BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046M10

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAB51610.1|  ADP-glucose pyrophosphorylase large subunit            302   2e-98   Ipomoea batatas [batate]
emb|CAB52196.1|  ADP-glucose pyrophosphorylase                          305   1e-97   Ipomoea batatas [batate]
dbj|BAF47746.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1A    304   1e-96   Ipomoea batatas [batate]
gb|AFL55396.1|  ADP-glucose pyrophosphorylase large subunit 1           304   1e-96   Ipomoea batatas [batate]
gb|AGB85109.1|  ADP-glucose pyrophosphorylase large subunit 1           302   7e-96   Ipomoea batatas [batate]
emb|CAB55496.1|  ADP-glucose pyrophosphorylase                          296   3e-95   Ipomoea batatas [batate]
emb|CAB55495.1|  ADP-glucose pyrophosphorylase                          299   8e-95   Ipomoea batatas [batate]
gb|AAC21562.1|  ADP-glucose pyrophosphorylase large subunit             299   2e-94   Ipomoea batatas [batate]
ref|XP_009763056.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    286   2e-89   Nicotiana sylvestris
ref|XP_009621409.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    285   4e-89   Nicotiana tomentosiformis
gb|AFO84074.1|  ADP glucose pyrophosphorylase                           275   1e-87   Actinidia chinensis
ref|XP_011088418.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    279   7e-87   Sesamum indicum [beniseed]
dbj|BAF47747.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1B    278   1e-86   Ipomoea batatas [batate]
gb|AFL55397.1|  ADP-glucose pyrophosphorylase large subunit 2           278   2e-86   Ipomoea batatas [batate]
gb|KDO42003.1|  hypothetical protein CISIN_1g0097201mg                  272   3e-86   Citrus sinensis [Valencia orange]
sp|Q00081.1|GLGL1_SOLTU  RecName: Full=Glucose-1-phosphate adenyl...    274   2e-85   Solanum tuberosum [potatoes]
gb|AAD56405.1|AF184345_1  ADP-glucose pyrophosphorylase large sub...    275   2e-85   Solanum habrochaites
ref|NP_001233918.1|  ADP-glucose pyrophosphorylase large subunit        275   3e-85   
gb|ABC26923.1|  ADPglucose pyrophosphorylase large subunit              275   3e-85   Solanum habrochaites
gb|AAC49941.1|  ADP-glucose pyrophosphorylase large subunit 1           275   4e-85   Solanum lycopersicum
gb|KDO42001.1|  hypothetical protein CISIN_1g0097201mg                  271   5e-85   Citrus sinensis [Valencia orange]
gb|ABC26921.1|  ADPglucose pyrophosphorylase large subunit              274   6e-85   Solanum lycopersicum
gb|AGB85110.1|  ADP-glucose pyrophosphorylase large subunit 2           274   6e-85   Ipomoea batatas [batate]
ref|XP_006365120.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    274   8e-85   Solanum tuberosum [potatoes]
gb|KDO41998.1|  hypothetical protein CISIN_1g0097201mg                  271   1e-84   Citrus sinensis [Valencia orange]
ref|NP_001275823.1|  glucose-1-phosphate adenylyltransferase larg...    273   3e-84   Citrus sinensis [Valencia orange]
gb|AAD56042.1|AF184598_1  ADP-glucose pyrophosphorylase large sub...    273   3e-84   Citrus unshiu [Satsuma orange]
gb|KJB32481.1|  hypothetical protein B456_005G244900                    268   4e-84   Gossypium raimondii
gb|AGS94412.1|  ADP-glucose pyrophosphorylase large subunit 4           272   4e-84   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006423322.1|  hypothetical protein CICLE_v10028195mg             271   8e-84   Citrus clementina
ref|NP_001284451.1|  myeloid leukemia factor 1                          271   1e-83   Cucumis melo [Oriental melon]
gb|KDP41770.1|  hypothetical protein JCGZ_26788                         271   1e-83   Jatropha curcas
ref|XP_002512925.1|  glucose-1-phosphate adenylyltransferase, put...    271   1e-83   Ricinus communis
emb|CDO97030.1|  unnamed protein product                                269   4e-83   Coffea canephora [robusta coffee]
ref|XP_010088945.1|  Glucose-1-phosphate adenylyltransferase larg...    269   7e-83   Morus notabilis
ref|XP_003537869.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    268   1e-82   Glycine max [soybeans]
ref|XP_008460955.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    268   1e-82   
ref|XP_003541029.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    268   1e-82   Glycine max [soybeans]
gb|KHG23571.1|  Glucose-1-phosphate adenylyltransferase large sub...    268   1e-82   Gossypium arboreum [tree cotton]
gb|AAB91467.1|  ADP-glucose pyrophosphorylase large subunit 1           268   2e-82   Citrullus lanatus subsp. vulgaris
gb|KCW55368.1|  hypothetical protein EUGRSUZ_I01281                     264   2e-82   Eucalyptus grandis [rose gum]
emb|CBI37674.3|  unnamed protein product                                267   3e-82   Vitis vinifera
gb|KJB32482.1|  hypothetical protein B456_005G244900                    267   3e-82   Gossypium raimondii
gb|KJB32479.1|  hypothetical protein B456_005G244900                    267   3e-82   Gossypium raimondii
ref|XP_002283855.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    267   4e-82   Vitis vinifera
ref|XP_007042146.1|  Glucose-1-phosphate adenylyltransferase fami...    266   7e-82   Theobroma cacao [chocolate]
ref|XP_006581117.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    262   1e-81   Glycine max [soybeans]
ref|XP_002306116.2|  ADP-glucose pyrophosphorylase large subunit ...    266   1e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011037496.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    266   1e-81   Populus euphratica
ref|XP_004500804.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    265   2e-81   Cicer arietinum [garbanzo]
gb|KDO41999.1|  hypothetical protein CISIN_1g0097201mg                  263   3e-81   Citrus sinensis [Valencia orange]
ref|XP_010028607.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    265   3e-81   Eucalyptus grandis [rose gum]
ref|XP_009345666.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    264   4e-81   Pyrus x bretschneideri [bai li]
ref|XP_009345668.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    264   4e-81   Pyrus x bretschneideri [bai li]
gb|AES74194.2|  glucose-1-phosphate adenylyltransferase family pr...    263   9e-81   Medicago truncatula
ref|XP_003527197.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    263   9e-81   Glycine max [soybeans]
ref|XP_003522921.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    263   9e-81   Glycine max [soybeans]
ref|XP_007131817.1|  hypothetical protein PHAVU_011G044000g             263   2e-80   Phaseolus vulgaris [French bean]
gb|EYU37810.1|  hypothetical protein MIMGU_mgv1a004455mg                263   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_004148834.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    262   2e-80   
gb|KJB79161.1|  hypothetical protein B456_013G035800                    262   2e-80   Gossypium raimondii
ref|XP_002313036.1|  ADP-glucose pyrophosphorylase large subunit ...    262   3e-80   Populus trichocarpa [western balsam poplar]
gb|KHF99865.1|  Glucose-1-phosphate adenylyltransferase large sub...    262   3e-80   Gossypium arboreum [tree cotton]
gb|AHM92232.1|  AGPase large subunit protein                            262   4e-80   Hevea brasiliensis [Para rubber tree]
ref|XP_011048155.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    261   6e-80   Populus euphratica
ref|XP_008385898.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    261   7e-80   
ref|XP_008385901.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    261   7e-80   Malus domestica [apple tree]
ref|XP_010690849.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    261   1e-79   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011015433.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    261   1e-79   Populus euphratica
gb|AAF66436.1|AF249917_1  ADP-glucose pyrophosphorylase large sub...    261   1e-79   Perilla frutescens [beefsteak-mint]
ref|XP_007199332.1|  hypothetical protein PRUPE_ppa023764mg             255   2e-79   Prunus persica
ref|XP_008800701.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    259   3e-79   Phoenix dactylifera
ref|XP_007201161.1|  hypothetical protein PRUPE_ppa004192mg             259   4e-79   Prunus persica
gb|AGV54292.1|  ADP-glucose pyrophosphorylase large subunit             259   6e-79   Phaseolus vulgaris [French bean]
ref|XP_010060971.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    258   7e-79   Eucalyptus grandis [rose gum]
ref|XP_007136621.1|  hypothetical protein PHAVU_009G059800g             252   9e-79   Phaseolus vulgaris [French bean]
ref|XP_008236919.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    258   9e-79   Prunus mume [ume]
ref|XP_003603943.1|  Glucose-1-phosphate adenylyltransferase larg...    258   1e-78   
ref|XP_011007450.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    258   1e-78   Populus euphratica
ref|XP_007136623.1|  hypothetical protein PHAVU_009G059800g             252   2e-78   Phaseolus vulgaris [French bean]
ref|XP_011028874.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    258   2e-78   Populus euphratica
ref|XP_003606943.1|  Glucose-1-phosphate adenylyltransferase            258   2e-78   Medicago truncatula
ref|XP_007136619.1|  hypothetical protein PHAVU_009G059800g             252   2e-78   Phaseolus vulgaris [French bean]
ref|XP_007136620.1|  hypothetical protein PHAVU_009G059800g             253   2e-78   Phaseolus vulgaris [French bean]
ref|XP_002300758.1|  ADP-glucose pyrophosphorylase large subunit ...    257   2e-78   Populus trichocarpa [western balsam poplar]
ref|XP_007136618.1|  hypothetical protein PHAVU_009G059800g             252   3e-78   Phaseolus vulgaris [French bean]
ref|XP_007136622.1|  hypothetical protein PHAVU_009G059800g             253   4e-78   Phaseolus vulgaris [French bean]
ref|XP_010531437.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    256   5e-78   Tarenaya hassleriana [spider flower]
ref|XP_002281223.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    256   8e-78   Vitis vinifera
gb|AAB91468.1|  ADP-glucose pyrophosphorylase large subunit 2           254   8e-78   Citrullus lanatus subsp. vulgaris
dbj|BAC66692.1|  ADP-glucose pyrophosphorylase large subunit PvAGPL1    256   9e-78   Phaseolus vulgaris [French bean]
ref|NP_001289786.1|  glucose-1-phosphate adenylyltransferase larg...    256   1e-77   Nelumbo nucifera [Indian lotus]
ref|XP_007136159.1|  hypothetical protein PHAVU_009G023100g             255   1e-77   Phaseolus vulgaris [French bean]
ref|XP_006473534.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    255   1e-77   Citrus sinensis [Valencia orange]
ref|XP_006435035.1|  hypothetical protein CICLE_v10000842mg             255   1e-77   Citrus clementina
ref|XP_010254773.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    255   1e-77   Nelumbo nucifera [Indian lotus]
emb|CAA65541.1|  ADP-glucose pyrophosphorylase                          255   1e-77   Pisum sativum [garden pea]
ref|XP_002307668.2|  hypothetical protein POPTR_0005s25130g             255   1e-77   Populus trichocarpa [western balsam poplar]
ref|XP_008466540.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    255   2e-77   
ref|XP_004147856.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    255   2e-77   Cucumis sativus [cucumbers]
gb|EPS74142.1|  glucose-1-phosphate adenylyltransferase                 255   2e-77   Genlisea aurea
ref|XP_004507462.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    255   2e-77   Cicer arietinum [garbanzo]
ref|XP_004154849.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-1-ph...    255   2e-77   
ref|XP_009378639.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    254   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_007017590.1|  ADPGLC-PPase large subunit isoform 1               254   2e-77   Theobroma cacao [chocolate]
ref|XP_009378638.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    254   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_009378637.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    254   2e-77   Pyrus x bretschneideri [bai li]
emb|CDP07489.1|  unnamed protein product                                253   9e-77   Coffea canephora [robusta coffee]
emb|CDY41275.1|  BnaA01g12640D                                          247   1e-76   Brassica napus [oilseed rape]
ref|XP_007136616.1|  hypothetical protein PHAVU_009G059800g             253   2e-76   Phaseolus vulgaris [French bean]
ref|NP_179753.1|  glucose-1-phosphate adenylyltransferase large s...    252   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472157.1|  PREDICTED: probable glucose-1-phosphate aden...    252   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010472156.1|  PREDICTED: probable glucose-1-phosphate aden...    252   2e-76   Camelina sativa [gold-of-pleasure]
gb|KJB58232.1|  hypothetical protein B456_009G200400                    252   2e-76   Gossypium raimondii
ref|XP_010263606.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    252   3e-76   Nelumbo nucifera [Indian lotus]
ref|XP_008388042.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    251   3e-76   Malus domestica [apple tree]
gb|KEH36175.1|  glucose-1-phosphate adenylyltransferase family pr...    252   3e-76   Medicago truncatula
ref|XP_010429080.1|  PREDICTED: probable glucose-1-phosphate aden...    251   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010416915.1|  PREDICTED: probable glucose-1-phosphate aden...    251   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006294016.1|  hypothetical protein CARUB_v10023004mg             251   4e-76   Capsella rubella
ref|XP_010416916.1|  PREDICTED: probable glucose-1-phosphate aden...    251   4e-76   Camelina sativa [gold-of-pleasure]
gb|AJG44463.1|  ADP-glucose pyrophosphorylase large subunit             251   4e-76   Lilium davidii var. unicolor
emb|CDX99581.1|  BnaC04g33380D                                          251   5e-76   Brassica napus [oilseed rape]
ref|XP_006878500.1|  hypothetical protein AMTR_s00011p00201790          251   5e-76   
ref|XP_003523570.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    251   5e-76   Glycine max [soybeans]
dbj|BAF47748.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb2     251   5e-76   Ipomoea batatas [batate]
ref|XP_002510419.1|  glucose-1-phosphate adenylyltransferase, put...    251   6e-76   Ricinus communis
gb|AFL55398.1|  ADP-glucose pyrophosphorylase large subunit 3           251   6e-76   Ipomoea batatas [batate]
ref|XP_009113743.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    251   7e-76   Brassica rapa
ref|XP_010110050.1|  Glucose-1-phosphate adenylyltransferase larg...    251   8e-76   Morus notabilis
gb|ACW82825.1|  ADP-glucose pyrophosphorylase large subunit L1 is...    250   8e-76   Lens culinaris
ref|XP_010924297.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    250   1e-75   Elaeis guineensis
ref|XP_009365525.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_009617843.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    250   1e-75   Nicotiana tomentosiformis
emb|CDY15884.1|  BnaA04g12270D                                          249   2e-75   Brassica napus [oilseed rape]
ref|XP_009140291.1|  PREDICTED: probable glucose-1-phosphate aden...    249   2e-75   Brassica rapa
ref|NP_001266081.1|  glucose-1-phosphate adenylyltransferase larg...    249   2e-75   Cicer arietinum [garbanzo]
ref|XP_009759775.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    250   2e-75   Nicotiana sylvestris
ref|XP_008377280.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   2e-75   Malus domestica [apple tree]
ref|XP_011083898.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   2e-75   Sesamum indicum [beniseed]
ref|XP_008377281.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   2e-75   Malus domestica [apple tree]
gb|AFK36497.1|  unknown                                                 250   2e-75   Lotus japonicus
ref|XP_009365102.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_009336061.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   2e-75   Pyrus x bretschneideri [bai li]
ref|NP_001289992.1|  glucose-1-phosphate adenylyltransferase larg...    249   2e-75   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010673183.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   3e-75   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EYU45186.1|  hypothetical protein MIMGU_mgv1a004400mg                249   3e-75   Erythranthe guttata [common monkey flower]
ref|XP_010926128.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   3e-75   Elaeis guineensis
gb|AAB82604.1|  ADP-glucose-pyrophosphorylase large subunit             242   3e-75   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003528021.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   5e-75   Glycine max [soybeans]
ref|XP_009396671.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    248   6e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406290.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    248   6e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006411722.1|  hypothetical protein EUTSA_v10024927mg             248   7e-75   Eutrema salsugineum
ref|XP_009406289.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    248   9e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002878559.1|  predicted protein                                  248   1e-74   Arabidopsis lyrata subsp. lyrata
ref|NP_195632.1|  glucose-1-phosphate adenylyltransferase large s...    248   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074558.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    247   2e-74   Sesamum indicum [beniseed]
ref|XP_009394804.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    247   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006415741.1|  hypothetical protein EUTSA_v10007379mg             246   2e-74   Eutrema salsugineum
gb|KFK36157.1|  hypothetical protein AALP_AA4G085400                    246   4e-74   Arabis alpina [alpine rockcress]
ref|XP_009101892.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    246   4e-74   Brassica rapa
gb|KDP38538.1|  hypothetical protein JCGZ_04463                         246   4e-74   Jatropha curcas
ref|XP_006303972.1|  hypothetical protein CARUB_v10008862mg             246   4e-74   Capsella rubella
ref|XP_006346702.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    246   5e-74   
ref|XP_009101891.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    246   5e-74   Brassica rapa
ref|XP_004291856.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    246   6e-74   Fragaria vesca subsp. vesca
gb|AGB85111.1|  ADP-glucose pyrophosphorylase large subunit 3           245   7e-74   Ipomoea batatas [batate]
ref|XP_008648319.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    245   7e-74   
gb|AFW79323.1|  ADP-glucose pyrophosphorylase large subunit             245   9e-74   Zea mays [maize]
ref|XP_006282507.1|  hypothetical protein CARUB_v10007053mg             245   1e-73   Capsella rubella
emb|CDY56761.1|  BnaA06g40730D                                          247   1e-73   Brassica napus [oilseed rape]
ref|XP_010446453.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    245   1e-73   Camelina sativa [gold-of-pleasure]
gb|ADE77153.1|  unknown                                                 235   1e-73   Picea sitchensis
gb|AIO11223.1|  AGPL1 protein                                           244   1e-73   Gladiolus hybrid cultivar
ref|XP_010499251.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010431888.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010460525.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   2e-73   Camelina sativa [gold-of-pleasure]
gb|ABF69950.1|  ADP-glucose pyrophosphorylase (glucose-1-phosphat...    242   2e-73   Musa acuminata [banana]
ref|XP_010478112.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010437035.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010437034.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010478113.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002866835.1|  hypothetical protein ARALYDRAFT_490693             244   2e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_010431887.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   2e-73   Camelina sativa [gold-of-pleasure]
gb|AJG44462.1|  ADP-glucose pyrophosphorylase large subunit             244   3e-73   Lilium davidii var. unicolor
ref|XP_006654841.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   3e-73   Oryza brachyantha
ref|XP_002890743.1|  hypothetical protein ARALYDRAFT_472972             243   3e-73   Arabidopsis lyrata subsp. lyrata
emb|CDX72711.1|  BnaC07g47330D                                          246   4e-73   Brassica napus [oilseed rape]
ref|XP_007160732.1|  hypothetical protein PHAVU_001G012500g             243   4e-73   Phaseolus vulgaris [French bean]
sp|P55242.1|GLGL2_SOLTU  RecName: Full=Glucose-1-phosphate adenyl...    243   4e-73   Solanum tuberosum [potatoes]
ref|XP_010323163.1|  PREDICTED: ADP-glucose pyrophosphorylase lar...    243   5e-73   Solanum lycopersicum
ref|NP_001233947.1|  ADP-glucose pyrophosphorylase large subunit        243   5e-73   
ref|XP_007222521.1|  hypothetical protein PRUPE_ppa004135mg             243   5e-73   Prunus persica
ref|XP_010540326.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   5e-73   Tarenaya hassleriana [spider flower]
sp|P12299.2|GLGL2_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    243   6e-73   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008220832.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   6e-73   Prunus mume [ume]
emb|CAA32532.1|  ADP-glucose pyrophosophorylase (1 is 2nd base in...    236   7e-73   Triticum aestivum [Canadian hard winter wheat]
gb|AHA11391.1|  cytosolic ADP-glucose pyrophosphorylase large sub...    243   7e-73   Hordeum vulgare [barley]
emb|CAD98749.1|  ADP-glucose pyrophosphorylase large subunit            243   8e-73   Triticum aestivum [Canadian hard winter wheat]
sp|P30524.2|GLGL1_HORVU  RecName: Full=Glucose-1-phosphate adenyl...    243   8e-73   Hordeum vulgare [barley]
ref|XP_009416548.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   9e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_174089.1|  glucose-1-phosphate adenylyltransferase large s...    242   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|EMT32758.1|  hypothetical protein F775_52189                         243   2e-72   Aegilops tauschii
ref|XP_011007451.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    242   2e-72   Populus euphratica
prf||1909370A  ADP glucose pyrophosphorylase:SUBUNIT=L                  242   2e-72
gb|AEH27531.1|  putative ADP-glucose pyrophosphorylase                  242   2e-72   Amorphophallus konjac [devil's-tongue]
ref|NP_001056424.2|  Os05g0580000                                       241   2e-72   
gb|AAD39597.1|AC007858_11  10A19I.12                                    241   3e-72   Oryza sativa Japonica Group [Japonica rice]
gb|KJB63621.1|  hypothetical protein B456_010G008700                    241   4e-72   Gossypium raimondii
gb|EMS53815.1|  Glucose-1-phosphate adenylyltransferase large sub...    239   6e-72   Triticum urartu
ref|NP_001284415.1|  myeloid leukemia factor 2                          239   1e-71   Cucumis melo [Oriental melon]
gb|AGT17180.1|  glucose-1-phosphate adenylyltransferase                 239   1e-71   Saccharum hybrid cultivar R570
ref|XP_004961109.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    239   2e-71   Setaria italica
gb|AAC49942.1|  ADP-glucose pyrophosphorylase large subunit             239   2e-71   Solanum lycopersicum
ref|XP_002440313.1|  hypothetical protein SORBIDRAFT_09g029610          238   4e-71   Sorghum bicolor [broomcorn]
ref|XP_006491439.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    238   7e-71   Citrus sinensis [Valencia orange]
ref|XP_006444661.1|  hypothetical protein CICLE_v10023395mg             238   7e-71   Citrus clementina
gb|KDO86722.1|  hypothetical protein CISIN_1g043870mg                   238   7e-71   Citrus sinensis [Valencia orange]
ref|XP_003567817.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    237   1e-70   Brachypodium distachyon [annual false brome]
dbj|BAA23490.1|  ADP glucose pyrophosphorylase large subunit            236   2e-70   Oryza sativa Japonica Group [Japonica rice]
gb|AFO84073.1|  ADP glucose pyrophosphorylase                           236   3e-70   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009113739.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   3e-70   Brassica rapa
gb|AEV40474.1|  ADP-glucose pyrophosphorylase 3                         236   3e-70   Spirodela polyrhiza
gb|AGT17354.1|  ADP-glucose pyrophosphorylase                           234   5e-70   Saccharum hybrid cultivar R570
gb|KCW46725.1|  hypothetical protein EUGRSUZ_K00547                     232   1e-69   Eucalyptus grandis [rose gum]
ref|XP_003545270.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    234   1e-69   Glycine max [soybeans]
