALP_AA3G241900 [Arabis alpina]
Length=532

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++EFETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  345  SITLRHRLQCHIIRDKARHEFETEDTMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>ref|XP_010269765.1| PREDICTED: putative NAD kinase 3 isoform X1 [Nelumbo nucifera]
Length=531

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRDTAK+E ETE P+LVLNEVTIDRGISS+LTNLECYCDNSF+TCVQG
Sbjct  343  SITLRHRLQCHVIRDTAKDELETEDPILVLNEVTIDRGISSYLTNLECYCDNSFMTCVQG  402

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  403  DGLIISTTSGSTAYSLAAGGSMVHP  427



>ref|XP_004139039.1| PREDICTED: NAD(H) kinase 1-like [Cucumis sativus]
 ref|XP_004154635.1| PREDICTED: NAD(H) kinase 1-like [Cucumis sativus]
 gb|KGN66497.1| hypothetical protein Csa_1G615160 [Cucumis sativus]
Length=521

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD A+NE+ETE P+LVLNEVTIDRGISS+LTNLECYCD SFVTCVQG
Sbjct  334  SITLRHRLQCHVIRDAARNEYETEEPILVLNEVTIDRGISSYLTNLECYCDRSFVTCVQG  393

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  394  DGLILSTTSGSTAYSLAAGGSMVHP  418



>ref|XP_007015105.1| NAD(H) kinase 1 isoform 4 [Theobroma cacao]
 gb|EOY32724.1| NAD(H) kinase 1 isoform 4 [Theobroma cacao]
Length=472

 Score =   164 bits (415),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE++TE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  285  SITLRHRLLCRVVRDAAKNEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  344

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  345  DGLILSTTSGSTAYSLAAGGSMVHP  369



>ref|XP_010509651.1| PREDICTED: NAD(H) kinase 1-like [Camelina sativa]
Length=525

 Score =   165 bits (417),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  338  SITLRHRLQCHIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  397

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  398  DGLILSTTSGSTAYSLAAGGSMVHP  422



>ref|XP_008450412.1| PREDICTED: NAD(H) kinase 1 [Cucumis melo]
Length=521

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRD A+NE+ETE P+LVLNEVTIDRGISS+LTNLECYCD SFVTCVQG
Sbjct  334  SITLRHRLQCHVIRDAARNEYETEEPILVLNEVTIDRGISSYLTNLECYCDRSFVTCVQG  393

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  394  DGLILSTTSGSTAYSLAAGGSMVHP  418



>ref|XP_010488093.1| PREDICTED: NAD(H) kinase 1 [Camelina sativa]
Length=525

 Score =   165 bits (417),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  338  SITLRHRLQCHIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  397

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  398  DGLILSTTSGSTAYSLAAGGSMVHP  422



>ref|XP_010673682.1| PREDICTED: NAD(H) kinase 1 [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   165 bits (417),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR++AK+E++TE P+LVLNEVTIDRGISS+LTNLECYCDN+FVTCVQG
Sbjct  334  SITLRHRLQCHVIRESAKHEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNTFVTCVQG  393

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  394  DGLILSTTSGSTAYSLAAGGSMVHP  418



>ref|XP_010269767.1| PREDICTED: putative NAD kinase 3 isoform X3 [Nelumbo nucifera]
Length=526

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRDTAK+E ETE P+LVLNEVTIDRGISS+LTNLECYCDNSF+TCVQG
Sbjct  343  SITLRHRLQCHVIRDTAKDELETEDPILVLNEVTIDRGISSYLTNLECYCDNSFMTCVQG  402

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  403  DGLIISTTSGSTAYSLAAGGSMVHP  427



>ref|XP_010269766.1| PREDICTED: putative NAD kinase 3 isoform X2 [Nelumbo nucifera]
Length=530

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIRDTAK+E ETE P+LVLNEVTIDRGISS+LTNLECYCDNSF+TCVQG
Sbjct  343  SITLRHRLQCHVIRDTAKDELETEDPILVLNEVTIDRGISSYLTNLECYCDNSFMTCVQG  402

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  403  DGLIISTTSGSTAYSLAAGGSMVHP  427



>ref|XP_007015104.1| NAD kinase 1 isoform 3 [Theobroma cacao]
 gb|EOY32723.1| NAD kinase 1 isoform 3 [Theobroma cacao]
Length=436

 Score =   163 bits (413),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE++TE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  249  SITLRHRLLCRVVRDAAKNEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  308

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  309  DGLILSTTSGSTAYSLAAGGSMVHP  333



>ref|XP_010466324.1| PREDICTED: NAD(H) kinase 1-like [Camelina sativa]
Length=526

 Score =   164 bits (416),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  339  SITLRHRLQCHIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  398

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  399  DGLILSTTSGSTAYSLAAGGSMVHP  423



>gb|KJB55386.1| hypothetical protein B456_009G073700 [Gossypium raimondii]
Length=538

 Score =   165 bits (417),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C VIRD AKNE+ETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  345  SITLRHRLLCRVIRDAAKNEYETEEPLLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>gb|KDP22112.1| hypothetical protein JCGZ_25943 [Jatropha curcas]
Length=554

 Score =   165 bits (417),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            NITLRHRLQCHVIRD A NE ET+ P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  364  NITLRHRLQCHVIRDAATNEVETDEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  423

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  424  DGLILSTTSGSTAYSLAAGGSMVHP  448



>gb|KJB35768.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=537

 Score =   164 bits (416),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  348  SITLRHRLLCRVVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  407

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  408  DGLILSTTSGSTAYSLAAGGSMVHP  432



>ref|XP_010031772.1| PREDICTED: NAD(H) kinase 1 [Eucalyptus grandis]
 gb|KCW51156.1| hypothetical protein EUGRSUZ_J00748 [Eucalyptus grandis]
Length=524

 Score =   164 bits (415),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHV+RD+A+NE+ETE P+LVLNEVTIDRGISS+LTNLECY DNSFVT VQG
Sbjct  337  SITLRHRLQCHVVRDSARNEYETEEPILVLNEVTIDRGISSYLTNLECYSDNSFVTLVQG  396

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  397  DGLILSTTSGSTAYSLAAGGSMVHP  421



>gb|KJB35765.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=541

 Score =   164 bits (415),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  352  SITLRHRLLCRVVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  411

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  412  DGLILSTTSGSTAYSLAAGGSMVHP  436



>gb|KJB35764.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=587

 Score =   164 bits (416),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  398  SITLRHRLLCRVVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  457

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  458  DGLILSTTSGSTAYSLAAGGSMVHP  482



>gb|KJB35762.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=539

 Score =   164 bits (415),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  350  SITLRHRLLCRVVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  409

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  410  DGLILSTTSGSTAYSLAAGGSMVHP  434



>ref|XP_003607363.1| NAD(H) kinase [Medicago truncatula]
 gb|AES89560.1| NAD/NADH kinase family protein [Medicago truncatula]
Length=523

 Score =   164 bits (414),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL CHVIRD AKNEFETE P+LVLNEVTIDRGISS+LTNLECYCDNSFVT VQG
Sbjct  336  SITLRHRLICHVIRDAAKNEFETEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTRVQG  395

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  396  DGLILSTTSGSTAYSLAAGGSMVHP  420



>dbj|BAD94003.1| hypothetical protein [Arabidopsis thaliana]
Length=272

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  88   SITLRHRLQCHIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  147

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  148  DGLILSTTSGSTAYSLAAGGSMVHP  172



>emb|CDY27547.1| BnaC01g32300D [Brassica napus]
Length=529

 Score =   164 bits (414),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE  MLVLNEVTIDRGI+SFLTNLECYCDNSFVTCVQG
Sbjct  342  SITLRHRLQCHIIRDKARHDYETEENMLVLNEVTIDRGITSFLTNLECYCDNSFVTCVQG  401

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  402  DGLILSTTSGSTAYSLAAGGSMVHP  426



>ref|XP_010545594.1| PREDICTED: NAD(H) kinase 1 isoform X1 [Tarenaya hassleriana]
Length=576

 Score =   164 bits (415),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH++RD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  389  SITLRHRLQCHIVRDKARHEYETEEQMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  448

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  449  DGLILSTTSGSTAYSLAAGGSMVHP  473



>ref|XP_007015103.1| NAD(H) kinase 1 isoform 2, partial [Theobroma cacao]
 gb|EOY32722.1| NAD(H) kinase 1 isoform 2, partial [Theobroma cacao]
Length=491

 Score =   163 bits (412),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE++TE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  398  SITLRHRLLCRVVRDAAKNEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  457

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  458  DGLILSTTSGSTAYSLAAGGSMVHP  482



>emb|CDY37318.1| BnaA01g25380D [Brassica napus]
Length=529

 Score =   163 bits (413),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE  MLVLNEVTIDRGI+SFLTNLECYCDNSFVTCVQG
Sbjct  342  SITLRHRLQCHIIRDKARHDYETEENMLVLNEVTIDRGITSFLTNLECYCDNSFVTCVQG  401

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  402  DGLILSTTSGSTAYSLAAGGSMVHP  426



>ref|XP_007015102.1| NAD kinase 1 isoform 1 [Theobroma cacao]
 gb|EOY32721.1| NAD kinase 1 isoform 1 [Theobroma cacao]
Length=537

 Score =   164 bits (414),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE++TE P+LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  350  SITLRHRLLCRVVRDAAKNEYDTEEPILVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  409

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  410  DGLILSTTSGSTAYSLAAGGSMVHP  434



>ref|XP_006406326.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
 ref|XP_006406327.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
 gb|ESQ47779.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
 gb|ESQ47780.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
Length=531

 Score =   163 bits (413),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  345  SITLRHRLQCHIIRDKARHDYETEENMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>ref|XP_006297412.1| hypothetical protein CARUB_v10013436mg [Capsella rubella]
 gb|EOA30310.1| hypothetical protein CARUB_v10013436mg [Capsella rubella]
Length=532

 Score =   163 bits (413),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCD+SFVTCVQG
Sbjct  345  SITLRHRLQCHIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDDSFVTCVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>gb|KHG26120.1| NAD (H) kinase 1 -like protein [Gossypium arboreum]
Length=451

 Score =   162 bits (410),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  262  SITLRHRLLCRVVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  321

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  322  DGLILSTTSGSTAYSLAAGGSMVHP  346



>gb|KJB35767.1| hypothetical protein B456_006G127100 [Gossypium raimondii]
Length=513

 Score =   163 bits (412),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  324  SITLRHRLLCRVVRDAAKNEYETEEPFLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  383

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  384  DGLILSTTSGSTAYSLAAGGSMVHP  408



>ref|XP_006844879.1| hypothetical protein AMTR_s00058p00119830 [Amborella trichopoda]
 gb|ERN06554.1| hypothetical protein AMTR_s00058p00119830 [Amborella trichopoda]
Length=533

 Score =   162 bits (411),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL CHVIRD AK+E ETE PMLVLNEVTIDRG+SSFLT LECYCDNSFVTCVQG
Sbjct  346  SITLRHRLICHVIRDGAKDELETEEPMLVLNEVTIDRGMSSFLTQLECYCDNSFVTCVQG  405

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  406  DGLILSTTSGSTAYSLAAGGSMVHP  430



>emb|CDY06405.1| BnaC05g31250D [Brassica napus]
Length=529

 Score =   162 bits (411),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  344  SITLRHRLQCHIIRDKARHDYETEENMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  403

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  404  DGLILSTTSGSTAYSLAAGGSMVHP  428



>ref|XP_011013831.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Populus euphratica]
Length=532

 Score =   162 bits (411),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHR+QCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQG
Sbjct  345  SITLRHRMQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSL AGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLGAGGSMVHP  429



>ref|XP_010545596.1| PREDICTED: NAD(H) kinase 1 isoform X3 [Tarenaya hassleriana]
Length=439

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH++RD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  252  SITLRHRLQCHIVRDKARHEYETEEQMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  311

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  312  DGLILSTTSGSTAYSLAAGGSMVHP  336



>ref|XP_011045416.1| PREDICTED: NAD(H) kinase 1-like isoform X3 [Populus euphratica]
Length=532

 Score =   162 bits (410),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHR+QCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQG
Sbjct  345  SITLRHRMQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSL AGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLGAGGSMVHP  429



>dbj|BAB01450.1| unnamed protein product [Arabidopsis thaliana]
Length=483

 Score =   162 bits (409),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  299  SITLRHRLQCHIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  358

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  359  DGLILSTTSGSTAYSLAAGGSMVHP  383



>ref|XP_010545595.1| PREDICTED: NAD(H) kinase 1 isoform X2 [Tarenaya hassleriana]
Length=533

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH++RD A++E+ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  346  SITLRHRLQCHIVRDKARHEYETEEQMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  405

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  406  DGLILSTTSGSTAYSLAAGGSMVHP  430



>ref|XP_010102369.1| NAD(H) kinase 1 [Morus notabilis]
 gb|EXB93330.1| NAD(H) kinase 1 [Morus notabilis]
Length=538

 Score =   162 bits (410),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL C V+RD AKNE+ETE P++VLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  351  SITLRHRLMCRVLRDAAKNEYETEEPVIVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  410

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  411  DGLILSTTSGSTAYSLAAGGSMVHP  435



>ref|XP_002298393.2| hypothetical protein POPTR_0001s26330g [Populus trichocarpa]
 gb|EEE83198.2| hypothetical protein POPTR_0001s26330g [Populus trichocarpa]
Length=446

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHR+QCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQG
Sbjct  259  SITLRHRMQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQG  318

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSL AGGSMVHP
Sbjct  319  DGLILSTTSGSTAYSLGAGGSMVHP  343



>ref|XP_011013830.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Populus euphratica]
Length=546

 Score =   162 bits (409),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHR+QCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQG
Sbjct  359  SITLRHRMQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQG  418

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSL AGGSMVHP
Sbjct  419  DGLILSTTSGSTAYSLGAGGSMVHP  443



>ref|XP_011045415.1| PREDICTED: NAD(H) kinase 1-like isoform X2 [Populus euphratica]
Length=546

 Score =   162 bits (409),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHR+QCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQG
Sbjct  359  SITLRHRMQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQG  418

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSL AGGSMVHP
Sbjct  419  DGLILSTTSGSTAYSLGAGGSMVHP  443



>ref|XP_011045414.1| PREDICTED: NAD(H) kinase 1-like isoform X1 [Populus euphratica]
Length=546

 Score =   162 bits (409),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHR+QCHVIRD AKNE+ETE P+LVLNEVTIDRGISSFL NLECYCDNSFVT VQG
Sbjct  359  SITLRHRMQCHVIRDAAKNEYETEEPILVLNEVTIDRGISSFLANLECYCDNSFVTRVQG  418

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSL AGGSMVHP
Sbjct  419  DGLILSTTSGSTAYSLGAGGSMVHP  443



>ref|XP_009109957.1| PREDICTED: NAD(H) kinase 1-like [Brassica rapa]
Length=529

 Score =   161 bits (408),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRL CH+IRD A++++ETE  MLVLNEVTIDRGI+SFLTNLECYCDNSFVTCVQG
Sbjct  342  SITLRHRLHCHIIRDKARHDYETEENMLVLNEVTIDRGITSFLTNLECYCDNSFVTCVQG  401

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  402  DGLILSTTSGSTAYSLAAGGSMVHP  426



>ref|NP_974347.1| NAD(H) kinase 1 [Arabidopsis thaliana]
 sp|Q56YN3.2|NADK1_ARATH RecName: Full=NAD(H) kinase 1; Short=AtNADK-1 [Arabidopsis thaliana]
 gb|AAR32133.1| NADK1 [Arabidopsis thaliana]
 dbj|BAD43895.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76456.1| NAD(H) kinase 1 [Arabidopsis thaliana]
Length=524

 Score =   161 bits (408),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  340  SITLRHRLQCHIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  399

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  400  DGLILSTTSGSTAYSLAAGGSMVHP  424



>ref|XP_009145525.1| PREDICTED: NAD(H) kinase 1 [Brassica rapa]
 emb|CDY61515.1| BnaAnng17540D [Brassica napus]
Length=528

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  343  SITLRHRLQCHIIRDKARHDYETEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  402

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  403  DGLILSTTSGSTAYSLAAGGSMVHP  427



>ref|XP_006406328.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
 gb|ESQ47781.1| hypothetical protein EUTSA_v10020469mg [Eutrema salsugineum]
Length=542

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  356  SITLRHRLQCHIIRDKARHDYETEENMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  415

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  416  DGLILSTTSGSTAYSLAAGGSMVHP  440



>emb|CDY32402.1| BnaC03g41860D [Brassica napus]
Length=536

 Score =   160 bits (406),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE   LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  344  SITLRHRLQCHIIRDKARHDYETEENTLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  403

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  404  DGLILSTTSGSTAYSLAAGGSMVHP  428



>ref|NP_188744.3| NAD(H) kinase 1 [Arabidopsis thaliana]
 gb|AEE76457.1| NAD(H) kinase 1 [Arabidopsis thaliana]
Length=530

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  346  SITLRHRLQCHIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  405

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  406  DGLILSTTSGSTAYSLAAGGSMVHP  430



>gb|AAM13987.1| unknown protein [Arabidopsis thaliana]
Length=557

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A +E+E E  MLVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  373  SITLRHRLQCHIIRDKATHEYEPEETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  432

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  433  DGLILSTTSGSTAYSLAAGGSMVHP  457



>ref|NP_001045444.2| Os01g0957000 [Oryza sativa Japonica Group]
 sp|Q5JK52.1|NADK1_ORYSJ RecName: Full=Probable NAD kinase 1 [Oryza sativa Japonica Group]
 dbj|BAD88145.1| ATP-NAD kinase family protein-like [Oryza sativa Japonica Group]
 dbj|BAG94271.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07358.2| Os01g0957000 [Oryza sativa Japonica Group]
Length=532

 Score =   159 bits (401),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  346  SITLRNRLQCHVIRDAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQG  405

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  406  DGLIISTTSGSTAYSLAAGGSMVHP  430



>emb|CDX82219.1| BnaA03g36020D [Brassica napus]
Length=529

 Score =   159 bits (401),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE   LVLNEVTIDRGISS+LTNLECYCDNSFVTCVQG
Sbjct  342  SITLRHRLQCHIIRDKARHDYETEENTLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQG  401

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  402  DGLILSTTSGSTAYSLAAGGSMVHP  426



>gb|EEE56031.1| hypothetical protein OsJ_04817 [Oryza sativa Japonica Group]
Length=571

 Score =   159 bits (401),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  385  SITLRNRLQCHVIRDAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQG  444

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  445  DGLIISTTSGSTAYSLAAGGSMVHP  469



>gb|EEC72189.1| hypothetical protein OsI_05264 [Oryza sativa Indica Group]
Length=571

 Score =   159 bits (401),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  385  SITLRNRLQCHVIRDAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQG  444

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  445  DGLIISTTSGSTAYSLAAGGSMVHP  469



>ref|XP_006646694.1| PREDICTED: probable NAD kinase 1-like [Oryza brachyantha]
Length=569

 Score =   157 bits (398),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCH+IRD AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  383  SITLRNRLQCHLIRDAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQG  442

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  443  DGLIISTTSGSTAYSLAAGGSMVHP  467



>dbj|BAJ98826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=653

 Score =   157 bits (398),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AK+E  TE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  467  SITLRNRLQCHVIRDAAKDELVTEDPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQG  526

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  527  DGLIISTTSGSTAYSLAAGGSMVHP  551



>ref|XP_009135723.1| PREDICTED: NAD(H) kinase 1-like [Brassica rapa]
Length=529

 Score =   157 bits (396),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCH+IRD A++++ETE   LVLNE TI+RGISS+LTNLECYCDNSFVTCVQG
Sbjct  342  SITLRHRLQCHIIRDKARHDYETEENTLVLNEATIERGISSYLTNLECYCDNSFVTCVQG  401

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  402  DGLILSTTSGSTAYSLAAGGSMVHP  426



>ref|XP_002459132.1| hypothetical protein SORBIDRAFT_03g046360 [Sorghum bicolor]
 gb|EES04252.1| hypothetical protein SORBIDRAFT_03g046360 [Sorghum bicolor]
Length=462

 Score =   155 bits (393),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+R+QCHVIRD AK+E  TE P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQG
Sbjct  276  SITLRNRIQCHVIRDAAKDEIMTEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQG  335

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  336  DGLIISTTSGSTAYSLAAGGSMVHP  360



>ref|XP_010938543.1| PREDICTED: probable NAD kinase 1 [Elaeis guineensis]
Length=532

 Score =   155 bits (393),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQC VIR+ AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVT VQG
Sbjct  345  SITLRHRLQCQVIREAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTLVQG  404

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  405  DGLILSTTSGSTAYSLAAGGSMVHP  429



>ref|XP_009391539.1| PREDICTED: putative NAD kinase 3 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQCHVIR+ AK+E +TE P+LVLNEVTIDRG+SS+LT LECYCD+SFVTCVQG
Sbjct  347  SITLRHRLQCHVIREAAKDELDTEEPILVLNEVTIDRGMSSYLTFLECYCDSSFVTCVQG  406

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  407  DGLILSTTSGSTAYSLAAGGSMVHP  431



>ref|XP_008782033.1| PREDICTED: probable NAD kinase 1 [Phoenix dactylifera]
Length=534

 Score =   154 bits (390),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLRHRLQC VIR+ AK+E ETE P+LVLNEVTIDRGISS+LT LECYCD+SFVT VQG
Sbjct  347  SITLRHRLQCQVIREAAKDELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTLVQG  406

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  407  DGLILSTTSGSTAYSLAAGGSMVHP  431