gb|KHN20962.1|  Glucose-1-phosphate adenylyltransferase large sub...    234   1e-69   Glycine soja [wild soybean]
emb|CDX84911.1|  BnaC05g21440D                                          233   2e-69   Brassica napus [oilseed rape]
ref|XP_004289659.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-1-ph...    233   2e-69   Fragaria vesca subsp. vesca
ref|XP_002515141.1|  glucose-1-phosphate adenylyltransferase, put...    233   3e-69   Ricinus communis
emb|CBI37074.3|  unnamed protein product                                232   4e-69   Vitis vinifera
ref|XP_010035362.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    233   4e-69   Eucalyptus grandis [rose gum]
ref|XP_003549440.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    233   4e-69   Glycine max [soybeans]
ref|XP_002994500.1|  hypothetical protein SELMODRAFT_138695             230   6e-69   Selaginella moellendorffii
ref|XP_006841529.1|  hypothetical protein AMTR_s00003p00152830          233   7e-69   Amborella trichopoda
ref|XP_010652349.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    231   7e-69   Vitis vinifera
ref|XP_002970384.1|  hypothetical protein SELMODRAFT_231637             231   8e-69   Selaginella moellendorffii
gb|KHN12692.1|  Glucose-1-phosphate adenylyltransferase large sub...    232   1e-68   Glycine soja [wild soybean]
ref|XP_002274245.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    231   1e-68   Vitis vinifera
gb|AEV40472.1|  ADP-glucose pyrophosphorylase 2                         232   1e-68   Spirodela polyrhiza
ref|XP_008799957.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    232   2e-68   Phoenix dactylifera
ref|XP_002968152.1|  hypothetical protein SELMODRAFT_169778             230   2e-68   Selaginella moellendorffii
emb|CAN67125.1|  hypothetical protein VITISV_040166                     229   2e-68   Vitis vinifera
gb|KJB09550.1|  hypothetical protein B456_001G149300                    231   3e-68   Gossypium raimondii
ref|XP_006658430.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    228   4e-68   
ref|XP_010914841.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    231   5e-68   Elaeis guineensis
ref|XP_011039886.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    230   5e-68   Populus euphratica
ref|XP_004959119.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    233   8e-68   
gb|KCW86631.1|  hypothetical protein EUGRSUZ_B03259                     223   9e-68   Eucalyptus grandis [rose gum]
gb|KDP28372.1|  hypothetical protein JCGZ_14143                         228   9e-68   Jatropha curcas
gb|KHG05254.1|  Glucose-1-phosphate adenylyltransferase large sub...    229   1e-67   Gossypium arboreum [tree cotton]
ref|XP_010323162.1|  PREDICTED: ADP-glucose pyrophosphorylase lar...    229   1e-67   Solanum lycopersicum
ref|XP_002320247.2|  hypothetical protein POPTR_0014s10560g             229   2e-67   Populus trichocarpa [western balsam poplar]
gb|EPS60253.1|  glucose-1-phosphate adenylyltransferase                 228   2e-67   Genlisea aurea
ref|XP_007051343.1|  ADPGLC-PPase large subunit                         228   3e-67   Theobroma cacao [chocolate]
ref|XP_003561277.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    228   4e-67   Brachypodium distachyon [annual false brome]
ref|XP_002461745.1|  hypothetical protein SORBIDRAFT_02g007310          221   5e-67   Sorghum bicolor [broomcorn]
ref|XP_006644406.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    227   5e-67   Oryza brachyantha
gb|KDO42000.1|  hypothetical protein CISIN_1g0097201mg                  225   5e-67   Citrus sinensis [Valencia orange]
dbj|BAD68891.1|  glucose-1-phosphate adenylyltransferase large chain    227   6e-67   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ71341.1|  ADP-glucose pyrophosphorylase large subunit             227   7e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001043654.1|  Os01g0633100                                       227   7e-67   
gb|ACJ71342.1|  ADP-glucose pyrophosphorylase large subunit             227   7e-67   Oryza sativa [red rice]
gb|ACJ71339.1|  ADP-glucose pyrophosphorylase large subunit             227   7e-67   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ71335.1|  ADP-glucose pyrophosphorylase large subunit             227   7e-67   Oryza sativa [red rice]
gb|ACJ71336.1|  ADP-glucose pyrophosphorylase large subunit             227   7e-67   Oryza sativa [red rice]
gb|KCW81736.1|  hypothetical protein EUGRSUZ_C03089                     223   7e-67   Eucalyptus grandis [rose gum]
gb|ACJ71347.1|  ADP-glucose pyrophosphorylase large subunit             227   8e-67   Oryza sativa Indica Group [Indian rice]
gb|ACJ71333.1|  ADP-glucose pyrophosphorylase large subunit             227   8e-67   Oryza sativa Indica Group [Indian rice]
gb|ACJ71334.1|  ADP-glucose pyrophosphorylase large subunit             227   8e-67   Oryza sativa Indica Group [Indian rice]
gb|ACJ71344.1|  ADP-glucose pyrophosphorylase large subunit             227   9e-67   Oryza sativa Indica Group [Indian rice]
sp|P12300.1|GLGL3_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    226   1e-66   Triticum aestivum [Canadian hard winter wheat]
gb|AAS00542.1|  ADP-glucose pyrophosphorylase large subunit             226   1e-66   Fragaria x ananassa
gb|EEE55040.1|  hypothetical protein OsJ_02724                          227   1e-66   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ71332.1|  ADP-glucose pyrophosphorylase large subunit             225   3e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ03355.1|  hypothetical protein OsI_25494                          224   4e-66   Oryza sativa Indica Group [Indian rice]
tpg|DAA60137.1|  TPA: glucose-1-phosphate adenylyltransferase           224   9e-66   Zea mays [maize]
gb|ACL52683.1|  unknown                                                 224   1e-65   Zea mays [maize]
gb|KHN43393.1|  Glucose-1-phosphate adenylyltransferase large sub...    224   1e-65   Glycine soja [wild soybean]
ref|XP_003553688.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    224   1e-65   
ref|NP_001059276.1|  Os07g0243200                                       223   1e-65   
ref|XP_010556665.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    224   2e-65   
dbj|BAC16096.1|  putative glucose-1-phosphate adenylyltransferase...    223   2e-65   
gb|AGT17259.1|  ADP-glucose pyrophosphorylase                           220   2e-65   
gb|ACJ71343.1|  ADP-glucose pyrophosphorylase large subunit             223   3e-65   
gb|EEE66870.1|  hypothetical protein OsJ_23681                          224   5e-65   
gb|KDO42002.1|  hypothetical protein CISIN_1g0097201mg                  219   6e-65   
ref|XP_002975788.1|  hypothetical protein SELMODRAFT_267891             221   7e-65   
gb|AAK27727.1|  ADP-glucose pyrophosphorylase large subunit isoform     221   8e-65   
ref|XP_002973739.1|  hypothetical protein SELMODRAFT_149205             222   9e-65   
ref|XP_006850726.1|  hypothetical protein AMTR_s00025p00042290          213   1e-64   
ref|NP_001106058.1|  putative glucose-1-phosphate adenylyltransfe...    220   2e-64   
gb|AGT17261.1|  ADP-glucose pyrophosphorylase                           220   4e-64   
ref|XP_004494490.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    220   5e-64   
ref|XP_010907343.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    211   1e-63   
ref|XP_008673451.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    220   1e-63   
ref|XP_008673450.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    220   1e-63   
dbj|BAG31808.1|  putative ADP-glucose pyrophosphorylase large sub...    206   1e-63   
ref|XP_007163265.1|  hypothetical protein PHAVU_001G219900g             218   2e-63   
ref|XP_004969255.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    218   2e-63   
gb|AFP90368.1|  endosperm glucose-1-phosphate adenylyltransferase...    217   3e-63   
tpg|DAA58441.1|  TPA: shrunken2                                         219   4e-63   
ref|XP_002456012.1|  hypothetical protein SORBIDRAFT_03g028850          217   5e-63   
tpg|DAA58443.1|  TPA: shrunken2                                         220   5e-63   
dbj|BAG31796.1|  putative ADP-glucose pyrophosphorylase large sub...    204   6e-63   
gb|KEH24450.1|  glucose-1-phosphate adenylyltransferase family pr...    214   6e-63   
ref|NP_001121104.1|  glucose-1-phosphate adenylyltransferase larg...    216   7e-63   
ref|XP_003520778.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    217   8e-63   
gb|AEV91541.1|  ADP-glucose pyrophosphorylase                           214   9e-63   
ref|XP_004162474.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    211   9e-63   
gb|AGT16790.1|  ADP-glucose pyrophosphorylase large subunit             216   9e-63   
gb|AFO84093.1|  ADP glucose pyrophosphorylase                           216   2e-62   
gb|AES82317.2|  glucose-1-phosphate adenylyltransferase family pr...    214   1e-61   
ref|XP_008458581.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    213   1e-61   
gb|ABR17521.1|  unknown                                                 213   1e-61   
ref|XP_007222671.1|  hypothetical protein PRUPE_ppa008581mg             208   2e-61   
ref|XP_004149284.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    213   2e-61   
gb|AFK40596.1|  unknown                                                 201   2e-61   
ref|XP_009342669.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    212   4e-61   
ref|XP_001784075.1|  predicted protein                                  210   4e-61   
ref|XP_009342671.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    211   5e-61   
ref|XP_004164723.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    211   6e-61   
ref|XP_004134146.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    211   6e-61   
ref|XP_001767907.1|  predicted protein                                  209   8e-61   
gb|AAS00543.1|  ADP-glucose pyrophosphorylase large subunit             206   1e-60   
ref|NP_001233977.1|  ADP-glucose pyrophosphorylase large subunit        211   1e-60   
ref|XP_008438706.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    210   2e-60   
gb|AEV40470.1|  ADP-glucose pyrophosphorylase 1                         210   2e-60   
ref|XP_010666778.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    210   2e-60   
ref|XP_010666779.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    210   2e-60   
ref|XP_009405044.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    210   3e-60   
ref|XP_001759196.1|  predicted protein                                  207   3e-60   
ref|XP_001751725.1|  predicted protein                                  209   4e-60   
ref|NP_197423.1|  glucose-1-phosphate adenylyltransferase large s...    209   5e-60   
dbj|BAA76362.1|  glucose-1-phosphate adenylyltransferase                209   6e-60   
ref|XP_001782975.1|  predicted protein                                  209   7e-60   
emb|CBI26204.3|  unnamed protein product                                207   8e-60   
gb|AES92592.2|  glucose-1-phosphate adenylyltransferase family pr...    208   9e-60   
ref|NP_001266131.1|  glucose-1-phosphate adenylyltransferase larg...    208   1e-59   
ref|XP_002281069.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    208   1e-59   
ref|XP_002873938.1|  hypothetical protein ARALYDRAFT_488807             207   2e-59   
ref|XP_002517196.1|  glucose-1-phosphate adenylyltransferase, put...    207   2e-59   
ref|XP_004296919.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    207   2e-59   
ref|XP_001774318.1|  predicted protein                                  206   2e-59   
ref|XP_003626099.1|  Glucose-1-phosphate adenylyltransferase            207   3e-59   
ref|XP_010255929.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    207   3e-59   
ref|XP_010551763.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    207   3e-59   
ref|XP_011090768.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    207   3e-59   
ref|XP_006577921.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   4e-59   
ref|XP_008800702.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   4e-59   
ref|XP_009120906.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   5e-59   
gb|KCW84250.1|  hypothetical protein EUGRSUZ_B01108                     206   5e-59   
gb|AFL55399.1|  ADP-glucose pyrophosphorylase large subunit 4           206   7e-59   
emb|CDY68209.1|  BnaC09g54280D                                          206   7e-59   
ref|XP_010035400.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   7e-59   
gb|KJB38095.1|  hypothetical protein B456_006G236600                    204   7e-59   
ref|XP_009603253.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   8e-59   
ref|XP_011034216.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   8e-59   
gb|AHL44840.1|  glucose-1-phosphate adenylyltransferase large sub...    206   8e-59   
dbj|BAF47749.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb3     206   8e-59   
gb|AHG12640.1|  ADP-glucose pyrophosphorylase large subunit             206   8e-59   
gb|EPS66248.1|  hypothetical protein M569_08527                         205   9e-59   
ref|XP_009760082.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   1e-58   
ref|XP_009338465.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   1e-58   
ref|XP_008340932.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   1e-58   
ref|XP_002311802.1|  ADP-glucose pyrophosphorylase family protein       206   1e-58   
ref|XP_008222970.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   1e-58   
emb|CDO99014.1|  unnamed protein product                                206   1e-58   
ref|XP_007034660.1|  ADP glucose pyrophosphorylase large subunit ...    202   1e-58   
emb|CDY02573.1|  BnaC02g08620D                                          205   1e-58   
gb|AGB85112.1|  ADP-glucose pyrophosphorylase large subunit 4           205   1e-58   
ref|XP_009345065.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   1e-58   
ref|XP_010039908.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    205   2e-58   
ref|XP_001784242.1|  predicted protein                                  203   2e-58   
ref|XP_001778378.1|  predicted protein                                  203   2e-58   
emb|CDY47206.1|  BnaAnng08760D                                          205   2e-58   
gb|KDO74746.1|  hypothetical protein CISIN_1g013483mg                   201   2e-58   
ref|XP_007153923.1|  hypothetical protein PHAVU_003G076500g             205   2e-58   
gb|KJB38094.1|  hypothetical protein B456_006G236600                    205   2e-58   
ref|XP_009126310.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    205   2e-58   
ref|NP_001275395.1|  glucose-1-phosphate adenylyltransferase larg...    204   3e-58   
ref|XP_010454187.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   3e-58   
ref|XP_010042059.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    196   3e-58   
ref|XP_008390847.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   3e-58   
ref|NP_001241391.1|  uncharacterized protein LOC100810451               204   4e-58   
ref|XP_009364201.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   4e-58   
gb|EEE59878.1|  hypothetical protein OsJ_12478                          201   4e-58   
ref|NP_001105717.1|  glucose-1-phosphate adenylyltransferase larg...    204   4e-58   
ref|XP_006400480.1|  hypothetical protein EUTSA_v10013265mg             204   5e-58   
ref|XP_010420717.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   5e-58   
gb|AIZ00993.1|  ADP-glucose pyrophosphorylase large subunit 1           203   8e-58   
gb|KFK26166.1|  hypothetical protein AALP_AA8G211600                    203   9e-58   
ref|XP_003549968.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    203   1e-57   
ref|XP_006651788.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    201   1e-57   
ref|XP_007034659.1|  ADP glucose pyrophosphorylase large subunit ...    202   1e-57   
gb|KDO74743.1|  hypothetical protein CISIN_1g013483mg                   200   2e-57   
ref|XP_007136617.1|  hypothetical protein PHAVU_009G059800g             199   2e-57   
gb|KDO74742.1|  hypothetical protein CISIN_1g013483mg                   200   2e-57   
tpg|DAA51190.1|  TPA: hypothetical protein ZEAMMB73_768829              195   2e-57   
ref|NP_001051184.1|  Os03g0735000                                       202   2e-57   
gb|EEC76133.1|  hypothetical protein OsI_13419                          202   2e-57   
ref|XP_010492975.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    202   3e-57   
gb|KDP40133.1|  hypothetical protein JCGZ_02131                         201   4e-57   
gb|AAM95945.1|  ADP-glucose pyrophosphorylase large subunit             201   4e-57   
ref|XP_006489328.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    201   6e-57   
ref|XP_010093993.1|  Glucose-1-phosphate adenylyltransferase larg...    201   6e-57   
ref|XP_006419854.1|  hypothetical protein CICLE_v10004731mg             201   7e-57   
sp|P12298.1|GLGL1_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    194   1e-56   
ref|XP_006581201.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    199   1e-56   
ref|XP_006289333.1|  hypothetical protein CARUB_v10002818mg             200   2e-56   
ref|XP_006404613.1|  hypothetical protein EUTSA_v10000141mg             199   2e-56   
gb|AGT16263.1|  plastid ADP-glucose pyrophosphorylase                   198   3e-56   
gb|EYU41519.1|  hypothetical protein MIMGU_mgv1a004639mg                198   5e-56   
gb|AGT17074.1|  glucose-1-phosphate adenylyltransferase                 197   7e-56   
ref|XP_010941806.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    198   1e-55   
gb|KCW45857.1|  hypothetical protein EUGRSUZ_L00275                     194   1e-55   
emb|CAX51356.1|  large subunit of ADP-glucose pyrophosphorylase         196   2e-55   
dbj|BAJ90901.1|  predicted protein                                      196   2e-55   
gb|AAC49729.1|  ADP-glucose pyrophosphorylase large subunit             196   3e-55   
ref|XP_003610395.1|  Glucose-1-phosphate adenylyltransferase            197   3e-55   
gb|EMT06319.1|  Glucose-1-phosphate adenylyltransferase large sub...    195   3e-55   
gb|ABD66657.1|  plastid ADP-glucose pyrophosphorylase large subunit     196   3e-55   
ref|XP_002463921.1|  hypothetical protein SORBIDRAFT_01g008940          196   4e-55   
ref|NP_001106017.1|  plastid ADP-glucose pyrophosphorylase large ...    196   4e-55   
gb|EMS50037.1|  Glucose-1-phosphate adenylyltransferase large sub...    194   6e-55   
gb|AGT16453.1|  glucose-1-phosphate adenylyltransferase                 195   8e-55   
ref|XP_003560093.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    194   1e-54   
gb|ABS19875.1|  putative glucose-1-phosphate adenylyltransferase ...    192   7e-54   
ref|XP_007034661.1|  ADP glucose pyrophosphorylase large subunit ...    189   7e-54   
emb|CAA51778.1|  glucose-1-phosphate adenylyltransferase                183   1e-53   
ref|XP_004981865.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    193   2e-53   
ref|XP_010910891.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    182   3e-53   
ref|XP_005842916.1|  hypothetical protein CHLNCDRAFT_37654              190   5e-53   
pir||S42547  glucose-1-phosphate adenylyltransferase (EC 2.7.7.27...    181   8e-53
gb|AAK27685.1|AF347698_1  ADP-glucose pyrophosphorylase large sub...    189   5e-52   
ref|XP_010914842.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    186   8e-52   
gb|AAB65844.1|  ADP-glucose pyrophosphorylase                           178   1e-51   
emb|CAB37841.1|  ADP-glucose pyrophosphorylase large subunit            177   2e-51   
ref|XP_005649170.1|  glucose-1-phosphate adenylyltransferase            186   2e-51   
ref|WP_015176220.1|  Glucose-1-phosphate adenylyltransferase            184   2e-51   
ref|WP_022607393.1|  glucose-1-phosphate adenylyltransferase            184   3e-51   
gb|AAM73733.1|  ADP-glucose pyrophosphorylase large subunit             176   3e-51   
ref|WP_012597885.1|  glucose-1-phosphate adenylyltransferase            183   4e-51   
gb|AAB24191.2|  endosperm ADP-glucose pyrophosphorylase subunit h...    185   4e-51   
gb|AAM73734.1|  ADP-glucose pyrophosphorylase large subunit             176   4e-51   
gb|KCW45645.1|  hypothetical protein EUGRSUZ_L00600                     185   5e-51   
gb|KCW55369.1|  hypothetical protein EUGRSUZ_I01281                     184   7e-51   
ref|WP_035156038.1|  glucose-1-phosphate adenylyltransferase            182   8e-51   
ref|WP_015228619.1|  glucose-1-phosphate adenylyltransferase            182   9e-51   
ref|XP_011401140.1|  Glucose-1-phosphate adenylyltransferase larg...    183   1e-50   
ref|WP_015129202.1|  glucose-1-phosphate adenylyltransferase            182   1e-50   
gb|AAB38781.1|  ADP-glucose pyrophosphorylase large subunit             184   1e-50   
ref|WP_006635221.1|  glucose-1-phosphate adenylyltransferase            182   1e-50   
ref|WP_002761951.1|  glucose-1-phosphate adenylyltransferase            182   1e-50   
pir||S22525  glucose-1-phosphate adenylyltransferase (EC 2.7.7.27...    175   2e-50
ref|WP_015200127.1|  glucose-1-phosphate adenylyltransferase            181   3e-50   
gb|ABQ81973.1|  ADP-glucose pyrophosphorylase                           173   4e-50   
ref|XP_002507549.1|  adp-glucose pyrophosphorylase                      181   4e-50   
ref|XP_001422382.1|  predicted protein                                  182   5e-50   
ref|WP_029636857.1|  glucose-1-phosphate adenylyltransferase [          181   5e-50   
ref|WP_002789937.1|  glucose-1-phosphate adenylyltransferase            180   6e-50   
ref|WP_012265852.1|  glucose-1-phosphate adenylyltransferase            180   8e-50   
ref|WP_035759831.1|  MULTISPECIES: glucose-1-phosphate adenylyltr...    180   1e-49   
ref|WP_015195259.1|  Glucose-1-phosphate adenylyltransferase            179   1e-49   
ref|WP_006621302.1|  glucose-1-phosphate adenylyltransferase            180   1e-49   
gb|KDD76751.1|  nucleotidyl transferase                                 179   1e-49   
ref|WP_002768734.1|  glucose-1-phosphate adenylyltransferase            179   2e-49   
ref|WP_002784562.1|  Glucose-1-phosphate adenylyltransferase            179   2e-49   
gb|ABQ81990.1|  ADP-glucose pyrophosphorylase                           171   2e-49   
ref|XP_003056043.1|  adp-glucose pyrophosphorylase                      180   2e-49   
ref|WP_040930274.1|  glucose-1-phosphate adenylyltransferase            171   2e-49   
ref|WP_015189052.1|  Glucose-1-phosphate adenylyltransferase            179   3e-49   
ref|WP_015226172.1|  glucose-1-phosphate adenylyltransferase            178   4e-49   
gb|ACJ06583.1|  chloroplast putative glucose-1-phosphate adenylyl...    169   4e-49   
ref|WP_006853039.1|  glucose-1-phosphate adenylyltransferase            178   5e-49   
ref|WP_004268476.1|  glucose-1-phosphate adenylyltransferase            178   5e-49   
ref|WP_002798919.1|  glucose-1-phosphate adenylyltransferase            178   5e-49   
ref|WP_011619605.1|  glucose-1-phosphate adenylyltransferase            178   5e-49   
ref|WP_013322137.1|  glucose-1-phosphate adenylyltransferase            177   7e-49   
ref|WP_017653597.1|  glucose-1-phosphate adenylyltransferase            177   7e-49   
emb|CAA51776.1|  glucose-1-phosphate adenylyltransferase                171   7e-49   
ref|WP_019489832.1|  glucose-1-phosphate adenylyltransferase            177   8e-49   
gb|ACJ06586.1|  chloroplast putative glucose-1-phosphate adenylyl...    168   8e-49   
ref|WP_015208914.1|  glucose-1-phosphate adenylyltransferase            177   9e-49   
dbj|GAL94421.1|  glucose-1-phosphate adenylyltransferase                177   1e-48   
ref|WP_006171646.1|  glucose-1-phosphate adenylyltransferase            177   1e-48   
ref|WP_038652218.1|  glucose-1-phosphate adenylyltransferase            177   1e-48   
ref|WP_011933203.1|  glucose-1-phosphate adenylyltransferase            177   2e-48   
ref|WP_006617056.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
ref|WP_008201765.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
ref|WP_006041310.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
ref|WP_042151366.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
ref|WP_026797575.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
ref|WP_039741952.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
ref|WP_027249398.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
ref|WP_026793759.1|  MULTISPECIES: glucose-1-phosphate adenylyltr...    176   2e-48   
ref|WP_004158460.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
ref|WP_026787044.1|  MULTISPECIES: glucose-1-phosphate adenylyltr...    176   2e-48   
ref|WP_024971182.1|  glucose-1-phosphate adenylyltransferase            176   2e-48   
gb|KHN14186.1|  Glucose-1-phosphate adenylyltransferase large sub...    177   3e-48   



>emb|CAB51610.1| ADP-glucose pyrophosphorylase large subunit [Ipomoea batatas]
Length=306

 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/151 (98%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE
Sbjct  156  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  215

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGV
Sbjct  216  LKDTLMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGV  275

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRPDEGFYIRSGITIIMEKATI DGTVI
Sbjct  276  QESDRPDEGFYIRSGITIIMEKATIRDGTVI  306



>emb|CAB52196.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=450

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC+VEHSIIGERSRLDCGVE
Sbjct  300  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECSVEHSIIGERSRLDCGVE  359

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD YETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV
Sbjct  360  LKDTLMMGADTYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  419

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            Q+SDRPDEGFYIRSGITIIMEKATIPDGTVI
Sbjct  420  QDSDRPDEGFYIRSGITIIMEKATIPDGTVI  450



>dbj|BAF47746.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1A [Ipomoea 
batatas]
Length=517

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/151 (98%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE
Sbjct  367  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGV
Sbjct  427  LKDTLMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRPDEGFYIRSGITIIMEKATI DGTVI
Sbjct  487  QESDRPDEGFYIRSGITIIMEKATIRDGTVI  517



>gb|AFL55396.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/151 (98%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE
Sbjct  367  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGV
Sbjct  427  LKDTLMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRPDEGFYIRSGITIIMEKATI DGTVI
Sbjct  487  QESDRPDEGFYIRSGITIIMEKATIRDGTVI  517



>gb|AGB85109.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score =   302 bits (774),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 147/151 (97%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFY SPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE
Sbjct  367  KFEFYDPKTPFYASPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGV
Sbjct  427  LKDTLMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRPDEGFYIRSGITIIMEKATI DGTVI
Sbjct  487  QESDRPDEGFYIRSGITIIMEKATIRDGTVI  517



>emb|CAB55496.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=385

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/151 (96%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPK PFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE
Sbjct  235  KFEFYDPKIPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  294

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD YETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGV
Sbjct  295  LKDTLMMGADTYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGV  354

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRPDEGFYIRSGITIIMEKATI  GTVI
Sbjct  355  QESDRPDEGFYIRSGITIIMEKATIRYGTVI  385



>emb|CAB55495.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=490

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/151 (97%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE
Sbjct  340  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  399

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGK VVI NKDGV
Sbjct  400  LKDTLMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKHVVITNKDGV  459

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRPDEGFYIRSGITIIMEKATI  GTVI
Sbjct  460  QESDRPDEGFYIRSGITIIMEKATIRYGTVI  490



>gb|AAC21562.1| ADP-glucose pyrophosphorylase large subunit [Ipomoea batatas]
Length=517

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/151 (96%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE
Sbjct  367  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD YETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGK VVI NKDGV
Sbjct  427  LKDTLMMGADTYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKHVVITNKDGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRPDEGFYIRSGITIIMEKATI DGTV+
Sbjct  487  QESDRPDEGFYIRSGITIIMEKATIRDGTVV  517



>ref|XP_009763056.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Nicotiana sylvestris]
Length=528

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC+V+HSI+GERSRLDCGVE
Sbjct  378  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECSVDHSIVGERSRLDCGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IGKDVVIMNKDGV
Sbjct  438  LKDTLMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGKDVVIMNKDGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIR+G+TI+ EKATI DGTVI
Sbjct  498  QEADRPEEGFYIRAGLTIVAEKATIKDGTVI  528



>ref|XP_009621409.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Nicotiana tomentosiformis]
Length=528

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC+V+HSI+GERSRLDCGVE
Sbjct  378  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECSVDHSIVGERSRLDCGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD Y+TESEIASLLA+G VPIG+GENTKIRN IIDKN +IGKDVVIMNKDGV
Sbjct  438  LKDTLMMGADYYQTESEIASLLAEGKVPIGIGENTKIRNCIIDKNAKIGKDVVIMNKDGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIR G+TII EKATI DGTVI
Sbjct  498  QEADRPEEGFYIRGGLTIIAEKATIKDGTVI  528



>gb|AFO84074.1| ADP glucose pyrophosphorylase, partial [Actinidia chinensis]
Length=344

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDPKTPF+TSPRFLPPTKID CKIKD+IISHGCFLREC+VEHSI+GERSRLD GVE
Sbjct  194  KFSFYDPKTPFFTSPRFLPPTKIDRCKIKDSIISHGCFLRECSVEHSIVGERSRLDYGVE  253

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD Y+TESEIASLLA+GN+PIG+G+NTKIRN IIDKN +IGKDVVI+NKDGV
Sbjct  254  LKDTLMMGADYYQTESEIASLLAEGNIPIGIGKNTKIRNCIIDKNAKIGKDVVIVNKDGV  313

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRPD+GFYIRSGITII+EKATI DGTVI
Sbjct  314  EEADRPDQGFYIRSGITIILEKATITDGTVI  344



>ref|XP_011088418.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088419.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088420.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088421.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088422.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088423.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
Length=526

 Score =   279 bits (714),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC VEHSI+GERSRLD GVE
Sbjct  376  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECIVEHSIVGERSRLDSGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD+LMMGAD Y+TESEIASLLA G VP+G+G NTKIRN IIDKN RIGKDV+I NKDGV
Sbjct  436  LKDSLMMGADYYQTESEIASLLAQGKVPMGIGRNTKIRNCIIDKNARIGKDVIIKNKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGITII+EKATI DGTVI
Sbjct  496  QEADRPEEGFYIRSGITIIVEKATISDGTVI  526



>dbj|BAF47747.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1B [Ipomoea 
batatas]
Length=515

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC VEHSI+GERSRLD GVE
Sbjct  365  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECIVEHSIVGERSRLDFGVE  424

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD YETESEIASLLADG VPIG+G NTKI N IIDKNVRIGKDV+I NKDGV
Sbjct  425  LKDTLMMGADYYETESEIASLLADGKVPIGIGHNTKISNCIIDKNVRIGKDVIIANKDGV  484

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGI +IMEKA I DGTVI
Sbjct  485  EEADRPEEGFYIRSGIPVIMEKAVIKDGTVI  515



>gb|AFL55397.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC VEHSI+GERSRLD GVE
Sbjct  365  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECIVEHSIVGERSRLDFGVE  424

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD YETESEIASLLADG VPIG+G NTKI N IIDKNVRIGKDV+I NKDGV
Sbjct  425  LKDTLMMGADYYETESEIASLLADGKVPIGIGHNTKISNCIIDKNVRIGKDVIIANKDGV  484

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGI +IMEKA I DGTVI
Sbjct  485  EEADRPEEGFYIRSGIPVIMEKAVIKDGTVI  515



>gb|KDO42003.1| hypothetical protein CISIN_1g0097201mg [Citrus sinensis]
Length=353

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVEL
Sbjct  204  FHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVEL  263

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQ
Sbjct  264  KDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQ  323

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP+ GFYIRSGITIIMEKATI DG VI
Sbjct  324  EADRPELGFYIRSGITIIMEKATIEDGMVI  353



>sp|Q00081.1|GLGL1_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
1; AltName: Full=ADP-glucose pyrophosphorylase; AltName: 
Full=ADP-glucose synthase; AltName: Full=AGPase S; AltName: 
Full=Alpha-D-glucose-1-phosphate adenyl transferase, partial 
[Solanum tuberosum]
 emb|CAA43490.1| ADP-glucose pyrophosphorylase large subunit [Solanum tuberosum]
Length=470

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+FYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+C+VEHSI+GERSRLDCGVE
Sbjct  320  EFQFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCSVEHSIVGERSRLDCGVE  379

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGV
Sbjct  380  LKDTFMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGV  439

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGI II+EKATI DGTVI
Sbjct  440  QEADRPEEGFYIRSGIIIILEKATIRDGTVI  470



>gb|AAD56405.1|AF184345_1 ADP-glucose pyrophosphorylase large subunit [Solanum habrochaites]
Length=520

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+FYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+C+VEHSI+GERSRLDCGVE
Sbjct  370  EFQFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCSVEHSIVGERSRLDCGVE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGV
Sbjct  430  LKDTFMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGITII EKATI DGTVI
Sbjct  490  QEADRPEEGFYIRSGITIISEKATIRDGTVI  520



>ref|NP_001233918.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|AAB40723.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=516

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+FYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+CTVEHSI+GERSRLDCGVE
Sbjct  366  EFQFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCTVEHSIVGERSRLDCGVE  425

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGV
Sbjct  426  LKDTFMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGV  485

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGI II EKATI DGTVI
Sbjct  486  QEADRPEEGFYIRSGIIIISEKATIRDGTVI  516



>gb|ABC26923.1| ADPglucose pyrophosphorylase large subunit [Solanum habrochaites]
Length=527

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+FYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+C+VEHSI+GERSRLDCGVE
Sbjct  377  EFQFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCSVEHSIVGERSRLDCGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGV
Sbjct  437  LKDTFMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGITII EKATI DGTVI
Sbjct  497  QEADRPEEGFYIRSGITIISEKATIRDGTVI  527



>gb|AAC49941.1| ADP-glucose pyrophosphorylase large subunit 1 [Solanum lycopersicum]
Length=524

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+FYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+CTVEHSI+GERSRLDCGVE
Sbjct  374  EFQFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCTVEHSIVGERSRLDCGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGV
Sbjct  434  LKDTFMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGI II EKATI DGTVI
Sbjct  494  QEADRPEEGFYIRSGIIIIAEKATIRDGTVI  524



>gb|KDO42001.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=419

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVEL
Sbjct  270  FHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVEL  329

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQ
Sbjct  330  KDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQ  389

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP+ GFYIRSGITIIMEKATI DG VI
Sbjct  390  EADRPELGFYIRSGITIIMEKATIEDGMVI  419



>gb|ABC26921.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|ABC26922.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=524

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+FYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+CTVEHSI+GERSRLDCGVE
Sbjct  374  EFQFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCTVEHSIVGERSRLDCGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGV
Sbjct  434  LKDTFMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGI II EKATI DGTVI
Sbjct  494  QEADRPEEGFYIRSGIIIISEKATIRDGTVI  524



>gb|AGB85110.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPR LPPTKIDNCKIKDAIISHGCFLREC VEHSI+GERSRLD GVE
Sbjct  365  KFEFYDPKTPFYTSPRLLPPTKIDNCKIKDAIISHGCFLRECIVEHSIVGERSRLDFGVE  424

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD YETESEIASLLADG VPIG+G NTKI N IIDKNVRIGKDV+I NKDGV
Sbjct  425  LKDTLMMGADYYETESEIASLLADGKVPIGIGHNTKISNCIIDKNVRIGKDVIIANKDGV  484

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGI +IMEK  I DGTVI
Sbjct  485  EEADRPEEGFYIRSGIPVIMEKVVIKDGTVI  515



>ref|XP_006365120.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Solanum tuberosum]
 ref|XP_006365121.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Solanum tuberosum]
Length=527

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+FYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+C+VEHSI+GERSRLDCGVE
Sbjct  377  EFQFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCSVEHSIVGERSRLDCGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGV
Sbjct  437  LKDTFMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGI II+EKATI DGTVI
Sbjct  497  QEADRPEEGFYIRSGIIIILEKATIRDGTVI  527



>gb|KDO41998.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=449

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVEL
Sbjct  300  FHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVEL  359

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQ
Sbjct  360  KDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQ  419

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP+ GFYIRSGITIIMEKATI DG VI
Sbjct  420  EADRPELGFYIRSGITIIMEKATIEDGMVI  449



>ref|NP_001275823.1| glucose-1-phosphate adenylyltransferase large subunit 1-like 
[Citrus sinensis]
 gb|ACF77017.1| ADP-glucose pyrophosphorylase large subunit [Citrus sinensis]
Length=527

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDPKTPFYTSPRFLPPTKIDNC++KDAIISHGCFLRECTVEHSI+GERSR+D GVEL
Sbjct  378  FHFYDPKTPFYTSPRFLPPTKIDNCRMKDAIISHGCFLRECTVEHSIVGERSRIDYGVEL  437

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKDGVQ
Sbjct  438  KDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDGVQ  497

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP+ GFYIRSGITIIMEKATI DG VI
Sbjct  498  EADRPELGFYIRSGITIIMEKATIEDGMVI  527



>gb|AAD56042.1|AF184598_1 ADP-glucose pyrophosphorylase large subunit [Citrus unshiu]
Length=531

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDPKTPFYTSPRFLPPTKIDNC++KDAIISHGCFLRECTVEHSI+GERSR+D GVEL
Sbjct  382  FHFYDPKTPFYTSPRFLPPTKIDNCRMKDAIISHGCFLRECTVEHSIVGERSRIDYGVEL  441