>gb|EMS47657.1| putative NAD kinase 1 [Triticum urartu]
Length=554

 Score =   154 bits (390),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AK+E  TE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  368  SITLRNRLQCHVIRDAAKDEIVTEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQG  427

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  428  DGLIISTTSGSTAYSLAAGGSMVHP  452



>ref|XP_003567496.2| PREDICTED: probable NAD kinase 1 [Brachypodium distachyon]
Length=573

 Score =   154 bits (390),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQC VIRD AK+E ETE P+L LNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  387  SITLRNRLQCRVIRDAAKDELETEEPILALNEVTIDRGISSYLTYLECYCDSSFVTCVQG  446

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  447  DGLIISTTSGSTAYSLAAGGSMVHP  471



>gb|EMT15186.1| Putative NAD kinase 1 [Aegilops tauschii]
Length=497

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AK+E  TE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  311  SITLRNRLQCHVIRDAAKDEIVTEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQG  370

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  371  DGLIISTTSGSTAYSLAAGGSMVHP  395



>ref|XP_004962207.1| PREDICTED: putative NAD kinase 3-like isoform X2 [Setaria italica]
Length=527

 Score =   154 bits (389),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR RL+CHV+RD AK+E E+E P+LVLNEVTIDRG+SS+LT LECYCD+SFVTCVQG
Sbjct  341  SITLRSRLKCHVVRDAAKDEVESEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTCVQG  400

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  401  DGLIISTTSGSTAYSLAAGGSMVHP  425



>ref|XP_004971313.1| PREDICTED: probable NAD kinase 1-like [Setaria italica]
Length=566

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+RLQCHVIRD AK+E  TE P+LVLNEVTIDRGISS+LT LECYCD+SFVTCVQG
Sbjct  380  SITLRNRLQCHVIRDAAKDELVTEDPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQG  439

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  440  DGLIISTTSGSTAYSLAAGGSMVHP  464



>gb|ACG29339.1| NAD kinase 1 [Zea mays]
Length=569

 Score =   154 bits (389),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+R+QCHVIRD AK+E  TE P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQG
Sbjct  383  SITLRNRIQCHVIRDAAKDEIVTEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQG  442

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  443  DGLIISTTSGSTAYSLAAGGSMVHP  467



>ref|NP_001278550.1| NAD kinase 1 [Zea mays]
 gb|ACN34598.1| unknown [Zea mays]
 gb|AFW83921.1| NAD kinase 1 [Zea mays]
Length=569

 Score =   154 bits (389),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+R+QCHVIRD AK+E  TE P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQG
Sbjct  383  SITLRNRIQCHVIRDAAKDEIVTEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQG  442

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  443  DGLIISTTSGSTAYSLAAGGSMVHP  467



>ref|XP_004962206.1| PREDICTED: putative NAD kinase 3-like isoform X1 [Setaria italica]
Length=529

 Score =   153 bits (387),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR RL+CHV+RD AK+E E+E P+LVLNEVTIDRG+SS+LT LECYCD+SFVTCVQG
Sbjct  343  SITLRSRLKCHVVRDAAKDEVESEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTCVQG  402

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  403  DGLIISTTSGSTAYSLAAGGSMVHP  427



>ref|XP_010231463.1| PREDICTED: putative NAD kinase 3 isoform X1 [Brachypodium distachyon]
Length=583

 Score =   153 bits (387),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ITLR RLQC VIRD AK+E ETE P++VLNE+TIDRG+SS+LT LECYCD+SFVTCVQGD
Sbjct  398  ITLRSRLQCQVIRDAAKDEVETEEPIIVLNEITIDRGMSSYLTYLECYCDSSFVTCVQGD  457

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLI+STTSGSTAYSLAAGGSMVHP
Sbjct  458  GLIISTTSGSTAYSLAAGGSMVHP  481



>ref|XP_003568558.1| PREDICTED: putative NAD kinase 3 isoform X2 [Brachypodium distachyon]
Length=548

 Score =   152 bits (385),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ITLR RLQC VIRD AK+E ETE P++VLNE+TIDRG+SS+LT LECYCD+SFVTCVQGD
Sbjct  363  ITLRSRLQCQVIRDAAKDEVETEEPIIVLNEITIDRGMSSYLTYLECYCDSSFVTCVQGD  422

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLI+STTSGSTAYSLAAGGSMVHP
Sbjct  423  GLIISTTSGSTAYSLAAGGSMVHP  446



>ref|NP_001151954.1| NAD kinase 1 [Zea mays]
 gb|ACG45132.1| NAD kinase 1 [Zea mays]
Length=565

 Score =   152 bits (384),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+R+QCHVIRD AK+E  +E P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQG
Sbjct  379  SITLRNRIQCHVIRDEAKDEIVSEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQG  438

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  439  DGLIISTTSGSTAYSLAAGGSMVHP  463



>tpg|DAA55769.1| TPA: NAD kinase 1 [Zea mays]
Length=565

 Score =   152 bits (384),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR+R+QCHVIRD AK+E  +E P LVLNEVTIDRGISS+LTNLE YCD+SFVTCVQG
Sbjct  379  SITLRNRIQCHVIRDEAKDEIVSEEPFLVLNEVTIDRGISSYLTNLEVYCDSSFVTCVQG  438

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  439  DGLIISTTSGSTAYSLAAGGSMVHP  463



>gb|EMS60742.1| Putative NAD kinase 3 [Triticum urartu]
Length=505

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ITLR RLQCHVIRD AK+E ET  P+LVLNEVTIDRG+SS+LT LECYCD+SFVTCVQGD
Sbjct  321  ITLRSRLQCHVIRDAAKDEVETGEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTCVQGD  380

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLI+STTSGSTAYSLAAGGSMVHP
Sbjct  381  GLIISTTSGSTAYSLAAGGSMVHP  404



>gb|EMT20687.1| Putative NAD kinase 3 [Aegilops tauschii]
Length=622

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ITLR RLQCHVIRD AK+E ET  P+LVLNEVTIDRG+SS+LT LECYCD+SFVTCVQGD
Sbjct  438  ITLRSRLQCHVIRDAAKDEVETGEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTCVQGD  497

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLI+STTSGSTAYSLAAGGSMVHP
Sbjct  498  GLIISTTSGSTAYSLAAGGSMVHP  521



>sp|Q60E60.2|NADK3_ORYSJ RecName: Full=Putative NAD kinase 3 [Oryza sativa Japonica Group]
Length=494

 Score =   147 bits (371),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ITLR RLQCHVI D+AKNE +TE P+LVLNEVTIDRG+SS+LT LECYCD+SFVT VQGD
Sbjct  309  ITLRSRLQCHVIYDSAKNEVDTEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTRVQGD  368

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLI+STTSGSTAYSLAAGGSMVHP
Sbjct  369  GLIISTTSGSTAYSLAAGGSMVHP  392



>ref|XP_006655275.1| PREDICTED: putative NAD kinase 3-like [Oryza brachyantha]
Length=520

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ITLR RLQCHVI D+AKNE ETE P+LVLNEVTIDRG+SS+LT LECYCD+SFVT VQGD
Sbjct  335  ITLRSRLQCHVICDSAKNEVETEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTRVQGD  394

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLI+STTSGSTAYSLAAGGSMVHP
Sbjct  395  GLIISTTSGSTAYSLAAGGSMVHP  418



>ref|XP_002439730.1| hypothetical protein SORBIDRAFT_09g019130 [Sorghum bicolor]
 gb|EES18160.1| hypothetical protein SORBIDRAFT_09g019130 [Sorghum bicolor]
Length=498

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +ITLR RLQCHVIRD AK + E E P+LVLNEVTIDRG+SS+LT LECYCD+S+VT VQG
Sbjct  312  SITLRSRLQCHVIRDAAKEQVENEQPILVLNEVTIDRGMSSYLTYLECYCDSSYVTRVQG  371

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+STTSGSTAYSLAAGGSMVHP
Sbjct  372  DGLIISTTSGSTAYSLAAGGSMVHP  396



>gb|EEC79147.1| hypothetical protein OsI_19811 [Oryza sativa Indica Group]
Length=442

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  LQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILST  55
            L CHVI D+AKNE +TE P+LVLNEVTIDRG+SS+LT LECYCD+SFVT VQGDGLI+ST
Sbjct  263  LWCHVIYDSAKNEVDTEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTRVQGDGLIIST  322

Query  54   TSGSTAYSLAAGGSMVHP  1
            TSGSTAYSLAAGGSMVHP
Sbjct  323  TSGSTAYSLAAGGSMVHP  340



>gb|AAV31342.1| unknown protein [Oryza sativa Japonica Group]
Length=419

 Score =   135 bits (340),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  LQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILST  55
            L CHVI D+AKNE +TE P+LVLNEVTIDRG+SS+LT LECYCD+SFVT VQGDGLI+ST
Sbjct  240  LWCHVIYDSAKNEVDTEEPILVLNEVTIDRGMSSYLTYLECYCDSSFVTRVQGDGLIIST  299

Query  54   TSGSTAYSLAAGGSMVHP  1
            TSGSTAYSLAAGGSMVHP
Sbjct  300  TSGSTAYSLAAGGSMVHP  317



>gb|EYU31388.1| hypothetical protein MIMGU_mgv1a004907mg [Erythranthe guttata]
Length=505

 Score =   134 bits (337),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 74/86 (86%), Gaps = 5/86 (6%)
 Frame = -3

Query  255  NITLRHRLQCHVIR-DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            NI LRHRLQCH+IR D AK    +EGP+LVLNEVTIDRG+S FLT L+CY D +FVT VQ
Sbjct  322  NIMLRHRLQCHIIRRDAAK----SEGPILVLNEVTIDRGVSPFLTYLKCYWDGTFVTDVQ  377

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLILSTTSGSTAYS+AAGGSMVHP
Sbjct  378  GDGLILSTTSGSTAYSVAAGGSMVHP  403



>gb|KCW51160.1| hypothetical protein EUGRSUZ_J00752 [Eucalyptus grandis]
Length=304

 Score =   131 bits (329),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRD-TAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            ITLR RLQC ++RD  A+NE  T   + VLNEVTIDRG S +LTNL+CYCD+ +VT VQG
Sbjct  101  ITLRRRLQCQIVRDLAAENENATAKKIFVLNEVTIDRGQSPYLTNLKCYCDDKYVTSVQG  160

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  161  DGLILSTTSGSTAYSLAAGGSMVHP  185



>ref|XP_010034271.1| PREDICTED: NAD(H) kinase 1-like [Eucalyptus grandis]
Length=472

 Score =   131 bits (330),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRD-TAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            ITLR RLQC ++RD  A+NE  T   + VLNEVTIDRG S +LTNL+CYCD+ +VT VQG
Sbjct  269  ITLRRRLQCQIVRDLAAENENATAKKIFVLNEVTIDRGQSPYLTNLKCYCDDKYVTSVQG  328

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  329  DGLILSTTSGSTAYSLAAGGSMVHP  353



>ref|XP_002963632.1| hypothetical protein SELMODRAFT_80525, partial [Selaginella moellendorffii]
 ref|XP_002974720.1| hypothetical protein SELMODRAFT_101714, partial [Selaginella 
moellendorffii]
 gb|EFJ24240.1| hypothetical protein SELMODRAFT_101714, partial [Selaginella 
moellendorffii]
 gb|EFJ35503.1| hypothetical protein SELMODRAFT_80525, partial [Selaginella moellendorffii]
Length=345

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ITLRHR+QC ++R+   +  E     LVLNEV+IDRG+SS LTNLECYCDN F+T VQGD
Sbjct  175  ITLRHRMQCQIVRNGESSASEMH---LVLNEVSIDRGMSSCLTNLECYCDNVFLTSVQGD  231

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLILSTTSGSTAYSLAAGGSMVHP
Sbjct  232  GLILSTTSGSTAYSLAAGGSMVHP  255



>ref|XP_001762814.1| predicted protein [Physcomitrella patens]
 gb|EDQ72315.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRD---TAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            ITLRHRL C +IR+     + +   E   LVLNE+ IDRG+SSFLTNLECYCD+ F+T V
Sbjct  295  ITLRHRLHCQIIRNPEAVKEGDDPCEETHLVLNEIAIDRGMSSFLTNLECYCDDIFLTSV  354

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLILST SGSTAYSLAAGGSMVHP
Sbjct  355  QGDGLILSTPSGSTAYSLAAGGSMVHP  381



>gb|KCW51159.1| hypothetical protein EUGRSUZ_J00751 [Eucalyptus grandis]
Length=342

 Score =   122 bits (307),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTA-KNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            ITLR RLQCHV+R  A K + E +  +LVLNEVTIDRG   +LT L+C CD S +T VQG
Sbjct  135  ITLRRRLQCHVVRHLADKGKAEEDENILVLNEVTIDRGQGGYLTKLQCECDGSEITTVQG  194

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  195  DGLILSTTSGSTAYSLAAGGSMVHP  219



>ref|XP_010031774.1| PREDICTED: putative NAD kinase 3 isoform X2 [Eucalyptus grandis]
Length=672

 Score =   122 bits (307),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTA-KNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            ITLR RLQCHV+R  A K + E +  +LVLNEVTIDRG   +LT L+C CD S +T VQG
Sbjct  465  ITLRRRLQCHVVRHLADKGKAEEDENILVLNEVTIDRGQGGYLTKLQCECDGSEITTVQG  524

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  525  DGLILSTTSGSTAYSLAAGGSMVHP  549



>ref|XP_010031773.1| PREDICTED: putative NAD kinase 3 isoform X1 [Eucalyptus grandis]
Length=674

 Score =   122 bits (307),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTA-KNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            ITLR RLQCHV+R  A K + E +  +LVLNEVTIDRG   +LT L+C CD S +T VQG
Sbjct  467  ITLRRRLQCHVVRHLADKGKAEEDENILVLNEVTIDRGQGGYLTKLQCECDGSEITTVQG  526

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLILSTTSGSTAYSLAAGGSMVHP
Sbjct  527  DGLILSTTSGSTAYSLAAGGSMVHP  551



>ref|XP_001758345.1| predicted protein [Physcomitrella patens]
 gb|EDQ76747.1| predicted protein [Physcomitrella patens]
Length=463

 Score =   120 bits (301),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 58/87 (67%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIR---DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            ITLRHRL C +IR   +T  N        LVLNEV+IDRG+SS L+NLEC+CD  FVT V
Sbjct  272  ITLRHRLHCQIIRHDRETDDNTSSESAEYLVLNEVSIDRGMSSALSNLECFCDGHFVTIV  331

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+S+ SGSTAYSLAAGGS+VHP
Sbjct  332  QGDGLIISSPSGSTAYSLAAGGSVVHP  358



>ref|XP_002949486.1| hypothetical protein VOLCADRAFT_59341 [Volvox carteri f. nagariensis]
 gb|EFJ49505.1| hypothetical protein VOLCADRAFT_59341 [Volvox carteri f. nagariensis]
Length=231

 Score =   116 bits (291),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 9/84 (11%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            I LRHRL CH++R             +VLNEV IDRGISSFLTNLECYCD +FVT VQGD
Sbjct  57   IMLRHRLHCHIVRAAE---------WVVLNEVVIDRGISSFLTNLECYCDGTFVTHVQGD  107

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLI++T +GSTAY+LAAGGSMVHP
Sbjct  108  GLIVATPTGSTAYNLAAGGSMVHP  131



>ref|XP_002965137.1| hypothetical protein SELMODRAFT_83370 [Selaginella moellendorffii]
 gb|EFJ33975.1| hypothetical protein SELMODRAFT_83370 [Selaginella moellendorffii]
Length=376

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 4/88 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFET----EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTC  85
            IT+RHRL C +IR ++ ++       E   +VLNEV IDRG+SSFLTNLECYCDN FVT 
Sbjct  185  ITIRHRLHCRIIRHSSSSKSRKKQAGEEVYIVLNEVAIDRGMSSFLTNLECYCDNIFVTN  244

Query  84   VQGDGLILSTTSGSTAYSLAAGGSMVHP  1
            VQGDGLILST SGSTAYSL+AGGSMVHP
Sbjct  245  VQGDGLILSTPSGSTAYSLSAGGSMVHP  272



>ref|XP_002962223.1| hypothetical protein SELMODRAFT_76799 [Selaginella moellendorffii]
 gb|EFJ37483.1| hypothetical protein SELMODRAFT_76799 [Selaginella moellendorffii]
Length=378

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 4/88 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFET----EGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTC  85
            IT+RHRL C +IR ++ ++       E   +VLNEV IDRG+SSFLTNLECYCDN FVT 
Sbjct  187  ITIRHRLHCRIIRHSSSSKSRKKQAGEEVYIVLNEVAIDRGMSSFLTNLECYCDNIFVTN  246

Query  84   VQGDGLILSTTSGSTAYSLAAGGSMVHP  1
            VQGDGLILST SGSTAYSL+AGGSMVHP
Sbjct  247  VQGDGLILSTPSGSTAYSLSAGGSMVHP  274



>ref|XP_001765616.1| predicted protein [Physcomitrella patens]
 gb|EDQ69666.1| predicted protein [Physcomitrella patens]
Length=512

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 69/89 (78%), Gaps = 6/89 (7%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPM-----LVLNEVTIDRGISSFLTNLECYCDNSFVT  88
            ITLRHRL C ++R+  K + E E P      LVLNEV I RG+SS L+NLECYCD +FVT
Sbjct  322  ITLRHRLHCQILRNPDKVK-EGEDPCESEVHLVLNEVAIHRGMSSNLSNLECYCDGNFVT  380

Query  87   CVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             VQGDGLILST SGSTAYSLAAGGSMVHP
Sbjct  381  SVQGDGLILSTPSGSTAYSLAAGGSMVHP  409



>ref|XP_001703150.1| hypothetical protein CHLREDRAFT_123446 [Chlamydomonas reinhardtii]
 gb|EDO96615.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=160

 Score = 99.8 bits (247),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  177  MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             +VLNEV IDRGIS FLTNLECYCD S VT VQGDGLI++T +GSTAY+LAAGGSMVHP
Sbjct  2    WVVLNEVVIDRGISPFLTNLECYCDGSLVTHVQGDGLIVATPTGSTAYNLAAGGSMVHP  60



>ref|XP_005715738.1| unnamed protein product [Chondrus crispus]
 emb|CDF35919.1| unnamed protein product [Chondrus crispus]
Length=738

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 7/86 (8%)
 Frame = -3

Query  255  NITLRHRLQCHVIR-DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            N++LR RL C ++R D  + EFE      VLNEV +DRG S +L NL+C+CD  ++T VQ
Sbjct  523  NLSLRMRLTCRIVRGDEIRKEFE------VLNEVVVDRGSSPYLCNLDCFCDGKYITTVQ  576

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
             DG+I+ST +GSTAYS++AGGSMVHP
Sbjct  577  ADGIIMSTPTGSTAYSMSAGGSMVHP  602



>dbj|BAM19258.1| poly(p)/ATP NAD kinase [Papilio polytes]
Length=414

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RLQC V+R T+  +   + P  +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  202  LTLRSRLQCVVLRKTSNEDNNKKKPTTILVLNEVVVDRGPSPYLSNIDLFLDGKHITSVQ  261

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  262  GDGLIVSTPTGSTAYAVAAGASMIHP  287



>gb|EHJ64249.1| hypothetical protein KGM_07251 [Danaus plexippus]
Length=411

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RLQC V+R   ++  E + P  +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  201  LTLRSRLQCVVLRKIPEDGKEKKKPTTILVLNEVVVDRGPSPYLSNIDLFLDGKHITSVQ  260

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  261  GDGLIVSTPTGSTAYAVAAGASMIHP  286



>ref|XP_004997035.1| poly(p)/ATP nad kinase [Salpingoeca rosetta]
 gb|EGD81831.1| poly(p)/ATP nad kinase [Salpingoeca rosetta]
Length=615

 Score =   100 bits (248),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 64/100 (64%), Gaps = 16/100 (16%)
 Frame = -3

Query  252  ITLRHRLQCHVI-------------RDTAKNEFETEGPM---LVLNEVTIDRGISSFLTN  121
            +TLR RL C+VI             R ++   F    P+    +LNEV IDRG S +LTN
Sbjct  408  VTLRLRLHCNVIEPPLPPSERKRFERSSSDANFVEANPIPEYEILNEVVIDRGPSPYLTN  467

Query  120  LECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
            L+ Y   S VTCVQGDGLI++T +GSTAYSLAAGGSMVHP
Sbjct  468  LDVYVGGSLVTCVQGDGLIIATPTGSTAYSLAAGGSMVHP  507



>gb|AHK10563.1| NADK protein 1, partial [Bombyx mori]
Length=361

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RLQC V+R +  +  + + P  +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  150  LTLRSRLQCVVLRKSQDDNKDKKKPTTILVLNEVVVDRGPSPYLSNIDLFLDGKHITSVQ  209

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  210  GDGLIVSTPTGSTAYAVAAGASMIHP  235



>ref|XP_006615114.1| PREDICTED: NAD kinase-like isoform X10 [Apis dorsata]
Length=381

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  262  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  320

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  321  QGDGLIVSTPTGSTAYAVAAGASMIHP  347



>ref|XP_004926313.1| PREDICTED: NAD kinase-like isoform X3 [Bombyx mori]
Length=411

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RLQC V+R +  +  + + P  +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  200  LTLRSRLQCVVLRKSQDDNKDKKKPTTILVLNEVVVDRGPSPYLSNIDLFLDGKHITSVQ  259

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  260  GDGLIVSTPTGSTAYAVAAGASMIHP  285