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKDGVQ
Sbjct  442  KDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDGVQ  501

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP+ GFYIRSGITIIMEKATI DG VI
Sbjct  502  EADRPELGFYIRSGITIIMEKATIEDGMVI  531



>gb|KJB32481.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=395

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +FEFYDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  245  RFEFYDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSIVGERSRLDYGVE  304

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+M+GAD Y+TE EIASLLA+G VPIG+G N+KIRN IIDKN +IGKDVVI+NKDGV
Sbjct  305  LQDTVMLGADYYQTEPEIASLLAEGKVPIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGV  364

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSG+TIIMEKATI DGTVI
Sbjct  365  EEADRPEEGFYIRSGLTIIMEKATIADGTVI  395



>gb|AGS94412.1| ADP-glucose pyrophosphorylase large subunit 4 [Actinidia deliciosa]
Length=524

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDPKTPF+TSPRFLPPTKID CKIKD+IISHGCFLREC+VEHSI+GERSRLD GVE
Sbjct  374  KFSFYDPKTPFFTSPRFLPPTKIDRCKIKDSIISHGCFLRECSVEHSIVGERSRLDYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD Y+TESEIASLLA+GN+PIGVG+NTKIRN IIDKN +IGK VVI+NKDGV
Sbjct  434  LKDTLMMGADYYQTESEIASLLAEGNIPIGVGKNTKIRNCIIDKNAKIGKGVVIVNKDGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+D+PD+GFYIRSGITII+EKATI DGTVI
Sbjct  494  EEADQPDQGFYIRSGITIILEKATITDGTVI  524



>ref|XP_006423322.1| hypothetical protein CICLE_v10028195mg [Citrus clementina]
 ref|XP_006487217.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Citrus sinensis]
 gb|ESR36562.1| hypothetical protein CICLE_v10028195mg [Citrus clementina]
Length=527

 Score =   271 bits (694),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVEL
Sbjct  378  FHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVEL  437

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQ
Sbjct  438  KDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQ  497

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP+ GFYIRSGITIIMEKATI DG VI
Sbjct  498  EADRPELGFYIRSGITIIMEKATIEDGMVI  527



>ref|NP_001284451.1| myeloid leukemia factor 1 [Cucumis melo]
 gb|AAB91463.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo]
Length=525

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLREC+++HSI+GERSRLD GVE
Sbjct  375  KFEFYDPKTPFYTSPRFLPPTKIDRCQIVDAIISHGCFLRECSIQHSIVGERSRLDYGVE  434

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGADNY+TESEI  LLA+G VP+G+G NTKIR  IIDKN +IGKDV+IMNKDGV
Sbjct  435  LKDTIMMGADNYQTESEITGLLAEGKVPVGIGPNTKIRKCIIDKNAKIGKDVIIMNKDGV  494

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIRSGITI+MEKATI DGTVI
Sbjct  495  QEADRPEQGFYIRSGITIVMEKATIEDGTVI  525



>gb|KDP41770.1| hypothetical protein JCGZ_26788 [Jatropha curcas]
Length=527

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTK+D C+I DAIISHGCFLRECT++HS++GERSRLD GVE
Sbjct  377  KFEFYDPKTPFYTSPRFLPPTKMDKCRIVDAIISHGCFLRECTIQHSVVGERSRLDYGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+M+GAD Y+TE+EIASLLADG VPIGVG NTKI+N IIDKN +IGKDVVIMNKDGV
Sbjct  437  LKDTVMLGADYYQTEAEIASLLADGKVPIGVGRNTKIKNCIIDKNAKIGKDVVIMNKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGITII EKATI DG VI
Sbjct  497  QEADRPEEGFYIRSGITIIAEKATIEDGIVI  527



>ref|XP_002512925.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF49428.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=531

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            FEFYDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLRECTV HS++GERSRLD GVEL
Sbjct  382  FEFYDPKTPFYTSPRFLPPTKIDKCRIVDAIISHGCFLRECTVRHSVVGERSRLDYGVEL  441

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TE+EIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NKDGVQ
Sbjct  442  KDTVMLGADYYQTETEIASLLAEGKVPIGVGRNTKIKNCIIDKNAKIGKDVVIVNKDGVQ  501

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP+EGFYIRSGITIIMEKATI DGTVI
Sbjct  502  EADRPEEGFYIRSGITIIMEKATIEDGTVI  531



>emb|CDO97030.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTKID C+I D+IISHGCFLRECTVEHSI+GERSRLD GVE
Sbjct  372  KFQFYDPKTPFFTSPRFLPPTKIDKCQIMDSIISHGCFLRECTVEHSIVGERSRLDYGVE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT MMGAD Y+TESEIASLLA+G VPIG+G+NTKIRN IIDKN +IGKDV I+NKDGV
Sbjct  432  LKDTFMMGADYYQTESEIASLLAEGKVPIGIGQNTKIRNCIIDKNAKIGKDVAILNKDGV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIR+GIT+I+EKATI D TVI
Sbjct  492  QEADRPEEGFYIRAGITVILEKATINDRTVI  522



>ref|XP_010088945.1| Glucose-1-phosphate adenylyltransferase large subunit 3 [Morus 
notabilis]
 gb|EXB37149.1| Glucose-1-phosphate adenylyltransferase large subunit 3 [Morus 
notabilis]
Length=535

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTKID C+I DAIISHGCFLREC+V+ SI+GERSRLD GVE
Sbjct  385  KFEFYDPKTPFFTSPRFLPPTKIDKCRIVDAIISHGCFLRECSVQRSIVGERSRLDYGVE  444

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G VPIG+G+NTKIRN IIDKNV+IGKDVVI NKDGV
Sbjct  445  LKDTIMMGADYYQTESEIASLLAEGKVPIGIGQNTKIRNCIIDKNVKIGKDVVIRNKDGV  504

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
             E+DRP+EGFYIRSGITII+EKATI DGTVI
Sbjct  505  HEADRPEEGFYIRSGITIIVEKATIEDGTVI  535



>ref|XP_003537869.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 ref|XP_006590891.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
 gb|KHN39792.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=530

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F+FYDPKTP YTSPRFLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GVEL
Sbjct  381  FKFYDPKTPIYTSPRFLPPTKIDKCRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVEL  440

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQ
Sbjct  441  QDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQ  500

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP++GFYIRSGIT+I+EKATI DGTVI
Sbjct  501  EADRPEDGFYIRSGITVILEKATIEDGTVI  530



>ref|XP_008460955.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis melo]
 ref|XP_008460956.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis melo]
Length=526

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLREC+++HSI+GERSRLD GVE
Sbjct  376  KFEFYDPKTPFYTSPRFLPPTKIDRCQIVDAIISHGCFLRECSIQHSIVGERSRLDYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGADNY+TE EI  LLA+G VP+G+G NTKIR  IIDKN +IGKDV+IMNKDGV
Sbjct  436  LKDTIMMGADNYQTELEITGLLAEGKVPVGIGPNTKIRKCIIDKNAKIGKDVIIMNKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIRSGITI+MEKATI DGTVI
Sbjct  496  QEADRPEQGFYIRSGITIVMEKATIEDGTVI  526



>ref|XP_003541029.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Glycine max]
 gb|KHN25384.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=528

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F+FYDPKTP YTSPRFLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GVEL
Sbjct  379  FKFYDPKTPIYTSPRFLPPTKIDKCRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVEL  438

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQ
Sbjct  439  QDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQ  498

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP++GFYIRSGIT+I+EKATI DGTVI
Sbjct  499  EADRPEDGFYIRSGITVILEKATIEDGTVI  528



>gb|KHG23571.1| Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic 
-like protein [Gossypium arboreum]
Length=526

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  376  KFEFYDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSIVGERSRLDYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+M+GAD Y+TE EIASLLA+G VPIG+G N+KIRN IIDKN +IGKDVVI+NKDGV
Sbjct  436  LQDTVMLGADYYQTEPEIASLLAEGKVPIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSG+TIIMEKATI DGTVI
Sbjct  496  EEADRPEEGFYIRSGLTIIMEKATIADGTVI  526



>gb|AAB91467.1| ADP-glucose pyrophosphorylase large subunit 1 [Citrullus lanatus 
subsp. vulgaris]
Length=526

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP YTSPRFLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  376  KFEFYDPKTPIYTSPRFLPPTKIDKCQIVDAIISHGCFLRECSVQHSIVGERSRLDYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE EIA LLA+G VPIG+G NTKIRN IIDKN +IGKDVVIMNK+GV
Sbjct  436  LKDTIMMGADTYQTEPEIAGLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVVIMNKEGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIRSGITII+EKATI DGTVI
Sbjct  496  QEADRPEQGFYIRSGITIILEKATIEDGTVI  526



>gb|KCW55368.1| hypothetical protein EUGRSUZ_I01281 [Eucalyptus grandis]
Length=395

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSPRFLPPTKIDNCK+KDAIISHGCFLREC VE SI+GERSRLD GVE
Sbjct  245  KFEFYDPKTPIFTSPRFLPPTKIDNCKLKDAIISHGCFLRECRVERSIVGERSRLDSGVE  304

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G VPIG+G+NTKIRN IIDKN +IGKDV I+NKDGV
Sbjct  305  LKDTVMMGADYYQTESEIASLLAEGKVPIGIGKNTKIRNCIIDKNAKIGKDVAIVNKDGV  364

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP +GFYIR GIT+I+EKATI DGTVI
Sbjct  365  EEADRPGDGFYIRLGITVILEKATIEDGTVI  395



>emb|CBI37674.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFY+PKTP +TSPRFLPPTKI+ C++ DAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  367  KFEFYNPKTPIFTSPRFLPPTKIEQCQVVDAIISHGCFLRECSVKHSIVGERSRLDYGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD Y+TESEIASLLA+GNVPIG+G NTKIRN IIDKN +IGKD VI+NKDGV
Sbjct  427  LKDTLMMGADFYQTESEIASLLAEGNVPIGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRPD+GFYIRSGITII+EKATI DGTVI
Sbjct  487  QEADRPDDGFYIRSGITIILEKATIKDGTVI  517



>gb|KJB32482.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=521

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +FEFYDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  371  RFEFYDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSIVGERSRLDYGVE  430

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+M+GAD Y+TE EIASLLA+G VPIG+G N+KIRN IIDKN +IGKDVVI+NKDGV
Sbjct  431  LQDTVMLGADYYQTEPEIASLLAEGKVPIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGV  490

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSG+TIIMEKATI DGTVI
Sbjct  491  EEADRPEEGFYIRSGLTIIMEKATIADGTVI  521



>gb|KJB32479.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
 gb|KJB32480.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=524

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +FEFYDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  374  RFEFYDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSIVGERSRLDYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+M+GAD Y+TE EIASLLA+G VPIG+G N+KIRN IIDKN +IGKDVVI+NKDGV
Sbjct  434  LQDTVMLGADYYQTEPEIASLLAEGKVPIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSG+TIIMEKATI DGTVI
Sbjct  494  EEADRPEEGFYIRSGLTIIMEKATIADGTVI  524



>ref|XP_002283855.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
Length=527

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFY+PKTP +TSPRFLPPTKI+ C++ DAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  377  KFEFYNPKTPIFTSPRFLPPTKIEQCQVVDAIISHGCFLRECSVKHSIVGERSRLDYGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD Y+TESEIASLLA+GNVPIG+G NTKIRN IIDKN +IGKD VI+NKDGV
Sbjct  437  LKDTLMMGADFYQTESEIASLLAEGNVPIGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRPD+GFYIRSGITII+EKATI DGTVI
Sbjct  497  QEADRPDDGFYIRSGITIILEKATIKDGTVI  527



>ref|XP_007042146.1| Glucose-1-phosphate adenylyltransferase family protein [Theobroma 
cacao]
 gb|EOX97977.1| Glucose-1-phosphate adenylyltransferase family protein [Theobroma 
cacao]
Length=526

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC V+HSI+GERSRLD GVE
Sbjct  376  KFEFYDPKTPFYTSPRYLPPTKIDKCQIKDAIISHGCFLRECNVQHSIVGERSRLDYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+M+GAD Y+TESEIASLLA+G VPIG+G NTKIR  IIDKN +IGKDVVI+NKD V
Sbjct  436  LQDTVMLGADYYQTESEIASLLAEGKVPIGIGRNTKIRTCIIDKNAKIGKDVVIVNKDDV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGITII EKATI DGTVI
Sbjct  496  QEADRPEEGFYIRSGITIIQEKATIEDGTVI  526



>ref|XP_006581117.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
Length=409

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  760  RKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGV  581
             KFEFYDPK P YTSP FLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GV
Sbjct  258  HKFEFYDPKIPIYTSPGFLPPTKIDKCRIVDAIISHGCFLRECTVQHSIVGERSRLDYGV  317

Query  580  ELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDG  401
            E+ DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDG
Sbjct  318  EVLDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIANKDG  377

Query  400  VQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            VQE+DRP++GFYIRSGITIIMEKATI DGTVI
Sbjct  378  VQEADRPEDGFYIRSGITIIMEKATIEDGTVI  409



>ref|XP_002306116.2| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86627.2| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=526

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSP FLPPTKID C+I DAIISHGCFLRECTV+HS++GERSRLD GVE
Sbjct  376  KFEFYDPKTPFYTSPGFLPPTKIDKCRIVDAIISHGCFLRECTVQHSVVGERSRLDYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+M+GAD+Y+TE+EIASLLA+G VPIGVG NTKIRN IIDKN +IGKDV+I NKDGV
Sbjct  436  LKDTVMLGADHYQTEAEIASLLAEGKVPIGVGRNTKIRNCIIDKNAKIGKDVIITNKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR ++GFYIRSGITII+EKATI DGTVI
Sbjct  496  QEADREEKGFYIRSGITIILEKATIEDGTVI  526



>ref|XP_011037496.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011037497.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSP FLPPTKID C+I DAIISHGCFLRECTV+HS++GERSRLD GVE
Sbjct  377  KFEFYDPKTPFYTSPGFLPPTKIDKCRIVDAIISHGCFLRECTVQHSVVGERSRLDYGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+M+GAD Y+TE+EIASLLA+G VPIGVG N+KIRN IIDKN +IGKDV+IMNKDGV
Sbjct  437  LKDTVMLGADYYQTEAEIASLLAEGKVPIGVGRNSKIRNCIIDKNAKIGKDVIIMNKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR ++GFYIRSGITII+EKATI DGTVI
Sbjct  497  QEADREEKGFYIRSGITIILEKATIEDGTVI  527



>ref|XP_004500804.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cicer arietinum]
Length=518

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSP FLPPTKIDNC++ DAIISHGCFLRECT++HSI+GERSRLD GVE
Sbjct  368  KFEFYDPKTPIFTSPGFLPPTKIDNCRVVDAIISHGCFLRECTIQHSIVGERSRLDYGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L++T+MMGADNY+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDGV
Sbjct  428  LQETVMMGADNYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR ++GFYIRSGITIIMEKATI DGTVI
Sbjct  488  QEADRSEDGFYIRSGITIIMEKATIEDGTVI  518



>gb|KDO41999.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=446

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 3/150 (2%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVEL
Sbjct  300  FHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVEL  359

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD   
Sbjct  360  KDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKD---  416

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP+ GFYIRSGITIIMEKATI DG VI
Sbjct  417  EADRPELGFYIRSGITIIMEKATIEDGMVI  446



>ref|XP_010028607.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 ref|XP_010028608.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 gb|KCW55367.1| hypothetical protein EUGRSUZ_I01281 [Eucalyptus grandis]
Length=527

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSPRFLPPTKIDNCK+KDAIISHGCFLREC VE SI+GERSRLD GVE
Sbjct  377  KFEFYDPKTPIFTSPRFLPPTKIDNCKLKDAIISHGCFLRECRVERSIVGERSRLDSGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G VPIG+G+NTKIRN IIDKN +IGKDV I+NKDGV
Sbjct  437  LKDTVMMGADYYQTESEIASLLAEGKVPIGIGKNTKIRNCIIDKNAKIGKDVAIVNKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP +GFYIR GIT+I+EKATI DGTVI
Sbjct  497  EEADRPGDGFYIRLGITVILEKATIEDGTVI  527



>ref|XP_009345666.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345667.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=519

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSPRFLPPTKID C+I DAIISHGCFL+EC+V+HSI+GERSRL+ GVE
Sbjct  369  KFEFYDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLQECSVQHSIVGERSRLNYGVE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD +MMGADNY+TESEIASLLADG VPIG+G NTKIRN IIDKN RIGKDV+I+NKDGV
Sbjct  429  LKDAIMMGADNYQTESEIASLLADGEVPIGIGSNTKIRNCIIDKNARIGKDVMIVNKDGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GITII+EKATI DG +I
Sbjct  489  QEADRPEDGFYIREGITIILEKATIEDGMII  519



>ref|XP_009345668.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=517

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSPRFLPPTKID C+I DAIISHGCFL+EC+V+HSI+GERSRL+ GVE
Sbjct  367  KFEFYDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLQECSVQHSIVGERSRLNYGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD +MMGADNY+TESEIASLLADG VPIG+G NTKIRN IIDKN RIGKDV+I+NKDGV
Sbjct  427  LKDAIMMGADNYQTESEIASLLADGEVPIGIGSNTKIRNCIIDKNARIGKDVMIVNKDGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GITII+EKATI DG +I
Sbjct  487  QEADRPEDGFYIREGITIILEKATIEDGMII  517



>gb|AES74194.2| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=518

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTP +TSP FLPPTKIDNC++ DAIISHGCFLRECT++HSI+GERSRLD GVE
Sbjct  368  KFQFYDPKTPIFTSPGFLPPTKIDNCRVVDAIISHGCFLRECTIQHSIVGERSRLDYGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKI+N IIDKN +IGKDVVI NKDGV
Sbjct  428  LQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKDVVITNKDGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR+GITI+MEKATI DGTVI
Sbjct  488  QEADRPEDGFYIRAGITIVMEKATIEDGTVI  518



>ref|XP_003527197.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 gb|KHN20061.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=519

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  760  RKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGV  581
             KFEFYDPK P YTSP FLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GV
Sbjct  368  HKFEFYDPKIPIYTSPGFLPPTKIDKCRIVDAIISHGCFLRECTVQHSIVGERSRLDYGV  427

Query  580  ELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDG  401
            E+ DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDG
Sbjct  428  EVLDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIANKDG  487

Query  400  VQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            VQE+DRP++GFYIRSGITIIMEKATI DGTVI
Sbjct  488  VQEADRPEDGFYIRSGITIIMEKATIEDGTVI  519



>ref|XP_003522921.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 ref|XP_006577920.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
 gb|KHN33746.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=519

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  760  RKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGV  581
             KFEFYDPK P YTSP FLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GV
Sbjct  368  HKFEFYDPKIPIYTSPGFLPPTKIDKCQIVDAIISHGCFLRECTVQHSIVGERSRLDYGV  427

Query  580  ELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDG  401
            EL DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDG
Sbjct  428  ELLDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIANKDG  487

Query  400  VQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            VQE+DRP++GFYIRSGITIIMEKATI DGT++
Sbjct  488  VQEADRPEDGFYIRSGITIIMEKATIEDGTIV  519



>ref|XP_007131817.1| hypothetical protein PHAVU_011G044000g [Phaseolus vulgaris]
 gb|ESW03811.1| hypothetical protein PHAVU_011G044000g [Phaseolus vulgaris]
Length=528

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F+FYDPKTP YTSPR LPPTKID C+I DAIISHGCFLREC V+HSI+GERSRLD GVEL
Sbjct  379  FKFYDPKTPIYTSPRLLPPTKIDKCRIVDAIISHGCFLRECIVQHSIVGERSRLDYGVEL  438

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQ
Sbjct  439  QDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQ  498

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP++GFYIRSGIT+I+EKATI DGTVI
Sbjct  499  EADRPEDGFYIRSGITVILEKATIEDGTVI  528



>gb|EYU37810.1| hypothetical protein MIMGU_mgv1a004455mg [Erythranthe guttata]
Length=526

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTKID+ KIK+AIISHGCFLREC V+HSI+GERSRLD GVE
Sbjct  376  KFEFYDPKTPFFTSPRFLPPTKIDSSKIKNAIISHGCFLRECIVDHSIVGERSRLDSGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD Y+TESEIASLLA G VPIG+G NTKIRN IIDKN +IGKDV+I NKDGV
Sbjct  436  LKDTLMMGADYYQTESEIASLLAQGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGI I+ EKATI DGTVI
Sbjct  496  EEADRPEEGFYIRSGIIIVPEKATINDGTVI  526



>ref|XP_004148834.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis sativus]
 ref|XP_004172290.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis sativus]
 gb|KGN61813.1| hypothetical protein Csa_2G248700 [Cucumis sativus]
Length=526

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLR+C+V+HSI+GERSRLD GVE
Sbjct  376  KFEFYDPKTPFYTSPRFLPPTKIDRCQIVDAIISHGCFLRDCSVQHSIVGERSRLDYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGADNY+TE EI  LLA+G VP+G+G N+KI+  IIDKN +IGKDV+IMNKDGV
Sbjct  436  LKDTIMMGADNYQTELEITGLLAEGKVPVGIGRNSKIKKCIIDKNAKIGKDVIIMNKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+ RP++GFYIRSGITIIMEKAT+ DGTVI
Sbjct  496  QEAARPEQGFYIRSGITIIMEKATVGDGTVI  526



>gb|KJB79161.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
 gb|KJB79162.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
 gb|KJB79163.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
Length=528

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HS+IGERSRLD GVE
Sbjct  378  KFEFYDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSVIGERSRLDSGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE EI SLLA+G VPIG+G NTKI N IIDKN +IG+DV+I NKDGV
Sbjct  438  LQDTVMMGADYYQTELEIISLLAEGKVPIGIGHNTKISNCIIDKNAKIGRDVIIANKDGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR DEGFYIRSGITII++KATI DGT+I
Sbjct  498  QEADRSDEGFYIRSGITIILDKATIKDGTII  528



>ref|XP_002313036.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86991.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=527

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRF PPTK D C+I +AIISHGCFLRECTV+HS++GERSRLD GVE
Sbjct  377  KFEFYDPKTPFYTSPRFSPPTKFDKCRIVNAIISHGCFLRECTVQHSVVGERSRLDYGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+M+GAD Y+TE EIASLLA+G VPIGVG NTKIRN IIDKN +IGKDV+IMNKDGV
Sbjct  437  LKDTVMLGADCYQTEVEIASLLAEGEVPIGVGRNTKIRNCIIDKNAKIGKDVIIMNKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR +EGFYIRSGITII EKATI DGTVI
Sbjct  497  QEADREEEGFYIRSGITIISEKATIEDGTVI  527



>gb|KHF99865.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Gossypium 
arboreum]
 gb|KHG27467.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Gossypium 
arboreum]
Length=528

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HS+IGERSRLD GVE
Sbjct  378  KFEFYDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSVIGERSRLDSGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE EI SLLA+G VPIG+G NTKI N IIDKN +IG+DV+I NKDGV
Sbjct  438  LQDTVMMGADYYQTELEIISLLAEGKVPIGIGHNTKISNCIIDKNAKIGRDVIIANKDGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR DEGFYIRSGIT+I++KATI DGT+I
Sbjct  498  QEADRSDEGFYIRSGITVILDKATIKDGTII  528



>gb|AHM92232.1| AGPase large subunit protein [Hevea brasiliensis]
Length=527

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLRECT++HS++GERSRLD GVE
Sbjct  377  KFEFYDPKTPFYTSPRFLPPTKIDKCRIVDAIISHGCFLRECTIQHSVVGERSRLDYGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+M+GAD Y+TE+EIASLLA+G VPIGVG +TKI+  IIDKN ++GK+VVI NKDGV
Sbjct  437  LKDTVMLGADCYQTEAEIASLLAEGEVPIGVGRDTKIKKCIIDKNAKMGKNVVITNKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGITII EKATI DGTVI
Sbjct  497  QEADRPEEGFYIRSGITIISEKATIEDGTVI  527



>ref|XP_011048155.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=540

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRF PPTK D C+I +AIISHGCFLRECTVEHS++GERSRLD GVE
Sbjct  390  KFEFYDPKTPFYTSPRFSPPTKFDKCRIVNAIISHGCFLRECTVEHSVVGERSRLDYGVE  449

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+M+GAD Y+TE EIASLLA+G VPIGVG NTKIRN IIDKN +IGK+V+IMNKDGV
Sbjct  450  LKDTVMLGADCYQTEVEIASLLAEGEVPIGVGRNTKIRNCIIDKNAKIGKNVIIMNKDGV  509

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR +EGFYIRSGITII EKATI DGTVI
Sbjct  510  QEADREEEGFYIRSGITIISEKATIEDGTVI  540



>ref|XP_008385898.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
 ref|XP_008385899.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
 ref|XP_008385900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
Length=519

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSPRFLPPTKID C+I DAIISHGCFL+EC+V+HSI+GERSRL+ GVE
Sbjct  369  KFEFYDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLQECSVQHSIVGERSRLNYGVE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD +MMGADNY+TESEIASLLADG VPIG+G NTKIRN IIDKN +IGKDV+I+NK+GV
Sbjct  429  LKDAIMMGADNYQTESEIASLLADGEVPIGIGSNTKIRNCIIDKNAKIGKDVMIVNKEGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GITII+EKATI DG +I
Sbjct  489  QEADRPEDGFYIREGITIILEKATIEDGMII  519



>ref|XP_008385901.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Malus domestica]
Length=517

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSPRFLPPTKID C+I DAIISHGCFL+EC+V+HSI+GERSRL+ GVE
Sbjct  367  KFEFYDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLQECSVQHSIVGERSRLNYGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD +MMGADNY+TESEIASLLADG VPIG+G NTKIRN IIDKN +IGKDV+I+NK+GV
Sbjct  427  LKDAIMMGADNYQTESEIASLLADGEVPIGIGSNTKIRNCIIDKNAKIGKDVMIVNKEGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GITII+EKATI DG +I
Sbjct  487  QEADRPEDGFYIREGITIILEKATIEDGMII  517



>ref|XP_010690849.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            FEFYDPKTPFYTSPRFLPPTK+D C+IKD IIS GCFLREC VEHSI+GERSRLD GVEL
Sbjct  375  FEFYDPKTPFYTSPRFLPPTKMDRCQIKDTIISDGCFLRECKVEHSIVGERSRLDSGVEL  434

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDTLMMGAD Y+TESEIASLLA+G VPIG+G NT IRN IIDKN +IGKDV+I NKDGV 
Sbjct  435  KDTLMMGADYYQTESEIASLLAEGKVPIGIGRNTIIRNCIIDKNAKIGKDVIITNKDGVI  494

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP++GFYIRSGIT+I+EKATI DGTVI
Sbjct  495  EADRPEQGFYIRSGITVIVEKATIEDGTVI  524



>ref|XP_011015433.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015434.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015435.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRF PPTK D C+I +AIISHGCFLRECTVEHS++GERSRLD GVE
Sbjct  377  KFEFYDPKTPFYTSPRFSPPTKFDKCRIVNAIISHGCFLRECTVEHSVVGERSRLDYGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+M+GAD Y+TE EIASLLA+G +PIGVG NTKIRN IIDKN +IG DV+IMNKDGV
Sbjct  437  LKDTVMLGADCYQTEVEIASLLAEGEIPIGVGRNTKIRNCIIDKNAKIGNDVIIMNKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR +EGFYIRSGITII EKATI DGTVI
Sbjct  497  QEADREEEGFYIRSGITIISEKATIEDGTVI  527



>gb|AAF66436.1|AF249917_1 ADP-glucose pyrophosphorylase large subunit [Perilla frutescens]
Length=527

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTS RFLPPTKIDNCKIKDAIISHGCFLREC  +HSI+GERSRLD GVE
Sbjct  377  KFEFYDPKTPFYTSLRFLPPTKIDNCKIKDAIISHGCFLRECVCQHSILGERSRLDSGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD Y TESEIASLL  G VP+G+G NTKI N IIDKN RIGKDV+I NKDGV
Sbjct  437  LKDTLMMGADYYPTESEIASLLVQGKVPMGIGRNTKISNCIIDKNARIGKDVIIKNKDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR +EGFYIRSGITI++EKATI DGT+I
Sbjct  497  EEADRSEEGFYIRSGITIVVEKATINDGTII  527



>ref|XP_007199332.1| hypothetical protein PRUPE_ppa023764mg, partial [Prunus persica]
 gb|EMJ00531.1| hypothetical protein PRUPE_ppa023764mg, partial [Prunus persica]
Length=353

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -1

Query  751  EFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELK  572
            EFYDPKTP +TSPRFLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVELK
Sbjct  205  EFYDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLRECSVQHSIVGERSRLDYGVELK  264

Query  571  DTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQE  392
            D +MMGAD Y+TE+EIASLLA+G VP+G+G NTKIRN IIDKN +IGKD VI+NKDGV+E
Sbjct  265  DAIMMGADYYQTETEIASLLAEGKVPVGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVRE  324

Query  391  SDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +DRP+EGFYIR GITII+EKATI DG VI
Sbjct  325  ADRPEEGFYIREGITIILEKATIQDGMVI  353



>ref|XP_008800701.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Phoenix dactylifera]
Length=525

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTKI+ C++ DAIISHGCFLREC+V+HSI+G RSRLD G E
Sbjct  375  KFQFYDPKTPFFTSPRFLPPTKIEKCRVLDAIISHGCFLRECSVQHSIVGVRSRLDYGAE  434

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGADNYETE+EIASLLA+G VPIGVG NTKI N IID NVRIGK++VI NKDGV
Sbjct  435  LKDTVMMGADNYETEAEIASLLAEGKVPIGVGRNTKISNCIIDMNVRIGKNIVIANKDGV  494

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGITII++ ATI DGT+I
Sbjct  495  QEADRPHEGFYIRSGITIILKNATIKDGTII  525



>ref|XP_007201161.1| hypothetical protein PRUPE_ppa004192mg [Prunus persica]
 gb|EMJ02360.1| hypothetical protein PRUPE_ppa004192mg [Prunus persica]
Length=524

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTP +TSPRFLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  374  KFQFYDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLRECSVQHSIVGERSRLDYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD +MMGAD Y+TE+EIASLLA+G VP+G+G NTKIRN IIDKN +IGKD VI+NKDGV
Sbjct  434  LKDAIMMGADYYQTETEIASLLAEGKVPVGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIR GITII+EKATI DG VI
Sbjct  494  READRPEEGFYIREGITIILEKATIQDGMVI  524



>gb|AGV54292.1| ADP-glucose pyrophosphorylase large subunit [Phaseolus vulgaris]
Length=525

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  760  RKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGV  581
             +FEFYDPKTP YTSP FLPPTKID  +I DAIISHGCFLRECTV+HSI+GERSRLD GV
Sbjct  374  HEFEFYDPKTPIYTSPGFLPPTKIDKSRIVDAIISHGCFLRECTVQHSIVGERSRLDYGV  433

Query  580  ELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDG  401
            E++DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDG
Sbjct  434  EIQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDG  493

Query  400  VQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            VQE+DRP++GFYIRSGITII EKATI DGTVI
Sbjct  494  VQEADRPEDGFYIRSGITIIAEKATIEDGTVI  525



>ref|XP_010060971.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 ref|XP_010060972.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 gb|KCW67874.1| hypothetical protein EUGRSUZ_F01590 [Eucalyptus grandis]
 gb|KCW67875.1| hypothetical protein EUGRSUZ_F01590 [Eucalyptus grandis]
Length=524

 Score =   258 bits (660),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP+TPFYTSPRFLPP+K+D C+I DAIISHGCFL+EC++EHSI+G RSRLD GVE
Sbjct  374  KFEFYDPQTPFYTSPRFLPPSKVDKCRIVDAIISHGCFLQECSIEHSIVGVRSRLDYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             KDT+MMGAD Y+TE+EIASLLA G VPIGVG+NTKIRN IIDKN RIGK+VVI N DGV
Sbjct  434  FKDTMMMGADYYQTEAEIASLLAQGKVPIGVGQNTKIRNCIIDKNARIGKNVVIHNTDGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I++ ATI DGTV+
Sbjct  494  QEADRPEEGFYIRSGITVILKNATIKDGTVV  524



>ref|XP_007136621.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08615.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=310

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVE
Sbjct  160  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVE  219

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGV
Sbjct  220  LQDTMMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGV  279

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGITI ++ ATI DGTVI
Sbjct  280  QEADRAKEGFYIRSGITITLKNATIKDGTVI  310



>ref|XP_008236919.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Prunus mume]
Length=524

 Score =   258 bits (659),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDPKTP +TSPRFLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVE
Sbjct  374  KFHFYDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLRECSVQHSIVGERSRLDYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD +MMGAD Y+TE+EIASLLA+G VP+G+G NTKIRN IIDKN +IGKD VI+NKDGV
Sbjct  434  LKDAIMMGADYYQTETEIASLLAEGKVPVGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIR GITII+EKATI DG VI
Sbjct  494  READRPEEGFYIREGITIILEKATIQDGMVI  524



>ref|XP_003603943.1| Glucose-1-phosphate adenylyltransferase large subunit [Medicago 
truncatula]
Length=526

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 8/159 (5%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIK--------DAIISHGCFLRECTVEHSIIGER  602
            KF+FYDPKTP +TSP FLPPTKIDNC+++        DAIISHGCFLRECT++HSI+GER
Sbjct  368  KFQFYDPKTPIFTSPGFLPPTKIDNCRVRQSIHLVVVDAIISHGCFLRECTIQHSIVGER  427

Query  601  SRLDCGVELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDV  422
            SRLD GVEL+DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKI+N IIDKN +IGKDV
Sbjct  428  SRLDYGVELQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKDV  487

Query  421  VIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            VI NKDGVQE+DRP++GFYIR+GITI+MEKATI DGTVI
Sbjct  488  VITNKDGVQEADRPEDGFYIRAGITIVMEKATIEDGTVI  526



>ref|XP_011007450.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Populus euphratica]
Length=528

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP+TPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  378  KFEFYDPQTPFFTSPRFLPPTKVDRCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT+MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN RIGKDV+I N DGV
Sbjct  438  LTDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNARIGKDVIITNADGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGIT +++ ATI DGT+I
Sbjct  498  QEADRPAEGFYIRSGITAVLKNATIKDGTLI  528



>ref|XP_007136623.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08617.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=337

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVE
Sbjct  187  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVE  246

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGV
Sbjct  247  LQDTMMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGV  306

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGITI ++ ATI DGTVI
Sbjct  307  QEADRAKEGFYIRSGITITLKNATIKDGTVI  337



>ref|XP_011028874.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Populus euphratica]
Length=528

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  378  KFEFYDPKTPFFTSPRFLPPTKVDKCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT+MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IGKDV+I N DGV
Sbjct  438  LTDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGKDVIITNADGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE DRP EGFYIRSGIT +++ ATI DGT+I
Sbjct  498  QEGDRPSEGFYIRSGITAVLKNATIKDGTII  528



>ref|XP_003606943.1| Glucose-1-phosphate adenylyltransferase [Medicago truncatula]
 gb|AES89140.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=528

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F+FYDPKTP +TSP FLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVEL
Sbjct  379  FKFYDPKTPIFTSPGFLPPTKIDKCRIVDAIISHGCFLRECSVQHSIVGERSRLDYGVEL  438

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+TESEIAS LA+G VPIG+G N+K+R  IIDKN RIGKDV+IMNKDGVQ
Sbjct  439  QDTVMMGADYYQTESEIASELAEGKVPIGIGSNSKVRKCIIDKNARIGKDVIIMNKDGVQ  498

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP++GFYIRSGITI+MEKATI DGTVI
Sbjct  499  EADRPEDGFYIRSGITIVMEKATIEDGTVI  528



>ref|XP_007136619.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08613.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=338

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVE
Sbjct  188  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVE  247

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGV
Sbjct  248  LQDTMMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGV  307

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGITI ++ ATI DGTVI
Sbjct  308  QEADRAKEGFYIRSGITITLKNATIKDGTVI  338



>ref|XP_007136620.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08614.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=369

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVE
Sbjct  219  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVE  278

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGV
Sbjct  279  LQDTMMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGV  338

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGITI ++ ATI DGTVI
Sbjct  339  QEADRAKEGFYIRSGITITLKNATIKDGTVI  369



>ref|XP_002300758.1| ADP-glucose pyrophosphorylase large subunit 2 family protein 
[Populus trichocarpa]
 gb|EEE80031.1| ADP-glucose pyrophosphorylase large subunit 2 family protein 
[Populus trichocarpa]
Length=528

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  378  KFEFYDPKTPFFTSPRFLPPTKVDKCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT+MMGAD Y+TESEIAS+LA+G VPIGVG+NTKIRN IIDKN +IGKDV+I N DGV
Sbjct  438  LTDTMMMGADYYQTESEIASVLAEGKVPIGVGQNTKIRNCIIDKNAKIGKDVIITNADGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGIT +++ ATI DGT+I
Sbjct  498  QEADRPSEGFYIRSGITAVLKNATIKDGTII  528



>ref|XP_007136618.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08612.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=365

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVE
Sbjct  215  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVE  274

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGV
Sbjct  275  LQDTMMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGV  334

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGITI ++ ATI DGTVI
Sbjct  335  QEADRAKEGFYIRSGITITLKNATIKDGTVI  365



>ref|XP_007136622.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08616.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=396

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVE
Sbjct  246  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVE  305

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGV
Sbjct  306  LQDTMMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGV  365

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGITI ++ ATI DGTVI
Sbjct  366  QEADRAKEGFYIRSGITITLKNATIKDGTVI  396



>ref|XP_010531437.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic [Tarenaya hassleriana]
 ref|XP_010531439.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic [Tarenaya hassleriana]
Length=526

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPP+KI+ C+I D+IISHGCFLREC+V+ SI+GERSRLD GV+
Sbjct  376  KFEFYDPDTPFYTSPRFLPPSKIEMCRIVDSIISHGCFLRECSVQRSIVGERSRLDYGVD  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+M+GAD Y+TESEIASLLA+GNVPIG+G NTKIR  IIDKN +IGKDV+I+NKD V
Sbjct  436  LQDTVMLGADYYQTESEIASLLAEGNVPIGIGRNTKIRKCIIDKNAKIGKDVMIVNKDDV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRPDEGFYIRSGIT+I+EKATI DGTVI
Sbjct  496  QEADRPDEGFYIRSGITVIVEKATIEDGTVI  526



>ref|XP_002281223.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
 ref|XP_010664711.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
 emb|CBI19730.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   256 bits (653),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+ SI+G RSRL+ GVE
Sbjct  374  KFEFYDPKTPFYTSPRFLPPTKVEECRILDAIISHGCFLRECSVQRSIVGVRSRLEYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G VPIGVG+NT+IRN IIDKN +IG+DVVI N DGV
Sbjct  434  LKDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTRIRNCIIDKNAKIGRDVVIANADGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGIT+I++ ATI DGT+I
Sbjct  494  QEADRPSEGFYIRSGITVILKNATINDGTII  524



>gb|AAB91468.1| ADP-glucose pyrophosphorylase large subunit 2 [Citrullus lanatus 
subsp. vulgaris]
Length=481

 Score =   254 bits (650),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPP+K++ C+I DAIISHGCFLREC+VEHSI+G RSRL+ GVE
Sbjct  331  KFEFYDPKTPFYTSPRFLPPSKVEKCRIVDAIISHGCFLRECSVEHSIVGVRSRLEYGVE  390