>ref|XP_006564945.1| PREDICTED: NAD kinase-like isoform X10 [Apis mellifera]
 ref|XP_006615113.1| PREDICTED: NAD kinase-like isoform X9 [Apis dorsata]
Length=389

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  184  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  242

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  243  QGDGLIVSTPTGSTAYAVAAGASMIHP  269



>ref|XP_004926312.1| PREDICTED: NAD kinase-like isoform X2 [Bombyx mori]
Length=418

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RLQC V+R +  +  + + P  +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  207  LTLRSRLQCVVLRKSQDDNKDKKKPTTILVLNEVVVDRGPSPYLSNIDLFLDGKHITSVQ  266

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  267  GDGLIVSTPTGSTAYAVAAGASMIHP  292



>ref|XP_006564943.1| PREDICTED: NAD kinase-like isoform X8 [Apis mellifera]
 ref|XP_006615111.1| PREDICTED: NAD kinase-like isoform X7 [Apis dorsata]
Length=418

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  213  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  271

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  272  QGDGLIVSTPTGSTAYAVAAGASMIHP  298



>gb|KIZ05631.1| NAD+ kinase [Monoraphidium neglectum]
Length=938

 Score =   100 bits (248),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  LVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
            +VLNEV +DRGIS FLTNLE YCD +FVT VQGDGLI++T +GSTAYSLAAGGSMVHP
Sbjct  780  VVLNEVVLDRGISPFLTNLETYCDGNFVTHVQGDGLIVATPTGSTAYSLAAGGSMVHP  837



>gb|EFX83515.1| hypothetical protein DAPPUDRAFT_187852 [Daphnia pulex]
Length=366

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R        T+ P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  155  LTLRSRLRCIILRKDEATGKPTKAPTSLLVLNEVVIDRGPSPYLSNIDLYLDGKHITSVQ  214

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  215  GDGLIVSTPTGSTAYAVAAGASMIHP  240



>ref|XP_005708614.1| NAD+ kinase [Galdieria sulphuraria]
 gb|EME32094.1| NAD+ kinase [Galdieria sulphuraria]
Length=738

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 7/85 (8%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDT-AKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            ++LR RL C +++    K EF+      +LNEV +DRG S +L NL+C+CDN ++T VQ 
Sbjct  559  LSLRMRLLCTLLKKGYPKKEFQ------ILNEVVVDRGASPYLCNLDCFCDNKYITTVQA  612

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG+I+ST +GSTAYS++AGGSMVHP
Sbjct  613  DGIIMSTPTGSTAYSMSAGGSMVHP  637



>ref|XP_006564944.1| PREDICTED: NAD kinase-like isoform X9 [Apis mellifera]
 ref|XP_006615112.1| PREDICTED: NAD kinase-like isoform X8 [Apis dorsata]
Length=405

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  200  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  258

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  259  QGDGLIVSTPTGSTAYAVAAGASMIHP  285



>gb|AHK10564.1| NADK protein 2, partial [Bombyx mori]
Length=361

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RLQC V+R +  +  + + P  +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  150  LTLRSRLQCVVLRKSQDDNKDKKKPTTILVLNEVVVDRGPSPYLSNIDLFLDGKHITSVQ  209

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  210  GDGLIVSTPTGSTAYAVAAGASMIHP  235



>ref|XP_004926311.1| PREDICTED: NAD kinase-like isoform X1 [Bombyx mori]
Length=430

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RLQC V+R +  +  + + P  +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  219  LTLRSRLQCVVLRKSQDDNKDKKKPTTILVLNEVVVDRGPSPYLSNIDLFLDGKHITSVQ  278

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  279  GDGLIVSTPTGSTAYAVAAGASMIHP  304



>ref|XP_001654785.1| AAEL000278-PA, partial [Aedes aegypti]
 gb|EAT48715.1| AAEL000278-PA, partial [Aedes aegypti]
Length=392

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 8/92 (9%)
 Frame = -3

Query  252  ITLRHRLQCHVIR-DTAKNEFET----EGP---MLVLNEVTIDRGISSFLTNLECYCDNS  97
            +TLR RL+C ++R D  + E  T    + P   +LVLNEV IDRG+SS+L+N++ + D  
Sbjct  175  LTLRSRLRCIIVRKDKTEQEISTFKSSQDPTTNILVLNEVVIDRGLSSYLSNIDLFLDGK  234

Query  96   FVTCVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             +T VQGDGLI+ST +GSTAYS AAG SM+HP
Sbjct  235  HITSVQGDGLIVSTPTGSTAYSAAAGASMIHP  266



>ref|XP_001868717.1| poly(p)/ATP NAD kinase [Culex quinquefasciatus]
 gb|EDS27527.1| poly(p)/ATP NAD kinase [Culex quinquefasciatus]
Length=470

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 50/92 (54%), Positives = 66/92 (72%), Gaps = 8/92 (9%)
 Frame = -3

Query  252  ITLRHRLQCHVIR-DTAKNEFET----EGP---MLVLNEVTIDRGISSFLTNLECYCDNS  97
            +TLR RL+C ++R D  + E  T    + P   +LVLNEV IDRG+SS+LTN++ + D  
Sbjct  253  LTLRSRLRCIIVRKDKTEQEISTFKSSQDPTTNILVLNEVVIDRGMSSYLTNIDLFLDGK  312

Query  96   FVTCVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             +T VQGDGLI+ST +GSTAYS AAG SM+HP
Sbjct  313  HITSVQGDGLIVSTPTGSTAYSAAAGASMIHP  344



>ref|XP_008470542.1| PREDICTED: NAD kinase-like isoform X12 [Diaphorina citri]
 ref|XP_008470543.1| PREDICTED: NAD kinase-like isoform X12 [Diaphorina citri]
 ref|XP_008470544.1| PREDICTED: NAD kinase-like isoform X12 [Diaphorina citri]
 ref|XP_008470545.1| PREDICTED: NAD kinase-like isoform X12 [Diaphorina citri]
Length=364

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  155  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  214

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  215  GDGLIVSTPTGSTAYAVAAGASMIHP  240



>ref|XP_011253168.1| PREDICTED: NAD kinase isoform X6 [Camponotus floridanus]
Length=417

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  213  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  271

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  272  GDGLIVSTPTGSTAYAVAAGASMIHP  297



>ref|XP_006564942.1| PREDICTED: NAD kinase-like isoform X7 [Apis mellifera]
 ref|XP_006615110.1| PREDICTED: NAD kinase-like isoform X6 [Apis dorsata]
Length=426

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  221  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  279

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  280  QGDGLIVSTPTGSTAYAVAAGASMIHP  306



>ref|XP_006615106.1| PREDICTED: NAD kinase-like isoform X2 [Apis dorsata]
 ref|XP_006615107.1| PREDICTED: NAD kinase-like isoform X3 [Apis dorsata]
 ref|XP_006615108.1| PREDICTED: NAD kinase-like isoform X4 [Apis dorsata]
Length=452

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  247  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  305

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  306  QGDGLIVSTPTGSTAYAVAAGASMIHP  332



>ref|XP_006564938.1| PREDICTED: NAD kinase-like isoform X3 [Apis mellifera]
 ref|XP_006564939.1| PREDICTED: NAD kinase-like isoform X4 [Apis mellifera]
 ref|XP_006564940.1| PREDICTED: NAD kinase-like isoform X5 [Apis mellifera]
 ref|XP_006564941.1| PREDICTED: NAD kinase-like isoform X6 [Apis mellifera]
Length=452

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  247  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  305

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  306  QGDGLIVSTPTGSTAYAVAAGASMIHP  332



>ref|XP_008470541.1| PREDICTED: NAD kinase-like isoform X11 [Diaphorina citri]
Length=387

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  178  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  237

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  238  GDGLIVSTPTGSTAYAVAAGASMIHP  263



>ref|XP_011058885.1| PREDICTED: NAD kinase-like isoform X7 [Acromyrmex echinatior]
Length=378

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  237  LTLRSRLRCIIIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  295

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  296  GDGLIVSTPTGSTAYAVAAGASMIHP  321



>ref|XP_008470539.1| PREDICTED: NAD kinase-like isoform X9 [Diaphorina citri]
Length=420

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  211  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  270

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  271  GDGLIVSTPTGSTAYAVAAGASMIHP  296



>ref|XP_004517709.1| PREDICTED: NAD kinase-like isoform X2 [Ceratitis capitata]
Length=599

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKN-EFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +TLR RL+C + R + ++ E E+E  +LVLNEV IDRG S +L+N++ + D  ++T VQG
Sbjct  389  LTLRSRLRCIIYRKSDRSRETESETNILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQG  448

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+ST +GSTAY++AAG SM+HP
Sbjct  449  DGLIVSTPTGSTAYAVAAGASMIHP  473



>ref|XP_002063997.1| GK15608 [Drosophila willistoni]
 gb|EDW74983.1| GK15608 [Drosophila willistoni]
Length=475

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEF-ETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTC  85
            +TLR RL+C + R + K +   TE P   +LVLNEV IDRG S +L+N++ + D  ++T 
Sbjct  264  LTLRSRLRCVMHRKSEKRQLIHTEAPPNSILVLNEVVIDRGPSPYLSNIDLFLDGKYITS  323

Query  84   VQGDGLILSTTSGSTAYSLAAGGSMVHP  1
            VQGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  324  VQGDGLIVSTPTGSTAYAVAAGASMIHP  351



>ref|XP_392018.3| PREDICTED: NAD kinase-like isoformX1 [Apis mellifera]
 ref|XP_003694814.1| PREDICTED: NAD kinase-like [Apis florea]
 ref|XP_006615109.1| PREDICTED: NAD kinase-like isoform X5 [Apis dorsata]
Length=436

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  231  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  289

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  290  QGDGLIVSTPTGSTAYAVAAGASMIHP  316



>ref|XP_008470538.1| PREDICTED: NAD kinase-like isoform X8 [Diaphorina citri]
Length=420

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  211  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  270

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  271  GDGLIVSTPTGSTAYAVAAGASMIHP  296



>ref|XP_008470530.1| PREDICTED: NAD kinase-like isoform X1 [Diaphorina citri]
Length=511

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  302  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  361

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  362  GDGLIVSTPTGSTAYAVAAGASMIHP  387



>ref|XP_008470540.1| PREDICTED: NAD kinase-like isoform X10 [Diaphorina citri]
Length=412

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  203  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  262

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  263  GDGLIVSTPTGSTAYAVAAGASMIHP  288



>ref|XP_008470533.1| PREDICTED: NAD kinase-like isoform X3 [Diaphorina citri]
Length=511

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  302  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  361

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  362  GDGLIVSTPTGSTAYAVAAGASMIHP  387



>ref|XP_011253171.1| PREDICTED: NAD kinase isoform X9 [Camponotus floridanus]
Length=359

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  155  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  213

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  214  GDGLIVSTPTGSTAYAVAAGASMIHP  239



>ref|XP_011253169.1| PREDICTED: NAD kinase isoform X7 [Camponotus floridanus]
Length=397

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  193  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  251

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  252  GDGLIVSTPTGSTAYAVAAGASMIHP  277



>ref|XP_005833010.1| hypothetical protein GUITHDRAFT_163085 [Guillardia theta CCMP2712]
 gb|EKX46030.1| hypothetical protein GUITHDRAFT_163085 [Guillardia theta CCMP2712]
Length=409

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            + +R RL C V  D  +   +     + LNEV++DRG S +LTN+EC+CD+ FV   QGD
Sbjct  216  VEIRTRLWCTVHNDMRRKIAD----FITLNEVSVDRGPSPYLTNIECFCDDRFVCASQGD  271

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            G+I++T +GSTAYSLAAGGSMVHP
Sbjct  272  GIIVATPTGSTAYSLAAGGSMVHP  295



>ref|XP_011058884.1| PREDICTED: NAD kinase-like isoform X6 [Acromyrmex echinatior]
Length=386

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  182  LTLRSRLRCIIIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  240

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  241  GDGLIVSTPTGSTAYAVAAGASMIHP  266



>ref|XP_006564937.1| PREDICTED: NAD kinase-like isoform X2 [Apis mellifera]
 ref|XP_006615105.1| PREDICTED: NAD kinase-like isoform X1 [Apis dorsata]
Length=467

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C ++R   +N+ ET+ P   +LVLNEV +DRG S +L+N++ + D   VT V
Sbjct  262  LTLRSRLKCIIMRKGEENK-ETKPPRTELLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSV  320

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  321  QGDGLIVSTPTGSTAYAVAAGASMIHP  347



>ref|XP_011253167.1| PREDICTED: NAD kinase isoform X5 [Camponotus floridanus]
Length=417

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  213  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  271

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  272  GDGLIVSTPTGSTAYAVAAGASMIHP  297



>ref|XP_011253170.1| PREDICTED: NAD kinase isoform X8 [Camponotus floridanus]
Length=386

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  182  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  240

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  241  GDGLIVSTPTGSTAYAVAAGASMIHP  266



>ref|XP_011253163.1| PREDICTED: NAD kinase isoform X1 [Camponotus floridanus]
Length=440

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  236  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  294

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  295  GDGLIVSTPTGSTAYAVAAGASMIHP  320



>ref|XP_011253164.1| PREDICTED: NAD kinase isoform X2 [Camponotus floridanus]
 gb|EFN70415.1| NAD kinase [Camponotus floridanus]
Length=440

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  236  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  294

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  295  GDGLIVSTPTGSTAYAVAAGASMIHP  320



>ref|XP_011058883.1| PREDICTED: NAD kinase-like isoform X5 [Acromyrmex echinatior]
Length=403

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  199  LTLRSRLRCIIIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  257

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  258  GDGLIVSTPTGSTAYAVAAGASMIHP  283



>ref|XP_011058881.1| PREDICTED: NAD kinase-like isoform X4 [Acromyrmex echinatior]
 ref|XP_011058882.1| PREDICTED: NAD kinase-like isoform X4 [Acromyrmex echinatior]
Length=417

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  213  LTLRSRLRCIIIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  271

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  272  GDGLIVSTPTGSTAYAVAAGASMIHP  297



>ref|XP_008470537.1| PREDICTED: NAD kinase-like isoform X7 [Diaphorina citri]
Length=442

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  233  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  292

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  293  GDGLIVSTPTGSTAYAVAAGASMIHP  318



>ref|XP_011058878.1| PREDICTED: NAD kinase-like isoform X1 [Acromyrmex echinatior]
Length=441

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  237  LTLRSRLRCIIIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  295

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  296  GDGLIVSTPTGSTAYAVAAGASMIHP  321



>ref|XP_011058879.1| PREDICTED: NAD kinase-like isoform X2 [Acromyrmex echinatior]
Length=441

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  237  LTLRSRLRCIIIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  295

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  296  GDGLIVSTPTGSTAYAVAAGASMIHP  321



>gb|KFM72467.1| hypothetical protein X975_06244, partial [Stegodyphus mimosarum]
Length=410

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIR--DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R  +T +   +     LVLNEV +DRG S +L+N++ Y D   VT VQ
Sbjct  203  LTLRSRLRCIIVRHSETGEKSNKPHASFLVLNEVVVDRGPSPYLSNIDLYLDGKHVTTVQ  262

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  263  GDGLIVSTPTGSTAYAVAAGASMIHP  288



>ref|XP_011058880.1| PREDICTED: NAD kinase-like isoform X3 [Acromyrmex echinatior]
 gb|EGI62840.1| NAD kinase [Acromyrmex echinatior]
Length=435

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C +IR    ++  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  231  LTLRSRLRCIIIRKNEDSQL-TEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  289

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  290  GDGLIVSTPTGSTAYAVAAGASMIHP  315



>ref|XP_002424361.1| NADH kinase, putative [Pediculus humanus corporis]
 gb|EEB11623.1| NADH kinase, putative [Pediculus humanus corporis]
Length=426

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 67/86 (78%), Gaps = 6/86 (7%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +NE E++ P  +LVLNEV +DRG S +L+N++ + D  ++T VQ
Sbjct  221  LTLRSRLRCIILR---RNE-ESKSPTSLLVLNEVVVDRGPSPYLSNIDLFLDGKYITSVQ  276

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  277  GDGLIVSTPTGSTAYAVAAGASMIHP  302



>ref|XP_002405188.1| sugar kinase, putative [Ixodes scapularis]
 gb|EEC10066.1| sugar kinase, putative [Ixodes scapularis]
Length=351

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIR---DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C + R   D+  N        LVLNEV +DRG S +L+N++ Y D   +T V
Sbjct  150  LTLRSRLRCTIYRSENDSNDNNLCNNSSCLVLNEVVVDRGPSPYLSNIDLYLDGKLITTV  209

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  210  QGDGLIVSTPTGSTAYAVAAGASMIHP  236



>ref|XP_001700866.1| ATP-NAD kinase [Chlamydomonas reinhardtii]
 gb|EDP07120.1| ATP-NAD kinase [Chlamydomonas reinhardtii]
Length=486

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 3/84 (4%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            +TLR RL C V R   K   + E  + VLNE+ IDRG S+FLTN+ECY    F++ VQ D
Sbjct  265  VTLRMRLSCEVWR---KGSRQPEQVVEVLNEMVIDRGSSAFLTNIECYEKGRFISRVQAD  321

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            G++L+T +GSTAYS+AAGGSMVHP
Sbjct  322  GIMLATPTGSTAYSVAAGGSMVHP  345



>ref|XP_011253165.1| PREDICTED: NAD kinase isoform X3 [Camponotus floridanus]
Length=437

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  233  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  291

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  292  GDGLIVSTPTGSTAYAVAAGASMIHP  317



>gb|KFB51324.1| AGAP011122-PA-like protein [Anopheles sinensis]
Length=610

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 8/92 (9%)
 Frame = -3

Query  252  ITLRHRLQCHVIR-DTAKNEFET----EGP---MLVLNEVTIDRGISSFLTNLECYCDNS  97
            +TLR RL+C ++R D  + E  T    + P   +LVLNEV IDRG+SS+L+N++ + D  
Sbjct  393  LTLRSRLRCIIVRKDKTEQEISTFKSSQDPSTNILVLNEVVIDRGLSSYLSNIDLFLDGK  452

Query  96   FVTCVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             +T VQGDGLI+ST +GSTAYS AAG SM+HP
Sbjct  453  HITSVQGDGLIVSTPTGSTAYSAAAGASMIHP  484



>ref|XP_008470531.1| PREDICTED: NAD kinase-like isoform X2 [Diaphorina citri]
Length=511

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N + Y D   +T VQ
Sbjct  302  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNTDLYLDGKLITSVQ  361

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  362  GDGLIVSTPTGSTAYAVAAGASMIHP  387



>ref|XP_011253166.1| PREDICTED: NAD kinase isoform X4 [Camponotus floridanus]
Length=423

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   + +  TE P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  219  LTLRSRLRCVIVRKNEEGQ-PTEPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  277

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  278  GDGLIVSTPTGSTAYAVAAGASMIHP  303



>ref|XP_008470536.1| PREDICTED: NAD kinase-like isoform X6 [Diaphorina citri]
Length=457

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  248  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  307

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  308  GDGLIVSTPTGSTAYAVAAGASMIHP  333



>ref|XP_008470535.1| PREDICTED: NAD kinase-like isoform X5 [Diaphorina citri]
Length=459

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  250  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  309

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  310  GDGLIVSTPTGSTAYAVAAGASMIHP  335



>ref|XP_008197014.1| PREDICTED: NAD kinase-like isoform X6 [Tribolium castaneum]
Length=377

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIR--DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R  D  K   +    +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  236  LTLRSRLRCIIMRKGDDEKKTSKQPTNLLVLNEVVVDRGPSPYLSNIDLFLDGKLITSVQ  295

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  296  GDGLIVSTPTGSTAYAVAAGASMIHP  321



>ref|XP_008470534.1| PREDICTED: NAD kinase-like isoform X4 [Diaphorina citri]
Length=487

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +   + + P  +LVLNEV IDRG S +L+N++ Y D   +T VQ
Sbjct  278  LTLRSRLRCIIMRKNEETAKDAKPPTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQ  337

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  338  GDGLIVSTPTGSTAYAVAAGASMIHP  363



>ref|XP_001942930.2| PREDICTED: NAD kinase-like isoform X8 [Acyrthosiphon pisum]
Length=481

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 7/87 (8%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C +++   KNE + + P   +LVLNEV IDRG S +L+N++ + D  ++T V
Sbjct  274  LTLRSRLRCIIVK---KNE-DKDKPQPNLLVLNEVVIDRGPSPYLSNIDLFLDRKYITSV  329

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  330  QGDGLIISTPTGSTAYAVAAGASMIHP  356



>gb|ETN65711.1| hypothetical protein AND_002517 [Anopheles darlingi]
Length=847

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 8/92 (9%)
 Frame = -3

Query  252  ITLRHRLQCHVIR-DTAKNEFET----EGP---MLVLNEVTIDRGISSFLTNLECYCDNS  97
            +TLR RL+C ++R D  + E  T    + P   +LVLNEV IDRG+SS+L+N++ + D  
Sbjct  587  LTLRSRLRCIIVRKDKTEQEISTFKSSQDPSNNILVLNEVVIDRGLSSYLSNIDLFLDGK  646

Query  96   FVTCVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             +T VQGDGLI+ST +GSTAYS AAG SM+HP
Sbjct  647  HITSVQGDGLIVSTPTGSTAYSAAAGASMIHP  678



>gb|KDR22109.1| hypothetical protein L798_02072, partial [Zootermopsis nevadensis]
Length=292