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN RIG++VVI N D V
Sbjct  391  LKDTMMMGADYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNARIGRNVVIANSDDV  450

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIRSGIT+ ++ ATI DGT+I
Sbjct  451  QEADRPEDGFYIRSGITVTLKNATIKDGTII  481



>dbj|BAC66692.1| ADP-glucose pyrophosphorylase large subunit PvAGPL1 [Phaseolus 
vulgaris]
Length=525

 Score =   256 bits (653),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  760  RKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGV  581
             +FEFYDPKTP YTSP FLPPTKID  +I DAIISHGCFLRECTV+HSI+GERSRLD GV
Sbjct  374  HEFEFYDPKTPIYTSPGFLPPTKIDKSRIVDAIISHGCFLRECTVQHSIVGERSRLDYGV  433

Query  580  ELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDG  401
            E++DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKD 
Sbjct  434  EIQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDD  493

Query  400  VQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            VQE+DRP++GFYIRSGITII EKATI DGTVI
Sbjct  494  VQEADRPEDGFYIRSGITIIAEKATIEDGTVI  525



>ref|NP_001289786.1| glucose-1-phosphate adenylyltransferase large subunit 1-like 
[Nelumbo nucifera]
 gb|AHZ08829.1| ADP-glucose pyrophosphorylase large subunit [Nelumbo nucifera]
 gb|AHZ08830.1| ADP-glucose pyrophosphorylase large subunit [Nelumbo nucifera]
Length=528

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            FEFYDPKTPF+TSPRFLPPTK+D C+I +AIISHGCFLREC+V+HSI+G RSRL+ G EL
Sbjct  379  FEFYDPKTPFFTSPRFLPPTKVDKCRIVNAIISHGCFLRECSVQHSIVGVRSRLEYGCEL  438

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+MMGAD Y TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DV+I NKDGVQ
Sbjct  439  KDTMMMGADYYHTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGRDVIIANKDGVQ  498

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRPD+GFYIRSGI +I++ ATI DGTVI
Sbjct  499  EADRPDDGFYIRSGIIVILKNATIKDGTVI  528



>ref|XP_007136159.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 ref|XP_007136160.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 gb|ESW08153.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 gb|ESW08154.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
Length=525

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  760  RKFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGV  581
             +FEFYDPKTP YTSP FLPPTKID  +I DAIISHGCFLRECTV+HSI+GERSRLD GV
Sbjct  374  HEFEFYDPKTPIYTSPGFLPPTKIDKSRIVDAIISHGCFLRECTVQHSIVGERSRLDYGV  433

Query  580  ELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDG  401
            E++DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKD 
Sbjct  434  EIQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDD  493

Query  400  VQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            VQE+DRP++GFYIRSGITII EKATI DGTVI
Sbjct  494  VQEADRPEDGFYIRSGITIIAEKATIEDGTVI  525



>ref|XP_006473534.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Citrus sinensis]
Length=526

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTS RFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  376  KFEFYDPKTPFYTSARFLPPTKVDRCKIVDAIISHGCFLRECSVQHSIVGVRSRLESGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             +DT+MMGAD Y+TESEIASLLA+G VPIGVG+NTKI+N IIDKN +IGK+V+I N +GV
Sbjct  436  FQDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIKNCIIDKNAKIGKNVIIANAEGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I++ ATI DGTVI
Sbjct  496  QEADRPNEGFYIRSGITVILKNATINDGTVI  526



>ref|XP_006435035.1| hypothetical protein CICLE_v10000842mg [Citrus clementina]
 gb|ESR48275.1| hypothetical protein CICLE_v10000842mg [Citrus clementina]
Length=526

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTS RFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  376  KFEFYDPKTPFYTSARFLPPTKVDRCKIVDAIISHGCFLRECSVQHSIVGVRSRLESGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             +DT+MMGAD Y+TESEIASLLA+G VPIGVG+NTKI+N IIDKN +IGK+V+I N +GV
Sbjct  436  FQDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIKNCIIDKNAKIGKNVIIANAEGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I++ ATI DGTVI
Sbjct  496  QEADRPNEGFYIRSGITVILKNATINDGTVI  526



>ref|XP_010254773.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Nelumbo nucifera]
Length=528

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            FEFYDPKTPF+TSPRFLPPTK+D C+I +AIISHGCFLREC+V+HSI+G RSRL+ G EL
Sbjct  379  FEFYDPKTPFFTSPRFLPPTKVDKCRIVNAIISHGCFLRECSVQHSIVGVRSRLEYGCEL  438

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+MMGAD Y TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DV+I NKDGVQ
Sbjct  439  KDTMMMGADYYHTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGRDVIIANKDGVQ  498

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRPD+GFYIRSGI +I++ ATI DGTVI
Sbjct  499  EADRPDDGFYIRSGIIVILKNATIKDGTVI  528



>emb|CAA65541.1| ADP-glucose pyrophosphorylase [Pisum sativum]
Length=510

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSP FLPPTKIDN ++ DAIISHGCFLR+CT++HSI+GERSRLD GVE
Sbjct  360  KFEFYDPKTPIFTSPGFLPPTKIDNSRVVDAIISHGCFLRDCTIQHSIVGERSRLDYGVE  419

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKI+N IIDKN +IGK+VVI NK+GV
Sbjct  420  LQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKEVVIANKEGV  479

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR ++GFYIRSGITIIMEKATI DGTVI
Sbjct  480  QEADRSEDGFYIRSGITIIMEKATIEDGTVI  510



>ref|XP_002307668.2| hypothetical protein POPTR_0005s25130g [Populus trichocarpa]
 gb|EEE94664.2| hypothetical protein POPTR_0005s25130g [Populus trichocarpa]
Length=528

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP+TPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  378  KFEFYDPQTPFFTSPRFLPPTKVDRCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT+MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IGKDV+I N DGV
Sbjct  438  LTDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGKDVIITNADGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGIT +++ A I DGT+I
Sbjct  498  QEADRPSEGFYIRSGITAVLKNAAIKDGTLI  528



>ref|XP_008466540.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Cucumis melo]
 gb|ADN34184.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo subsp. 
melo]
Length=533

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPP+K++ C+I DAIISHGCFLRECTVEHSI+G RSRL+ GVE
Sbjct  383  KFEFYDPKTPFYTSPRFLPPSKVEKCRIVDAIISHGCFLRECTVEHSIVGVRSRLEYGVE  442

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN +IG++VVI N D V
Sbjct  443  LKDTMMMGADYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNAKIGRNVVIANTDDV  502

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+ ++ ATI DGT+I
Sbjct  503  QEADRPEEGFYIRSGITVTLKNATIKDGTII  533



>ref|XP_004147856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Cucumis sativus]
 gb|KGN59984.1| hypothetical protein Csa_3G859710 [Cucumis sativus]
Length=532

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPP+K++ CKI DAIISHGCFLRECTVEHSI+G RSRL+ GVE
Sbjct  382  KFEFYDPKTPFYTSPRFLPPSKVEKCKIVDAIISHGCFLRECTVEHSIVGVRSRLEYGVE  441

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN +IG++VVI N D V
Sbjct  442  LKDTMMMGADYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNAKIGRNVVIANTDDV  501

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE++RP+EGFYIRSGIT+ ++ ATI DGT+I
Sbjct  502  QEAERPEEGFYIRSGITVTLKNATIKDGTII  532



>gb|EPS74142.1| glucose-1-phosphate adenylyltransferase [Genlisea aurea]
Length=543

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 139/173 (80%), Gaps = 22/173 (13%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTKIDN KIKDAIISHGCFLREC VEHSIIGERSRLD GVE
Sbjct  371  KFEFYDPKTPFYTSPRFLPPTKIDNSKIKDAIISHGCFLRECIVEHSIIGERSRLDIGVE  430

Query  577  LK----------------------DTLMMGADNYETESEIASLLADGNVPIGVGENTKIR  464
            LK                      DTLMMGAD+Y+TESEIASLLA G VP+G+G ++KIR
Sbjct  431  LKACLYTHTRMDVYVYEFAIIFSQDTLMMGADSYQTESEIASLLAQGKVPVGIGRDSKIR  490

Query  463  NAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            N IIDKN RIGK+V+I NKDGV+E+DRP+EGFYIR GITII EKATI DGTVI
Sbjct  491  NCIIDKNARIGKNVIIENKDGVEEADRPEEGFYIRGGITIISEKATINDGTVI  543



>ref|XP_004507462.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cicer arietinum]
Length=528

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F+FYDPKTP +TSPRFLPPTKIDNC+I DAIISHGCFLREC+V HSI+GERSRLD GVEL
Sbjct  379  FKFYDPKTPIFTSPRFLPPTKIDNCRIVDAIISHGCFLRECSVHHSIVGERSRLDYGVEL  438

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+TE EIAS +A+G VPI +G NTKIR  IIDKN RIGKDV+IMNKDGV+
Sbjct  439  QDTIMMGADYYQTEPEIASQVAEGKVPIRIGRNTKIRKCIIDKNARIGKDVIIMNKDGVE  498

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DR D+GFYIRSGITIIMEKATI DGTVI
Sbjct  499  EADREDDGFYIRSGITIIMEKATIEDGTVI  528



>ref|XP_004154849.1| PREDICTED: LOW QUALITY PROTEIN: glucose-1-phosphate adenylyltransferase 
large subunit, chloroplastic/amyloplastic-like [Cucumis 
sativus]
Length=532

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPP+K++ CKI DAIISHGCFLRECTVEHSI+G RSRL+ GVE
Sbjct  382  KFEFYDPKTPFYTSPRFLPPSKVEKCKIVDAIISHGCFLRECTVEHSIVGVRSRLEYGVE  441

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN +IG++VVI N D V
Sbjct  442  LKDTMMMGADYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNAKIGRNVVIANTDDV  501

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE++RP+EGFYIRSGIT+ ++ ATI DGT+I
Sbjct  502  QEAERPEEGFYIRSGITVTLKNATIKDGTII  532



>ref|XP_009378639.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378640.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378642.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378643.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
Length=519

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE
Sbjct  369  KFEFYDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KD++MMGAD Y+TESEIASLLADG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGV
Sbjct  429  IKDSIMMGADYYQTESEIASLLADGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GITII+EKAT+ DG VI
Sbjct  489  QEADRPEDGFYIREGITIILEKATVQDGMVI  519



>ref|XP_007017590.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao]
 gb|EOY14815.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao]
Length=526

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTK+D C+I DAI+SHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  376  KFEFYDPKTPFYTSPRFLPPTKVDKCRIVDAIVSHGCFLRECSVQHSIVGVRSRLESGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE E+ASLLA+G VPIGVG NTKIRN IIDKN +IGKDV+I N   V
Sbjct  436  LEDTMMMGADYYQTEYEVASLLAEGKVPIGVGHNTKIRNCIIDKNAKIGKDVIISNSGAV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRPD+GFYIRSGIT+I++ ATI DGTVI
Sbjct  496  QEADRPDDGFYIRSGITVILKNATIKDGTVI  526



>ref|XP_009378638.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=523

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE
Sbjct  373  KFEFYDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVE  432

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KD++MMGAD Y+TESEIASLLADG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGV
Sbjct  433  IKDSIMMGADYYQTESEIASLLADGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGV  492

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GITII+EKAT+ DG VI
Sbjct  493  QEADRPEDGFYIREGITIILEKATVQDGMVI  523



>ref|XP_009378637.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=525

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE
Sbjct  375  KFEFYDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVE  434

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KD++MMGAD Y+TESEIASLLADG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGV
Sbjct  435  IKDSIMMGADYYQTESEIASLLADGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGV  494

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GITII+EKAT+ DG VI
Sbjct  495  QEADRPEDGFYIREGITIILEKATVQDGMVI  525



>emb|CDP07489.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   253 bits (646),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+VEHSI+G RSRLD GVE
Sbjct  380  KFDFNDPKTPFYTSPRFLPPTKVEKCRIVDAIISHGCFLRECSVEHSIVGVRSRLDYGVE  439

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT+MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DVVI N DGV
Sbjct  440  LMDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNTKIGRDVVITNADGV  499

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGI +I++ ATI DGTVI
Sbjct  500  EEADRPEEGFYIRSGIIVILKNATIKDGTVI  530



>emb|CDY41275.1| BnaA01g12640D [Brassica napus]
Length=322

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  172  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRVESGVE  231

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VPIGVGENTKIRN IIDKN +IGK+VVI N DGV
Sbjct  232  LQDTMMMGADFYQTEAEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGKNVVIANADGV  291

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EG YIRSGIT++++ ATI DG V+
Sbjct  292  EEGDRPEEGVYIRSGITVVLKNATIRDGLVL  322



>ref|XP_007136616.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08610.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=528

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVE
Sbjct  378  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGV
Sbjct  438  LQDTMMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGITI ++ ATI DGTVI
Sbjct  498  QEADRAKEGFYIRSGITITLKNATIKDGTVI  528



>ref|NP_179753.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 ref|NP_001031391.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 sp|Q9SIK1.1|GLGL4_ARATH RecName: Full=Probable glucose-1-phosphate adenylyltransferase 
large subunit, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl 
transferase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD23646.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 gb|AAL49924.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 gb|AAM20291.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 dbj|BAH19825.1| AT2G21590 [Arabidopsis thaliana]
 gb|AEC07199.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 gb|AEC07200.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
Length=523

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP+TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVE
Sbjct  373  KFEFYDPETPFYTSPRFLPPTKAEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVE  432

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  V
Sbjct  433  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDV  492

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  493  QEADRPEEGFYIRSGITVIVEKATIQDGTVI  523



>ref|XP_010472157.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
Length=524

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVE
Sbjct  374  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+VVIMNK  V
Sbjct  434  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVVIMNKGDV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  494  QEADRPEEGFYIRSGITVIVEKATIQDGTVI  524



>ref|XP_010472156.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X1 [Camelina sativa]
Length=528

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVE
Sbjct  378  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+VVIMNK  V
Sbjct  438  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVVIMNKGDV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  498  QEADRPEEGFYIRSGITVIVEKATIQDGTVI  528



>gb|KJB58232.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
 gb|KJB58233.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
 gb|KJB58234.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
Length=526

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTK+D CKI D+IISHGCFLREC+V+HSI+G RSRL+  V+
Sbjct  376  KFEFYDPKTPFYTSPRFLPPTKVDECKIVDSIISHGCFLRECSVQHSIVGVRSRLESSVD  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIGVG+NTKI+N IIDKN +IGKDV+I N D V
Sbjct  436  LQDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIKNCIIDKNAKIGKDVIISNTDAV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP++GFYIRSGIT+IM+ ATI DGTVI
Sbjct  496  EEAERPEDGFYIRSGITVIMKNATIRDGTVI  526



>ref|XP_010263606.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Nelumbo nucifera]
Length=528

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKT F+TSPRFLPPTK+D C+I +AIISHGCFLREC+V+HS++G RSRL+ GVE
Sbjct  378  KFEFYDPKTLFFTSPRFLPPTKVDKCRIVNAIISHGCFLRECSVQHSVVGVRSRLEYGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT+MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DVVI NKD V
Sbjct  438  LMDTMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGRDVVIENKDNV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRPDEGFYIRSGI +I++ ATI DGT+I
Sbjct  498  QEADRPDEGFYIRSGIVVILKNATIKDGTII  528



>ref|XP_008388042.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Malus domestica]
Length=512

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEF DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  362  KFEFNDPKTPFYTSPRFLPPTKVEKCRIMDAIISHGCFLRECSVQHSIVGVRSRLESGVE  421

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA G VP+GVGENTKI N IIDKN +IG++VVI N DGV
Sbjct  422  LKDTMMMGADYYQTESEIASLLAQGKVPVGVGENTKIWNCIIDKNAKIGRNVVITNGDGV  481

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE++R DEGFYIRSGIT++++ ATI DGTVI
Sbjct  482  QEAERADEGFYIRSGITVVLKNATIKDGTVI  512



>gb|KEH36175.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=530

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  380  KFQFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFLRECSVQHSIVGIRSRLESGVE  439

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VP+GVGENTKIRN IIDKN +IG++ +I N DGV
Sbjct  440  LQDTMMMGADYYQTESEIASLLAEGKVPVGVGENTKIRNCIIDKNAKIGRNAIITNADGV  499

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR  EGFYIRSGIT+I++ ATI DGTVI
Sbjct  500  EEADRTKEGFYIRSGITVILKNATIQDGTVI  530



>ref|XP_010429080.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Camelina sativa]
 ref|XP_010429081.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Camelina sativa]
Length=525

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVE
Sbjct  375  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVE  434

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  V
Sbjct  435  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDV  494

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  495  QEADRPEEGFYIRSGITVIVEKATIQDGTVI  525



>ref|XP_010416915.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X1 [Camelina sativa]
Length=528

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVE
Sbjct  378  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  V
Sbjct  438  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  498  QEADRPEEGFYIRSGITVIVEKATIQDGTVI  528



>ref|XP_006294016.1| hypothetical protein CARUB_v10023004mg [Capsella rubella]
 gb|EOA26914.1| hypothetical protein CARUB_v10023004mg [Capsella rubella]
Length=523

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVE
Sbjct  373  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVE  432

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  V
Sbjct  433  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDV  492

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  493  QEADRPEEGFYIRSGITVIVEKATIEDGTVI  523



>ref|XP_010416916.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010416917.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
Length=524

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVE
Sbjct  374  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  V
Sbjct  434  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  494  QEADRPEEGFYIRSGITVIVEKATIQDGTVI  524



>gb|AJG44463.1| ADP-glucose pyrophosphorylase large subunit [Lilium davidii var. 
unicolor]
Length=518

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ C+I +AIISHGCFLREC ++ SI+G RSRLD G E
Sbjct  368  KFEFYDPKTPFFTSPRFLPPTKVEKCRILNAIISHGCFLRECGIQRSIVGVRSRLDYGAE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLMMGADNYETE+EIASLLA+G VPIGVGENTKIRN IID N RIGK+VVI+NKDGV
Sbjct  428  LEDTLMMGADNYETEAEIASLLAEGKVPIGVGENTKIRNCIIDMNARIGKNVVILNKDGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIRSGI ++++ ATI D T+I
Sbjct  488  QEADRPEDGFYIRSGIAVVLKNATIRDETII  518



>emb|CDX99581.1| BnaC04g33380D [Brassica napus]
Length=525

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCF+REC+V+ SIIGERSRLD GVE
Sbjct  375  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFMRECSVQRSIIGERSRLDYGVE  434

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  V
Sbjct  435  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGQDTKIRKCIIDKNAKIGKNVIIMNKGDV  494

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  495  QEADRPEEGFYIRSGITVVVEKATIQDGTVI  525



>ref|XP_006878500.1| hypothetical protein AMTR_s00011p00201790 [Amborella trichopoda]
 gb|ERM94645.1| hypothetical protein AMTR_s00011p00201790 [Amborella trichopoda]
Length=520

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  370  KFQFYDPMTPFFTSPRFLPPTKIEKCRILDAIISHGCFLRECSVQHSIVGVRSRLETGVE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIA+LLA+G VP+GVG+NTKIRN IIDKN +IGK+VVI N DGV
Sbjct  430  LQDTMMMGADYYQTEAEIAALLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVVIANTDGV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGIT+I++ +TI DG VI
Sbjct  490  QEADRPSEGFYIRSGITVILKNSTIKDGMVI  520



>ref|XP_003523570.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like isoform X1 [Glycine max]
 gb|KHN45868.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=530

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCFLREC+++HSI+G RSRL+ GVE
Sbjct  380  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFLRECSIQHSIVGVRSRLESGVE  439