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +    ++ P  +LVLNEV IDRG S +L+N++ + D   +T VQ
Sbjct  175  LTLRSRLRCIIMRKNDELSKSSKPPTNLLVLNEVVIDRGPSPYLSNIDLFLDGKHITSVQ  234

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  235  GDGLIVSTPTGSTAYAVAAGASMIHP  260



>ref|XP_005537945.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81909.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=511

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 8/87 (9%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML---VLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL C + +D      + + P++   VLNEV +DRG + FL+NLECYCD+  VT +
Sbjct  237  VTLRMRLDCAIYKDG-----DGQRPLIQKTVLNEVVVDRGPAPFLSNLECYCDDFPVTRI  291

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            Q DG+IL+T +GSTAYSL++ GSMVHP
Sbjct  292  QADGVILATPTGSTAYSLSSNGSMVHP  318



>ref|XP_008188401.1| PREDICTED: NAD kinase-like isoform X7 [Acyrthosiphon pisum]
 ref|XP_008188402.1| PREDICTED: NAD kinase-like isoform X7 [Acyrthosiphon pisum]
Length=362

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 7/87 (8%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C +++   KNE + + P   +LVLNEV IDRG S +L+N++ + D  ++T V
Sbjct  155  LTLRSRLRCIIVK---KNE-DKDKPQPNLLVLNEVVIDRGPSPYLSNIDLFLDRKYITSV  210

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  211  QGDGLIISTPTGSTAYAVAAGASMIHP  237



>ref|XP_008188400.1| PREDICTED: NAD kinase-like isoform X6 [Acyrthosiphon pisum]
Length=395

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 7/87 (8%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C +++   KNE + + P   +LVLNEV IDRG S +L+N++ + D  ++T V
Sbjct  188  LTLRSRLRCIIVK---KNE-DKDKPQPNLLVLNEVVIDRGPSPYLSNIDLFLDRKYITSV  243

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  244  QGDGLIISTPTGSTAYAVAAGASMIHP  270



>ref|XP_008197013.1| PREDICTED: NAD kinase-like isoform X5 [Tribolium castaneum]
Length=385

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIR--DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R  D  K   +    +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  174  LTLRSRLRCIIMRKGDDEKKTSKQPTNLLVLNEVVVDRGPSPYLSNIDLFLDGKLITSVQ  233

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  234  GDGLIVSTPTGSTAYAVAAGASMIHP  259



>ref|XP_001621136.1| hypothetical protein NEMVEDRAFT_v1g145879 [Nematostella vectensis]
 gb|EDO29036.1| predicted protein, partial [Nematostella vectensis]
Length=161

 Score = 91.3 bits (225),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPML----VLNEVTIDRGISSFLTNLECYCDNSFVT  88
             +TLR RL+C + +    +    + P +    VLNEV IDRG S +L+NLE YC++  +T
Sbjct  47   RLTLRSRLRCIITKYHTDSNENCKTPNMQRYTVLNEVVIDRGQSPYLSNLEVYCNDYHIT  106

Query  87   CVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             VQGDGLI+ST +GSTAY++AAG SMVHP
Sbjct  107  SVQGDGLIISTPTGSTAYAVAAGASMVHP  135



>ref|XP_008197011.1| PREDICTED: NAD kinase-like isoform X3 [Tribolium castaneum]
Length=409

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIR--DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R  D  K   +    +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  198  LTLRSRLRCIIMRKGDDEKKTSKQPTNLLVLNEVVVDRGPSPYLSNIDLFLDGKLITSVQ  257

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  258  GDGLIVSTPTGSTAYAVAAGASMIHP  283



>ref|XP_008197010.1| PREDICTED: NAD kinase-like isoform X2 [Tribolium castaneum]
Length=447

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIR--DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R  D  K   +    +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  236  LTLRSRLRCIIMRKGDDEKKTSKQPTNLLVLNEVVVDRGPSPYLSNIDLFLDGKLITSVQ  295

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  296  GDGLIVSTPTGSTAYAVAAGASMIHP  321



>ref|XP_008188399.1| PREDICTED: NAD kinase-like isoform X5 [Acyrthosiphon pisum]
Length=418

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 7/87 (8%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C +++   KNE + + P   +LVLNEV IDRG S +L+N++ + D  ++T V
Sbjct  211  LTLRSRLRCIIVK---KNE-DKDKPQPNLLVLNEVVIDRGPSPYLSNIDLFLDRKYITSV  266

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  267  QGDGLIISTPTGSTAYAVAAGASMIHP  293



>ref|XP_003488899.1| PREDICTED: NAD kinase-like [Bombus impatiens]
Length=435

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +++ E + P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  231  LTLRSRLRCIIMRKGEEDK-EAKPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  289

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  290  GDGLIVSTPTGSTAYAVAAGASMIHP  315



>ref|XP_004347505.2| poly(p)/ATP nad kinase [Capsaspora owczarzaki ATCC 30864]
Length=596

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML--VLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +T+R RL+C VIR +  N+  +  P +   LNE+ IDRG S FL +L+ +CD   +T VQ
Sbjct  373  VTMRMRLECEVIR-SKNNQRASMLPHVFHALNEIVIDRGPSPFLGDLQVFCDGKHITSVQ  431

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI++T +GSTAYS++AGGSMVHP
Sbjct  432  GDGLIVATPTGSTAYSVSAGGSMVHP  457



>ref|XP_003702819.1| PREDICTED: NAD kinase-like [Megachile rotundata]
Length=435

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R   +N+ + + P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  231  LTLRSRLRCIIMRKGEENK-DAKPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  289

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  290  GDGLIVSTPTGSTAYAVAAGASMIHP  315



>emb|CBN79989.1| NAD(+) kinase [Ectocarpus siliculosus]
Length=471

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
             ++LR RL   +IRD   +E         LNE+ IDRG S +LTNLECYCD   +T VQ 
Sbjct  377  KVSLRMRLSARIIRDDQTSEA-----FHALNEIVIDRGSSPYLTNLECYCDEEHLTTVQA  431

Query  75   DGLILSTTSGSTAYSLAAGGSMVH  4
            DGLI++T +GSTAYS++AGGSMV+
Sbjct  432  DGLIIATPTGSTAYSMSAGGSMVN  455



>ref|XP_008197012.1| PREDICTED: NAD kinase-like isoform X4 [Tribolium castaneum]
Length=407

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIR--DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R  D  K   +    +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  196  LTLRSRLRCIIMRKGDDEKKTSKQPTNLLVLNEVVVDRGPSPYLSNIDLFLDGKLITSVQ  255

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  256  GDGLIVSTPTGSTAYAVAAGASMIHP  281



>ref|XP_008197009.1| PREDICTED: NAD kinase-like isoform X1 [Tribolium castaneum]
Length=447

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIR--DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R  D  K   +    +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  236  LTLRSRLRCIIMRKGDDEKKTSKQPTNLLVLNEVVVDRGPSPYLSNIDLFLDGKLITSVQ  295

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  296  GDGLIVSTPTGSTAYAVAAGASMIHP  321



>ref|XP_003248159.1| PREDICTED: NAD kinase-like isoform X4 [Acyrthosiphon pisum]
Length=423

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 7/87 (8%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C +++   KNE + + P   +LVLNEV IDRG S +L+N++ + D  ++T V
Sbjct  216  LTLRSRLRCIIVK---KNE-DKDKPQPNLLVLNEVVIDRGPSPYLSNIDLFLDRKYITSV  271

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  272  QGDGLIISTPTGSTAYAVAAGASMIHP  298



>ref|XP_006696003.1| NAD+ kinase-like protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 gb|EGS19058.1| NAD+ kinase-like protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
Length=706

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML-VLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            + LR R  C V RDT       EG    VLNE+ IDRG S +++NLE Y D+  +T VQ 
Sbjct  474  VNLRMRFTCTVYRDTPNGHEMEEGEQFEVLNELVIDRGPSPYVSNLELYGDDELLTIVQA  533

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG+ILST +GSTAYSL+AGGS+VHP
Sbjct  534  DGIILSTPTGSTAYSLSAGGSLVHP  558



>ref|XP_008188398.1| PREDICTED: NAD kinase-like isoform X3 [Acyrthosiphon pisum]
Length=425

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 7/87 (8%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C +++   KNE + + P   +LVLNEV IDRG S +L+N++ + D  ++T V
Sbjct  218  LTLRSRLRCIIVK---KNE-DKDKPQPNLLVLNEVVIDRGPSPYLSNIDLFLDRKYITSV  273

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  274  QGDGLIISTPTGSTAYAVAAGASMIHP  300



>gb|EHL02566.1| putative NAD(+) kinase [Glarea lozoyensis 74030]
Length=340

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  NITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
             + LR R  C V RD    + E      VLNE+ IDRG S +++NLE Y DN  +T VQ 
Sbjct  116  RVNLRMRFTCTVYRDGRGEDLEEGEQFEVLNELVIDRGPSPYVSNLELYGDNELLTVVQA  175

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG I ST +GSTAYSL+AGGS+VHP
Sbjct  176  DGCIFSTPTGSTAYSLSAGGSLVHP  200



>ref|XP_011297438.1| PREDICTED: NAD kinase-like isoform X11 [Fopius arisanus]
 ref|XP_011297439.1| PREDICTED: NAD kinase-like isoform X11 [Fopius arisanus]
Length=354

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R     +  T+ P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  150  LTLRSRLRCIIMRKGEDGQ-PTKPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  208

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  209  GDGLIVSTPTGSTAYAVAAGASMIHP  234



>ref|XP_003291185.1| hypothetical protein DICPUDRAFT_155765 [Dictyostelium purpureum]
 gb|EGC32307.1| hypothetical protein DICPUDRAFT_155765 [Dictyostelium purpureum]
Length=745

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/84 (54%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ++ R RL C V+     +E + +    VLNEVTIDRG + +L+NLEC CD   +T VQ D
Sbjct  542  VSYRLRLSCTVV----SSETQVKHRYQVLNEVTIDRGTNPYLSNLECCCDGKLITIVQAD  597

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            GLI++T++GSTAYSL+AGGS+VHP
Sbjct  598  GLIIATSTGSTAYSLSAGGSLVHP  621



>ref|XP_011297437.1| PREDICTED: NAD kinase-like isoform X10 [Fopius arisanus]
Length=357

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R     +  T+ P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  153  LTLRSRLRCIIMRKGEDGQ-PTKPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  211

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  212  GDGLIVSTPTGSTAYAVAAGASMIHP  237



>dbj|BAE62131.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=694

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/89 (54%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFET----EGPML-VLNEVTIDRGISSFLTNLECYCDNSFVT  88
            + LR R  C V R   + E E     EG    VLNE+ IDRG S +++NLE Y DN F+T
Sbjct  452  VNLRMRFTCTVFRKDRRKEAEAGAVEEGEQFEVLNELVIDRGPSPYVSNLELYADNDFLT  511