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE EIASLLA+G VPIGVGENTKIRN IIDKN +IG++VVI N DGV
Sbjct  440  LQDTMMMGADYYQTEYEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVVIENIDGV  499

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGITI ++ ATI DGTVI
Sbjct  500  QEADRAKEGFYIRSGITITLKNATIKDGTVI  530



>dbj|BAF47748.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb2 [Ipomoea batatas]
Length=518

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F+F DPKTPFYTSPRFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G RSRLD GVEL
Sbjct  369  FDFNDPKTPFYTSPRFLPPTKVDKCKIVDAIISHGCFLRECSVKHSIVGIRSRLDYGVEL  428

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT++MGAD Y+TESEIASLLA G VPIG+G NTKIRN IIDKN RIGKDVVI NKDGV 
Sbjct  429  EDTMVMGADYYQTESEIASLLATGKVPIGIGTNTKIRNCIIDKNARIGKDVVIANKDGVD  488

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DR DEGFYIRSGITI+++ ATI DGTVI
Sbjct  489  EADRADEGFYIRSGITIVLKNATIRDGTVI  518



>ref|XP_002510419.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF52606.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=523

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK+D C+I DAIISHGCFL+EC+++HSI+G RSRL+  VE
Sbjct  373  KFEFYDPKTPFFTSPRFLPPTKVDQCRIVDAIISHGCFLQECSIKHSIVGVRSRLESAVE  432

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT+MMGAD Y+TESEIASL A+G VPIGVG+NTKIRN IIDKN +IG+ VVI N DGV
Sbjct  433  LMDTMMMGADYYQTESEIASLQAEGKVPIGVGQNTKIRNCIIDKNAKIGRGVVITNADGV  492

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE++RP+EGFYIRSGIT+IME ATI DGT+I
Sbjct  493  QEAERPEEGFYIRSGITVIMENATINDGTII  523



>gb|AFL55398.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas]
Length=518

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F+F DPKTPFYTSPRFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G RSRLD GVEL
Sbjct  369  FDFNDPKTPFYTSPRFLPPTKVDKCKIVDAIISHGCFLRECSVKHSIVGIRSRLDYGVEL  428

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT++MGAD Y+TESEIASLLA G VPIG+G NTKIRN IIDKN RIGKDVVI NKDGV 
Sbjct  429  EDTMVMGADYYQTESEIASLLATGKVPIGIGTNTKIRNCIIDKNARIGKDVVIANKDGVD  488

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DR DEGFYIRSGITI+++ ATI DGTVI
Sbjct  489  EADRADEGFYIRSGITIVLKNATIRDGTVI  518



>ref|XP_009113743.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X2 [Brassica rapa]
 emb|CDY27626.1| BnaA09g27810D [Brassica napus]
Length=517

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  367  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRVESGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VPIGVGENTKIRN IIDKN +IGK+VVI N DGV
Sbjct  427  LQDTMMMGADFYQTEAEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGKNVVIANADGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGFYIRSGIT++++ ATI DG V+
Sbjct  487  EEGDRPEEGFYIRSGITVVLKNATIRDGLVL  517



>ref|XP_010110050.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus 
notabilis]
 gb|EXC25068.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus 
notabilis]
Length=524

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  374  KFEFYDPKTPFYTSPRFLPPTKVEKCRIVDAIISHGCFLRECSVQHSIVGVRSRLEYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+D +MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DVVI N DGV
Sbjct  434  LQDAMMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGRDVVITNADGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR  +GF+IRSGIT+I++ ATI DGTVI
Sbjct  494  EEADRSSKGFHIRSGITVILKNATIKDGTVI  524



>gb|ACW82825.1| ADP-glucose pyrophosphorylase large subunit L1 isoform [Lens 
culinaris]
Length=510

 Score =   250 bits (639),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSP FLPPTK DN ++ DAIISHGCFLR+CT++HSI+GERSRLD GVE
Sbjct  360  KFEFYDPKTPIFTSPGFLPPTKFDNSRVVDAIISHGCFLRDCTIQHSIVGERSRLDYGVE  419

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKI+N IIDKN +IGK+VVI NK+GV
Sbjct  420  LQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKEVVIANKEGV  479

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR ++GFYIRSGITIIME AT+ DGTV+
Sbjct  480  QEADRSEDGFYIRSGITIIMENATVDDGTVM  510



>ref|XP_010924297.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
 ref|XP_010924298.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
Length=520

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPF+TSPRFLPPTKI+ C++ DAIISHGCFLREC+V+HSI+G RSRLD G E
Sbjct  370  KFQFYDPMTPFFTSPRFLPPTKIEKCRVLDAIISHGCFLRECSVQHSIVGVRSRLDYGAE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD YETE+EIASLLA+G VPIGVG+NTKI N IID NVRIGK+V+I NK+GV
Sbjct  430  LKDTVMMGADYYETEAEIASLLAEGKVPIGVGQNTKISNCIIDMNVRIGKNVIIANKEGV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGITII++ A I DGT+I
Sbjct  490  QEADRPCEGFYIRSGITIILKNAIIKDGTII  520



>ref|XP_009365525.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
 ref|XP_009365526.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
 ref|XP_009365527.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
Length=512

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEF DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  362  KFEFNDPKTPFYTSPRFLPPTKVEECRIMDAIISHGCFLRECSVQHSIVGVRSRLESGVE  421

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA G VPIGVGENTKI N IIDKN +IG++VVI N DGV
Sbjct  422  LKDTMMMGADYYQTESEIASLLAQGKVPIGVGENTKIWNCIIDKNAKIGRNVVISNGDGV  481

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++R DEGFYIRSGIT++++ ATI DGTVI
Sbjct  482  EEAERADEGFYIRSGITVVLKNATIKDGTVI  512



>ref|XP_009617843.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana tomentosiformis]
 ref|XP_009617844.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana tomentosiformis]
Length=529

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTSPRFLPPTK+D  +I DAIISHGCF+REC+++HSI+G RSRLD GVE
Sbjct  379  KFDFNDPKTPFYTSPRFLPPTKVDKSRIVDAIISHGCFMRECSIQHSIVGVRSRLDYGVE  438

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+T+SEIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NK+GV
Sbjct  439  LKDTMMMGADYYQTDSEIASLLAEGKVPIGVGPNTKIQNCIIDKNAKIGKDVVIVNKEGV  498

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP+EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  499  EEAERPEEGFYIRSGITVIMKNATIKDGTVI  529



>emb|CDY15884.1| BnaA04g12270D [Brassica napus]
Length=520

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCF+REC+V+ SIIGERSRLD GVE
Sbjct  370  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFMRECSVQRSIIGERSRLDYGVE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G+++KIR  IIDKN +IGK+V+IMNK  V
Sbjct  430  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGQDSKIRKCIIDKNAKIGKNVIIMNKGDV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  490  QEADRPEEGFYIRSGITVVVEKATIQDGTVI  520



>ref|XP_009140291.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140292.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140293.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140294.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140295.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
Length=520

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCF+REC+V+ SIIGERSRLD GVE
Sbjct  370  KFEFYDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFMRECSVQRSIIGERSRLDYGVE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G+++KIR  IIDKN +IGK+V+IMNK  V
Sbjct  430  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGQDSKIRKCIIDKNAKIGKNVIIMNKGDV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  490  QEADRPEEGFYIRSGITVVVEKATIQDGTVI  520



>ref|NP_001266081.1| glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic-like 
[Cicer arietinum]
 gb|AAK27719.1|AF356003_1 ADP-glucose pyrophosphorylase large subunit CagpL2 [Cicer arietinum]
Length=521

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPFYT PRFLPPTK++ CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  371  KFQFYDPNTPFYTFPRFLPPTKVEKCKIVDAIISHGCFLRECSVQHSIVGIRSRLESGVE  430

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TESEIASLLA+G VP+GVGENTKIRN IIDKN RIG++V+I N DGV
Sbjct  431  LQDTMMMGADYYQTESEIASLLAEGKVPVGVGENTKIRNCIIDKNARIGRNVIITNADGV  490

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR  EGFYIRSGIT I++ ATI DGTVI
Sbjct  491  EEADRTKEGFYIRSGITAILKNATIKDGTVI  521



>ref|XP_009759775.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759780.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759785.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759792.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
Length=529

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTSPRFLPPTK+D  +I DAIISHGCF+REC+++HSI+G RSRLD GVE
Sbjct  379  KFDFNDPKTPFYTSPRFLPPTKVDKSRIVDAIISHGCFMRECSIQHSIVGVRSRLDYGVE  438

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+T+SEIASLLA+G VPIGVG NTKIRN IIDKN +IGKDVVI NK+G+
Sbjct  439  LKDTMMMGADYYQTDSEIASLLAEGKVPIGVGPNTKIRNCIIDKNAKIGKDVVIGNKEGI  498

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP+EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  499  EEAERPEEGFYIRSGITVIMKNATIKDGTVI  529



>ref|XP_008377280.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
Length=519

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE
Sbjct  369  KFEFYDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KD++MMGAD Y+TESEIA LL DG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGV
Sbjct  429  IKDSIMMGADYYQTESEIALLLVDGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GIT+I+EKATI DG VI
Sbjct  489  QEADRPEDGFYIREGITVILEKATIRDGMVI  519



>ref|XP_011083898.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like, partial [Sesamum indicum]
Length=510

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRLD GVE
Sbjct  360  KFDFNDPKTPFYTSPRFLPPTKVEKCRIVDAIISHGCFLRECSVQHSIVGVRSRLDYGVE  419

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G VPIGVG NTKI N IIDKN +IGKDV+I NKD V
Sbjct  420  LKDTMMMGADYYQTESEIASLLAEGKVPIGVGHNTKISNCIIDKNAKIGKDVIIANKDCV  479

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR DEGFYIRSGIT+I++ +TI DGT+I
Sbjct  480  EEADRADEGFYIRSGITVILKNSTIKDGTII  510



>ref|XP_008377281.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Malus domestica]
Length=517

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE
Sbjct  367  KFEFYDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KD++MMGAD Y+TESEIA LL DG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGV
Sbjct  427  IKDSIMMGADYYQTESEIALLLVDGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIR GIT+I+EKATI DG VI
Sbjct  487  QEADRPEDGFYIREGITVILEKATIRDGMVI  517



>gb|AFK36497.1| unknown [Lotus japonicus]
Length=535

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPP+K++ CKI DAIISHGCFLR C V+HSI+G RSRL+ GVE
Sbjct  385  KFEFYDPKTPFFTSPRFLPPSKVEKCKIVDAIISHGCFLRGCNVQHSIVGIRSRLESGVE  444

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASL+A+G VPIGVGENTKIRN IIDKN +IG++VVI N DGV
Sbjct  445  LQDTMMMGADYYQTETEIASLVAEGKVPIGVGENTKIRNCIIDKNAKIGRNVVIANTDGV  504

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE++RP EGFYIRSGIT+ ++ ATI DGTVI
Sbjct  505  QEAERPKEGFYIRSGITVTLKNATIKDGTVI  535



>ref|XP_009365102.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
Length=512

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEF DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  362  KFEFNDPKTPFYTSPRFLPPTKVEKCRIMDAIISHGCFLRECSVQHSIVGVRSRLESGVE  421

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA G VP+GVGENTKI N IIDKN +IG++VVI N DGV
Sbjct  422  LKDTMMMGADYYQTESEIASLLAQGKVPVGVGENTKIWNCIIDKNAKIGRNVVITNGDGV  481

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++R DEGFYIRSGIT++++ ATI DGTVI
Sbjct  482  EEAERADEGFYIRSGITVVLKNATIKDGTVI  512



>ref|XP_009336061.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Pyrus x bretschneideri]
Length=512

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEF DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  362  KFEFNDPKTPFYTSPRFLPPTKVEKCRIMDAIISHGCFLRECSVQHSIVGVRSRLESGVE  421

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA G VP+GVGENTKI N IIDKN +IG++VVI N DGV
Sbjct  422  LKDTMMMGADYYQTESEIASLLAQGKVPVGVGENTKIWNCIIDKNAKIGRNVVITNGDGV  481

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++R DEGFYIRSGIT++++ ATI DGTVI
Sbjct  482  EEAERADEGFYIRSGITVVLKNATIKDGTVI  512



>ref|NP_001289992.1| glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Beta vulgaris subsp. vulgaris]
 sp|P55233.1|GLGL1_BETVU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Beta vulgaris]
 emb|CAA55516.1| ADP-glucose pyrophosphorylase [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTS RFLPPTK+D CKI D+I+SHGCFL+E +++HSI+G RSRL+ GVE
Sbjct  372  KFEFYDPKTPFYTSARFLPPTKVDRCKIVDSIVSHGCFLQESSIQHSIVGVRSRLESGVE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             +DT+MMGAD Y+TESEIASLLA+G VP+GVG+NTKI+N IIDKN +IGKDVVI N DGV
Sbjct  432  FQDTMMMGADYYQTESEIASLLAEGKVPVGVGQNTKIKNCIIDKNAKIGKDVVIANTDGV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGITII++ ATI DG VI
Sbjct  492  EEADRPNEGFYIRSGITIILKNATIQDGLVI  522



>ref|XP_010673183.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTS RFLPPTK+D CKI D+I+SHGCFL+E +++HSI+G RSRL+ GVE
Sbjct  372  KFEFYDPKTPFYTSARFLPPTKVDRCKIVDSIVSHGCFLQESSIQHSIVGVRSRLESGVE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             +DT+MMGAD Y+TESEIASLLA+G VP+GVG+NTKI+N IIDKN +IGKDVVI N DGV
Sbjct  432  FQDTMMMGADYYQTESEIASLLAEGKVPVGVGQNTKIKNCIIDKNAKIGKDVVIANTDGV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGITII++ ATI DG VI
Sbjct  492  EEADRPNEGFYIRSGITIILKNATIQDGLVI  522



>gb|EYU45186.1| hypothetical protein MIMGU_mgv1a004400mg [Erythranthe guttata]
Length=529

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+VEHSI+G RSRLD GVE
Sbjct  379  KFDFNDPKTPFYTSPRFLPPTKVEQCRIVDAIISHGCFLRECSVEHSIVGVRSRLDYGVE  438

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA G VPIGVG N+KI N IIDKN +IGK+V+I NKDGV
Sbjct  439  LKDTMMMGADYYQTESEIASLLAQGKVPIGVGHNSKISNCIIDKNAKIGKNVIIANKDGV  498

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++R DEGFYIRSGIT+I++ +TI DGT+I
Sbjct  499  EEAERADEGFYIRSGITVILKNSTIKDGTII  529



>ref|XP_010926128.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
Length=529

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+++HS++G RSRLD GVE
Sbjct  379  KFQFYDPMTPFFTSPRFLPPTKIEKCRILDAIISHGCFLRECSIQHSVVGVRSRLDYGVE  438

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD YETE+EIASLLA+  VPIGVG+NTKI N IID N RIGK+V+I NKDGV
Sbjct  439  LKDTMMMGADYYETEAEIASLLAEDKVPIGVGQNTKISNCIIDMNARIGKNVIIANKDGV  498

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGI+II++ ATI DG +I
Sbjct  499  QEADRPHEGFYIRSGISIILKNATIKDGAII  529



>gb|AAB82604.1| ADP-glucose-pyrophosphorylase large subunit [Triticum aestivum]
Length=290

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G E
Sbjct  140  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSE  199

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  200  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  259

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I + ATI DGTV+
Sbjct  260  QEADRPEEGYYIRSGIVVIQKNATIKDGTVV  290



>ref|XP_003528021.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X1 [Glycine max]
 gb|KHN22238.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=531

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPRFLPPTK++ CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  381  KFEFYDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFLRECSVQHSIVGVRSRLESGVE  440

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE EIASL+A+G VPIGVG NTKIRN IIDKN +IG++V+I N DGV
Sbjct  441  LQDTMMMGADYYQTEYEIASLVAEGKVPIGVGANTKIRNCIIDKNAKIGRNVIIANTDGV  500

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFYIRSGIT+ ++ ATI DGTVI
Sbjct  501  QEADRAKEGFYIRSGITVTLKNATIKDGTVI  531



>ref|XP_009396671.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP+TP +TSPRFLPP KI+ C+I+DAIISHGCFL EC++EHS++G RSR+  G E
Sbjct  374  KFQFYDPRTPIFTSPRFLPPNKIEQCRIRDAIISHGCFLHECSIEHSVVGMRSRVYYGAE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK TLMMGAD+YETE+EIASLLA+G VPIGVGENTKIRN IID N RIGK+VVI N+DGV
Sbjct  434  LKHTLMMGADDYETEAEIASLLAEGKVPIGVGENTKIRNCIIDMNARIGKNVVIANRDGV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGIT I++ AT+ DGTVI
Sbjct  494  QEADRPSEGFYIRSGITTILKSATVKDGTVI  524



>ref|XP_009406290.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=526

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+VE SI+G RSRLD   E
Sbjct  376  KFQFYDPMTPFFTSPRFLPPTKIEKCRIVDAIISHGCFLRECSVERSIVGVRSRLDFDAE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD YETE+EIASLLAD  VPIGVG+NT+IRN IID N RIGK+VVI NKDG+
Sbjct  436  LKDTMMMGADIYETEAEIASLLADDKVPIGVGQNTRIRNCIIDMNARIGKNVVIANKDGI  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGITIIM+ +TI DGTVI
Sbjct  496  QEADRPCEGFYIRSGITIIMKNSTIKDGTVI  526



>ref|XP_006411722.1| hypothetical protein EUTSA_v10024927mg [Eutrema salsugineum]
 dbj|BAJ34261.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53175.1| hypothetical protein EUTSA_v10024927mg [Eutrema salsugineum]
Length=521

 Score =   248 bits (633),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+  D+IISHGCFL EC+++ SIIGERSRLD GVE
Sbjct  371  KFEFYDQNTPFYTSPRFLPPTKTEKCRFVDSIISHGCFLGECSIQRSIIGERSRLDYGVE  430

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V
Sbjct  431  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDV  490

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  491  QEADRPEEGFYIRSGITVIVEKATIKDGTVI  521



>ref|XP_009406289.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+VE SI+G RSRLD   E
Sbjct  399  KFQFYDPMTPFFTSPRFLPPTKIEKCRIVDAIISHGCFLRECSVERSIVGVRSRLDFDAE  458

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD YETE+EIASLLAD  VPIGVG+NT+IRN IID N RIGK+VVI NKDG+
Sbjct  459  LKDTMMMGADIYETEAEIASLLADDKVPIGVGQNTRIRNCIIDMNARIGKNVVIANKDGI  518

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGITIIM+ +TI DGTVI
Sbjct  519  QEADRPCEGFYIRSGITIIMKNSTIKDGTVI  549



>ref|XP_002878559.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+++ SIIGERSRLD GVE
Sbjct  370  KFEFYDPDTPFYTSPRFLPPTKAEKCRMVDSIISHGCFLRECSIQRSIIGERSRLDYGVE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD Y+TESEIASLLA+G VPIG+G +TK+R  IIDKN +IGK+V+IMNK  V
Sbjct  430  LQDTLMLGADYYQTESEIASLLAEGKVPIGIGRDTKVRKCIIDKNAKIGKNVIIMNKGDV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIR GIT+I+EKATI DGTVI
Sbjct  490  QEADRPEEGFYIRLGITVIVEKATIQDGTVI  520



>ref|NP_195632.1| glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis 
thaliana]
 sp|P55231.2|GLGL3_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: Full=AGPase 
S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA77173.1| glucose-1-phosphate adenylyltransferase [Arabidopsis thaliana]
 emb|CAB43636.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 emb|CAB80584.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 gb|AAL24344.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 gb|AAQ56821.1| At4g39210 [Arabidopsis thaliana]
 gb|AEE87038.1| glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis 
thaliana]
Length=521