Query  87   CVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             VQ DG ILST +GSTAYSL+AGGS++HP
Sbjct  512  VVQADGCILSTPTGSTAYSLSAGGSLIHP  540



>gb|EFA76375.1| NAD+ kinase family protein [Polysphondylium pallidum PN500]
Length=540

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 6/84 (7%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ++ R RL C VI  T    ++      VLNEV IDRG + +L+NLEC+CD+  +T VQ D
Sbjct  368  VSYRLRLSCTVISGTTYKTYQ------VLNEVAIDRGNNPYLSNLECFCDDKLITMVQAD  421

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            G+I++T++GSTAYSL+AGGS+VHP
Sbjct  422  GVIIATSTGSTAYSLSAGGSLVHP  445



>ref|XP_008188397.1| PREDICTED: NAD kinase-like isoform X2 [Acyrthosiphon pisum]
Length=426

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 7/87 (8%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP---MLVLNEVTIDRGISSFLTNLECYCDNSFVTCV  82
            +TLR RL+C +++   KNE + + P   +LVLNEV IDRG S +L+N++ + D  ++T V
Sbjct  274  LTLRSRLRCIIVK---KNE-DKDKPQPNLLVLNEVVIDRGPSPYLSNIDLFLDRKYITSV  329

Query  81   QGDGLILSTTSGSTAYSLAAGGSMVHP  1
            QGDGLI+ST +GSTAY++AAG SM+HP
Sbjct  330  QGDGLIISTPTGSTAYAVAAGASMIHP  356



>ref|XP_007828670.1| hypothetical protein PFICI_01898 [Pestalotiopsis fici W106-1]
 gb|ETS88070.1| hypothetical protein PFICI_01898 [Pestalotiopsis fici W106-1]
Length=657

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAK-NEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            + LR R  C V RD A  NE E      VLNE+ IDRG S +++NLE Y DN  +T VQ 
Sbjct  427  VNLRMRFTCTVYRDGASGNEVEEGEQFEVLNELVIDRGPSPYVSNLELYGDNELLTVVQA  486

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG I ST +GSTAYSL+AGGS+VHP
Sbjct  487  DGCIFSTPTGSTAYSLSAGGSLVHP  511



>gb|KJE94057.1| poly(p)/ATP nad kinase [Capsaspora owczarzaki ATCC 30864]
Length=658

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML--VLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +T+R RL+C VIR +  N+  +  P +   LNE+ IDRG S FL +L+ +CD   +T VQ
Sbjct  435  VTMRMRLECEVIR-SKNNQRASMLPHVFHALNEIVIDRGPSPFLGDLQVFCDGKHITSVQ  493

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI++T +GSTAYS++AGGSMVHP
Sbjct  494  GDGLIVATPTGSTAYSVSAGGSMVHP  519



>ref|XP_002955100.1| hypothetical protein VOLCADRAFT_118925 [Volvox carteri f. nagariensis]
 gb|EFJ43854.1| hypothetical protein VOLCADRAFT_118925 [Volvox carteri f. nagariensis]
Length=383

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            +TLR RL C + R         E  + VLNE+ IDRG S+FLTN+ECY    F+  VQ D
Sbjct  200  VTLRMRLVCEIWRKGGSG---PEQSVEVLNEMVIDRGSSAFLTNIECYEKGRFIARVQAD  256

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            G++L+T +GSTAYS+AAGGSMVHP
Sbjct  257  GIMLATPTGSTAYSVAAGGSMVHP  280



>ref|XP_011297433.1| PREDICTED: NAD kinase-like isoform X6 [Fopius arisanus]
Length=415

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R     +  T+ P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  211  LTLRSRLRCIIMRKGEDGQ-PTKPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  269

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  270  GDGLIVSTPTGSTAYAVAAGASMIHP  295



>gb|KFY44809.1| hypothetical protein V494_01295 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=633

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML-VLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            + LR R  C V RD A  +   EG    VLNE+ IDRG S +++NLE Y DN  +T VQ 
Sbjct  408  VNLRMRFTCTVYRDGANGDDMEEGEQFEVLNELVIDRGPSPYVSNLELYGDNELLTVVQA  467

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG I ST +GSTAYSL+AGGS+VHP
Sbjct  468  DGCIFSTPTGSTAYSLSAGGSLVHP  492



>ref|XP_011346928.1| PREDICTED: NAD kinase-like isoform X6 [Cerapachys biroi]
Length=414

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNE-FETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            +TLR RL C + R + + +  E+   +LVLNEV +DRG S +L+N++ + +   VT VQG
Sbjct  210  LTLRSRLTCTITRKSEEGQPGESSTTLLVLNEVVVDRGPSPYLSNIDLFIEGKHVTSVQG  269

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DGLI+ST +GSTAY++AAG SM+HP
Sbjct  270  DGLIVSTPTGSTAYAVAAGASMIHP  294



>ref|XP_001823264.2| NAD+ kinase Utr1 [Aspergillus oryzae RIB40]
 gb|EIT80592.1| putative sugar kinase [Aspergillus oryzae 3.042]
 gb|KDE80660.1| putative sugar kinase [Aspergillus oryzae 100-8]
Length=654

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/89 (54%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFET----EGPML-VLNEVTIDRGISSFLTNLECYCDNSFVT  88
            + LR R  C V R   + E E     EG    VLNE+ IDRG S +++NLE Y DN F+T
Sbjct  412  VNLRMRFTCTVFRKDRRKEAEAGAVEEGEQFEVLNELVIDRGPSPYVSNLELYADNDFLT  471

Query  87   CVQGDGLILSTTSGSTAYSLAAGGSMVHP  1
             VQ DG ILST +GSTAYSL+AGGS++HP
Sbjct  472  VVQADGCILSTPTGSTAYSLSAGGSLIHP  500



>ref|XP_008605425.1| hypothetical protein SDRG_01668 [Saprolegnia diclina VS20]
 gb|EQC41711.1| hypothetical protein SDRG_01668 [Saprolegnia diclina VS20]
Length=469

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ++LR RLQC V+R       E + P+  LNEV IDRG SS + +L+C+CD   +T +  D
Sbjct  276  LSLRQRLQCTVLRAKPGVVEEVQMPIHALNEVVIDRGPSSAMVDLDCFCDGVELTKISAD  335

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            G+I+++ +GSTAYSL+AGGSM HP
Sbjct  336  GIIIASPTGSTAYSLSAGGSMTHP  359



>ref|XP_011297432.1| PREDICTED: NAD kinase-like isoform X5 [Fopius arisanus]
Length=421

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R     +  T+ P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  217  LTLRSRLRCIIMRKGEDGQ-PTKPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  275

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  276  GDGLIVSTPTGSTAYAVAAGASMIHP  301



>ref|XP_011297431.1| PREDICTED: NAD kinase-like isoform X4 [Fopius arisanus]
Length=421

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGP--MLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R     +  T+ P  +LVLNEV +DRG S +L+N++ + D   VT VQ
Sbjct  217  LTLRSRLRCIIMRKGEDGQ-PTKPPTNLLVLNEVVVDRGPSPYLSNIDLFIDGKHVTSVQ  275

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  276  GDGLIVSTPTGSTAYAVAAGASMIHP  301



>gb|KDO34538.1| hypothetical protein SPRG_00601 [Saprolegnia parasitica CBS 223.65]
Length=471

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQGD  73
            ++LR RLQC V+R       E + P+  LNEV IDRG SS + +L+C+CD   +T +  D
Sbjct  278  LSLRQRLQCTVLRAKPGVVEEVQMPIHALNEVVIDRGPSSAMVDLDCFCDGVELTKISAD  337

Query  72   GLILSTTSGSTAYSLAAGGSMVHP  1
            G+I+++ +GSTAYSL+AGGSM HP
Sbjct  338  GIIIASPTGSTAYSLSAGGSMTHP  361



>gb|KFY77402.1| hypothetical protein V499_03200 [Pseudogymnoascus pannorum VKM 
F-103]
Length=629

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML-VLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            + LR R  C V RD A  +   EG    VLNE+ IDRG S +++NLE Y DN  +T VQ 
Sbjct  404  VNLRMRFTCTVYRDGANGQDMEEGEQFEVLNELVIDRGPSPYVSNLELYGDNELLTVVQA  463

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG I ST +GSTAYSL+AGGS+VHP
Sbjct  464  DGCIFSTPTGSTAYSLSAGGSLVHP  488



>gb|KFZ22790.1| hypothetical protein V502_02720 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=630

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML-VLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            + LR R  C V RD A  +   EG    VLNE+ IDRG S +++NLE Y DN  +T VQ 
Sbjct  405  VNLRMRFTCTVYRDGANGQDMEEGEQFEVLNELVIDRGPSPYVSNLELYGDNELLTVVQA  464

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG I ST +GSTAYSL+AGGS+VHP
Sbjct  465  DGCIFSTPTGSTAYSLSAGGSLVHP  489



>gb|KFZ08209.1| hypothetical protein V501_06051 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=629

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML-VLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            + LR R  C V RD A  +   EG    VLNE+ IDRG S +++NLE Y DN  +T VQ 
Sbjct  404  VNLRMRFTCTVYRDGANGQDMEEGEQFEVLNELVIDRGPSPYVSNLELYGDNELLTVVQA  463

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG I ST +GSTAYSL+AGGS+VHP
Sbjct  464  DGCIFSTPTGSTAYSLSAGGSLVHP  488



>gb|EFA08909.1| hypothetical protein TcasGA2_TC006614 [Tribolium castaneum]
Length=540

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -3

Query  252  ITLRHRLQCHVIR--DTAKNEFETEGPMLVLNEVTIDRGISSFLTNLECYCDNSFVTCVQ  79
            +TLR RL+C ++R  D  K   +    +LVLNEV +DRG S +L+N++ + D   +T VQ
Sbjct  329  LTLRSRLRCIIMRKGDDEKKTSKQPTNLLVLNEVVVDRGPSPYLSNIDLFLDGKLITSVQ  388

Query  78   GDGLILSTTSGSTAYSLAAGGSMVHP  1
            GDGLI+ST +GSTAY++AAG SM+HP
Sbjct  389  GDGLIVSTPTGSTAYAVAAGASMIHP  414



>gb|ELR06268.1| hypothetical protein GMDG_02062 [Pseudogymnoascus destructans 
20631-21]
Length=629

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  252  ITLRHRLQCHVIRDTAKNEFETEGPML-VLNEVTIDRGISSFLTNLECYCDNSFVTCVQG  76
            + LR R  C V RD A  +   EG    VLNE+ IDRG S +++NLE Y DN  +T VQ 
Sbjct  404  VNLRMRFTCTVYRDGANGQDMEEGEQFEVLNELVIDRGPSPYVSNLELYGDNELLTVVQA  463

Query  75   DGLILSTTSGSTAYSLAAGGSMVHP  1
            DG I ST +GSTAYSL+AGGS+VHP
Sbjct  464  DGCIFSTPTGSTAYSLSAGGSLVHP  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552168806140