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I +++ISHGCFL EC+++ SIIGERSRLD GVE
Sbjct  371  KFEFYDQNTPFYTSPRFLPPTKTEKCRIVNSVISHGCFLGECSIQRSIIGERSRLDYGVE  430

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+VVIMNKD V
Sbjct  431  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVVIMNKDDV  490

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  491  KEADRPEEGFYIRSGITVVVEKATIKDGTVI  521



>ref|XP_011074558.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Sesamum indicum]
 ref|XP_011074559.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Sesamum indicum]
Length=529

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+  DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRLD GVE
Sbjct  379  KFDLNDPKTPFYTSPRFLPPTKVEKCRIVDAIISHGCFLRECSVQHSIVGVRSRLDYGVE  438

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASLLA+G VPIGVG NTKI N IIDKN +IGKDVVI NKDGV
Sbjct  439  LKDTMMMGADYYQTESEIASLLAEGKVPIGVGRNTKISNCIIDKNAKIGKDVVIANKDGV  498

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++R DEGFYIRSGI ++++  TI DGTVI
Sbjct  499  EEAERADEGFYIRSGIVVLLKNTTIKDGTVI  529



>ref|XP_009394804.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=538

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP+TP +TSPRFLPPTKI+ C+I D+IISHGCFL EC++EHSI+G RSR+D G E
Sbjct  388  KFQFYDPRTPIFTSPRFLPPTKIEKCRILDSIISHGCFLHECSIEHSIVGVRSRIDYGAE  447

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD LM+GAD YETE+E+AS+LA+G VPIGVG+NTKIRN IID N RIGK+VVI NKDGV
Sbjct  448  LKDALMLGADLYETEAELASILAEGKVPIGVGQNTKIRNCIIDMNARIGKNVVIANKDGV  507

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIR GITIIM+ ATI DGTVI
Sbjct  508  QEADRPSEGFYIRFGITIIMKNATIKDGTVI  538



>ref|XP_006415741.1| hypothetical protein EUTSA_v10007379mg [Eutrema salsugineum]
 gb|ESQ34094.1| hypothetical protein EUTSA_v10007379mg [Eutrema salsugineum]
Length=518

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  368  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRVESGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+  VPIGVGENTKIRN IIDKN +IGK+VVI N DGV
Sbjct  428  LQDTMMMGADFYQTEAEIASLLAERKVPIGVGENTKIRNCIIDKNAKIGKNVVIANADGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGFYIRSGIT++++ ATI DG V+
Sbjct  488  EEGDRPEEGFYIRSGITVVVKNATIRDGFVV  518



>gb|KFK36157.1| hypothetical protein AALP_AA4G085400 [Arabis alpina]
Length=514

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  364  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRLESGVE  423

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VPIGVG+NTKIRN IIDKN +IGK+VVI N DGV
Sbjct  424  LQDTMMMGADFYQTEAEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGKNVVIANADGV  483

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDG  314
            +E DRP +GFYIRSGIT++++ ATI DG
Sbjct  484  EEGDRPADGFYIRSGITVVLKNATIRDG  511



>ref|XP_009101892.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Brassica rapa]
Length=523

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I D+IISHGCFL EC+++ SIIGERSRLD GVE
Sbjct  373  KFEFYDQDTPFYTSPRFLPPTKTEKCRILDSIISHGCFLGECSIQRSIIGERSRLDYGVE  432

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+N D V
Sbjct  433  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDV  492

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  493  QEADRPEEGFYIRSGITVVVEKATIKDGTVI  523



>gb|KDP38538.1| hypothetical protein JCGZ_04463 [Jatropha curcas]
Length=527

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD KTPFYT PRFLPPTK+D CKI DAIISHGCFL+EC+++HS++G RSRL+ GVE
Sbjct  377  KFEFYDSKTPFYTCPRFLPPTKVDKCKIVDAIISHGCFLQECSIQHSVVGVRSRLESGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT+MMGAD Y+TESEIASLLA+G VP+GVG+NTKIRN IIDKN +IG+DVVI N DGV
Sbjct  437  LIDTMMMGADYYQTESEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGRDVVITNADGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
             E+DRP+EGFYIRSGIT I + ATI DGT+I
Sbjct  497  LEADRPEEGFYIRSGITAIPKDATIKDGTII  527



>ref|XP_006303972.1| hypothetical protein CARUB_v10008862mg [Capsella rubella]
 gb|EOA36870.1| hypothetical protein CARUB_v10008862mg [Capsella rubella]
Length=519

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  369  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VPIGVG+NTKIRN IIDKN +IGK+VVI N DGV
Sbjct  429  LQDTMMMGADFYQTEAEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGKNVVIANADGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGF+IRSGIT++++ ATI DG  I
Sbjct  489  EEGDRPEEGFHIRSGITVVLKNATIRDGLQI  519



>ref|XP_006346702.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Solanum tuberosum]
Length=521

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE
Sbjct  371  KFDFNDPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVE  430

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             KDT+MMGAD Y+TESEIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NK+GV
Sbjct  431  FKDTMMMGADYYQTESEIASLLAEGKVPIGVGPNTKIQNCIIDKNAKIGKDVVILNKEGV  490

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR  EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  491  EEADRSAEGFYIRSGITVIMKNATIKDGTVI  521



>ref|XP_009101891.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X1 [Brassica rapa]
Length=529

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I D+IISHGCFL EC+++ SIIGERSRLD GVE
Sbjct  379  KFEFYDQDTPFYTSPRFLPPTKTEKCRILDSIISHGCFLGECSIQRSIIGERSRLDYGVE  438

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+N D V
Sbjct  439  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDV  498

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  499  QEADRPEEGFYIRSGITVVVEKATIKDGTVI  529



>ref|XP_004291856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Fragaria vesca subsp. vesca]
Length=521

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEF DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ G E
Sbjct  371  KFEFNDPKTPFYTSPRFLPPTKVEKCRIMDAIISHGCFLRECSVQHSIVGVRSRLEYGAE  430

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE EIASLLA+G VP+GVGENTKI N IIDKN +IG++VVI N DGV
Sbjct  431  LKDTMMMGADYYQTEEEIASLLANGKVPVGVGENTKIWNCIIDKNAKIGRNVVITNGDGV  490

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP++GFYIRSGIT++++ ATI DGT+I
Sbjct  491  EEAERPEDGFYIRSGITVVLKNATIKDGTII  521



>gb|AGB85111.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas]
Length=517

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F+F DPKTPFYTSPRFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G  SRLD GVEL
Sbjct  368  FDFNDPKTPFYTSPRFLPPTKVDKCKIVDAIISHGCFLRECSVKHSIVGIWSRLDYGVEL  427

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT++MGAD Y+TESEIASLLA G VPIG+G NTKIRN IIDKN RIGKDVVI NKD V 
Sbjct  428  EDTMVMGADYYQTESEIASLLATGKVPIGIGTNTKIRNCIIDKNARIGKDVVIANKDRVD  487

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DR DEGFYIRSGITI+++ ATI DGTVI
Sbjct  488  EADRADEGFYIRSGITIVLKNATIRDGTVI  517



>ref|XP_008648319.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic isoform X1 [Zea mays]
 ref|XP_008648320.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic isoform X1 [Zea mays]
 gb|ACG34981.1| glucose-1-phosphate adenylyltransferase large subunit [Zea mays]
 gb|ACN28262.1| unknown [Zea mays]
 gb|AFW79324.1| glucose-1-phosphate adenylyltransferase large subunit 2, /amyloplastic 
Precursor(ADP-glucose pyrophosphorylase) isoform 1 
[Zea mays]
 gb|AFW79325.1| glucose-1-phosphate adenylyltransferase large subunit 2, /amyloplastic 
Precursor(ADP-glucose pyrophosphorylase) isoform 2 
[Zea mays]
Length=518

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLREC +EHSI+G RSRL+ G E
Sbjct  368  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LLA+G VPIGVGENTKI N IID N R+G++V I NK+GV
Sbjct  428  LKNTMMMGADLYETEDEISRLLAEGKVPIGVGENTKISNCIIDMNARVGRNVSITNKEGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRPDEG+YIRSGI ++++ ATI DGTVI
Sbjct  488  QEADRPDEGYYIRSGIVVVLKNATIKDGTVI  518



>gb|AFW79323.1| ADP-glucose pyrophosphorylase large subunit [Zea mays]
Length=534

 Score =   245 bits (626),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLREC +EHSI+G RSRL+ G E
Sbjct  384  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCE  443

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LLA+G VPIGVGENTKI N IID N R+G++V I NK+GV
Sbjct  444  LKNTMMMGADLYETEDEISRLLAEGKVPIGVGENTKISNCIIDMNARVGRNVSITNKEGV  503

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRPDEG+YIRSGI ++++ ATI DGTVI
Sbjct  504  QEADRPDEGYYIRSGIVVVLKNATIKDGTVI  534



>ref|XP_006282507.1| hypothetical protein CARUB_v10007053mg [Capsella rubella]
 gb|EOA15405.1| hypothetical protein CARUB_v10007053mg [Capsella rubella]
Length=521

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVE
Sbjct  371  KFEFYDQTTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVE  430

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G++TKIR  IIDKN +IGK+V+I+NKD V
Sbjct  431  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGQDTKIRKCIIDKNAKIGKNVMILNKDDV  490

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT+++EKATI DGT+I
Sbjct  491  KEADRPEEGFYIRSGITVVVEKATIKDGTII  521



>emb|CDY56761.1| BnaA06g40730D [Brassica napus]
Length=595

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I D+IISHGCFL EC+++ SIIGERSRLD GVE
Sbjct  445  KFEFYDQDTPFYTSPRFLPPTKTEKCRIVDSIISHGCFLGECSIQRSIIGERSRLDYGVE  504

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+N D V
Sbjct  505  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDV  564

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  565  QEADRPEEGFYIRSGITVVVEKATIKDGTVI  595



>ref|XP_010446453.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446454.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446456.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446457.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
Length=522

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVE
Sbjct  372  KFEFYDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V
Sbjct  432  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  492  KEADRPEEGFYIRSGITVVVEKATIKDGTVI  522



>gb|ADE77153.1| unknown [Picea sitchensis]
Length=220

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP  P +TSP+FLPPTKI+ C++ D+IISHGCFL+ECTVEHS++G RSRL+ G E
Sbjct  70   KFHFYDPMKPIFTSPQFLPPTKIEKCQVLDSIISHGCFLQECTVEHSVVGIRSRLEYGAE  129

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE+EIASLLA+G VPIGVGENTKIRN IIDKN RIGK+VVI N D V
Sbjct  130  LKETMMMGADYYETEAEIASLLAEGKVPIGVGENTKIRNCIIDKNARIGKNVVIANSDNV  189

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP EG+YIRSGIT+I++ + I DGTVI
Sbjct  190  EEAERPSEGYYIRSGITVILKNSRIKDGTVI  220



>gb|AIO11223.1| AGPL1 protein [Gladiolus hybrid cultivar]
Length=517

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPR+LPPTK++ C+I DAIISHGCFL+ECTV +SI+G RSRLD GVE
Sbjct  367  KFQFYDPKTPFFTSPRYLPPTKMEKCRIVDAIISHGCFLQECTVHNSIVGVRSRLDYGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLMMGAD YETE+EIASLLA+G VPIGVG+NTKIRN IID N RIG +VVI NKDGV
Sbjct  427  LEDTLMMGADVYETEAEIASLLAEGKVPIGVGKNTKIRNCIIDMNARIGANVVIANKDGV  486

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSGITII   + I DGT+I
Sbjct  487  QEADRPLEGFYIRSGITIIPMNSIIKDGTII  517



>ref|XP_010499251.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Camelina sativa]
Length=520

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  370  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+VVI N DGV
Sbjct  430  LQDTMMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVVIANADGV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGF+IRSGIT++++ ATI DG  I
Sbjct  490  EEGDRPEEGFHIRSGITVVLKNATIRDGLHI  520



>ref|XP_010431888.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010431889.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010431890.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
Length=522

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVE
Sbjct  372  KFEFYDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V
Sbjct  432  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  492  KEADRPEEGFYIRSGITVVVEKATIKDGTVI  522



>ref|XP_010460525.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Camelina sativa]
Length=520

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  370  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+V+I N DGV
Sbjct  430  LQDTMMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVIIANADGV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGF+IRSGIT++++ ATI DG  I
Sbjct  490  EEGDRPEEGFHIRSGITVVLKNATIRDGLHI  520



>gb|ABF69950.1| ADP-glucose pyrophosphorylase (glucose-1-phosphate adenylyltransferase) 
large subunit, putative [Musa acuminata]
Length=445

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPF+TSPRFLPPTKI+ C++ DAIISHGCFLREC+VE SI+G RSRLD GVE
Sbjct  295  KFQFYDPMTPFFTSPRFLPPTKIEKCRVMDAIISHGCFLRECSVERSIVGVRSRLDFGVE  354

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD YETE+EI+S LAD  VPIGVG+ TKIRN +ID N RIGK+VVI NKDGV
Sbjct  355  LKDTMMMGADIYETEAEISSHLADDKVPIGVGQKTKIRNCVIDMNARIGKNVVIANKDGV  414

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFY+RSGI +I++ ATI DGTVI
Sbjct  415  QEADRASEGFYVRSGIVVILKNATIKDGTVI  445



>ref|XP_010478112.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X1 [Camelina sativa]
Length=522

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  372  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+V+I N DGV
Sbjct  432  LQDTMMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVIIANADGV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGF+IRSGIT++++ ATI DG  I
Sbjct  492  EEGDRPEEGFHIRSGITVVLKNATIRDGLHI  522



>ref|XP_010437035.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like isoform X2 [Camelina sativa]
Length=519

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVE
Sbjct  369  KFEFYDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVP+G+G +TKIR  IIDKN +IGK+V+I+NKD V
Sbjct  429  LQDTLMLGADSYQTESEIASLLAEGNVPVGIGRDTKIRKCIIDKNAKIGKNVMILNKDDV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  489  KEADRPEEGFYIRSGITVVVEKATIKDGTVI  519



>ref|XP_010437034.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like isoform X1 [Camelina sativa]
Length=522

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVE
Sbjct  372  KFEFYDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVP+G+G +TKIR  IIDKN +IGK+V+I+NKD V
Sbjct  432  LQDTLMLGADSYQTESEIASLLAEGNVPVGIGRDTKIRKCIIDKNAKIGKNVMILNKDDV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  492  KEADRPEEGFYIRSGITVVVEKATIKDGTVI  522



>ref|XP_010478113.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X2 [Camelina sativa]
Length=520

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  370  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+V+I N DGV
Sbjct  430  LQDTMMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVIIANADGV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGF+IRSGIT++++ ATI DG  I
Sbjct  490  EEGDRPEEGFHIRSGITVVLKNATIRDGLHI  520



>ref|XP_002866835.1| hypothetical protein ARALYDRAFT_490693 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43094.1| hypothetical protein ARALYDRAFT_490693 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+++ SIIGERSRLD GVE
Sbjct  371  KFEFYDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSIQRSIIGERSRLDYGVE  430

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V
Sbjct  431  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDV  490

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT+++EKATI D TVI
Sbjct  491  KEADRPEEGFYIRSGITVVVEKATIKDSTVI  521



>ref|XP_010431887.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X1 [Camelina sativa]
Length=534

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVE
Sbjct  384  KFEFYDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVE  443

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V
Sbjct  444  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDV  503

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  504  KEADRPEEGFYIRSGITVVVEKATIKDGTVI  534



>gb|AJG44462.1| ADP-glucose pyrophosphorylase large subunit [Lilium davidii var. 
unicolor]
Length=514

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPFYTSPR+LPPTK+D C+I +AIISHGCFL +C+V+HS++G RSRL+ GVE
Sbjct  364  KFQFYDPMTPFYTSPRYLPPTKVDKCQIVNAIISHGCFLHDCSVQHSVVGVRSRLESGVE  423

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESE+A+LLA+G VPIGVG NTKI+N IIDKN RIG+DV+I NKDGV
Sbjct  424  LKDTMMMGADFYQTESEVAALLAEGKVPIGVGPNTKIKNCIIDKNARIGRDVIITNKDGV  483

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++GFYIRSGITII +  TI D TVI
Sbjct  484  QEADRPEDGFYIRSGITIIPKNTTIKDETVI  514



>ref|XP_006654841.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Oryza brachyantha]
Length=519

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLRECT+EHSI+G RSRL+ G E
Sbjct  369  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECTIEHSIVGVRSRLNSGCE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++VVI N +GV
Sbjct  429  LKNTMMMGADLYETEDEISRLLSEGKVPIGVGENTKISNCIIDMNARVGRNVVIKNSEGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I++ ATI DGTVI
Sbjct  489  QEADRPEEGYYIRSGIVVILKNATIKDGTVI  519



>ref|XP_002890743.1| hypothetical protein ARALYDRAFT_472972 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67002.1| hypothetical protein ARALYDRAFT_472972 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  368  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+VVI N +GV
Sbjct  428  LQDTMMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVVIANAEGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGF+IRSGIT++++ ATI DG  I
Sbjct  488  EEGDRPEEGFHIRSGITVVLKNATIRDGLHI  518



>emb|CDX72711.1| BnaC07g47330D [Brassica napus]
Length=632

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+++ SIIGERSRLD GVE
Sbjct  482  KFEFYDQDTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSIQRSIIGERSRLDYGVE  541

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DTLM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+N D V
Sbjct  542  LQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNNDDV  601

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  602  QEADRPEEGFYIRSGITVVVEKATIKDGTVI  632



>ref|XP_007160732.1| hypothetical protein PHAVU_001G012500g [Phaseolus vulgaris]
 gb|ESW32726.1| hypothetical protein PHAVU_001G012500g [Phaseolus vulgaris]
Length=520

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSP FLPPTK+  CK+ DAIISHGCFL +C V+HSI+G+RSRL+ G E
Sbjct  370  KFEFYDPKTPFFTSPGFLPPTKLIKCKLVDAIISHGCFLNKCKVQHSIVGQRSRLEAGSE  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+T+SEIA+LLA+G VP+GVGENTKIRN IIDKN +IGK+V+I N DGV
Sbjct  430  LQDTMMMGADYYQTDSEIATLLAEGKVPVGVGENTKIRNCIIDKNAKIGKNVIIANADGV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+D+P+EGFYIRSGI +I++ ATI DGTVI
Sbjct  490  QEADKPEEGFYIRSGIVVIVKNATIKDGTVI  520



>sp|P55242.1|GLGL2_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Solanum tuberosum]
 emb|CAA52917.1| ADP-glucose-pyrophosphorylase [Solanum tuberosum]
Length=519

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE
Sbjct  369  KFDFNDPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             KDT+MMGAD Y+TE EIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NK+GV
Sbjct  429  FKDTMMMGADYYQTECEIASLLAEGKVPIGVGPNTKIQNCIIDKNAKIGKDVVILNKEGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR  EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  489  EEADRSAEGFYIRSGITVIMKNATIKDGTVI  519



>ref|XP_010323163.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323164.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X1 [Solanum lycopersicum]
Length=518

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE
Sbjct  368  KFDFNDPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             KDT+MMGAD Y+TESEIASLLA+G VPIGVG NTKI+  IIDKN +IGKDVVI+NK GV
Sbjct  428  FKDTMMMGADYYQTESEIASLLAEGKVPIGVGPNTKIQKCIIDKNAKIGKDVVILNKQGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR  EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  488  EEADRSAEGFYIRSGITVIMKNATIKDGTVI  518



>ref|NP_001233947.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|AAB40724.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=518

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE
Sbjct  368  KFDFNDPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             KDT+MMGAD Y+TESEIASLLA+G VPIGVG NTKI+  IIDKN +IGKDVVI+NK GV
Sbjct  428  FKDTMMMGADYYQTESEIASLLAEGKVPIGVGPNTKIQKCIIDKNAKIGKDVVILNKQGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR  EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  488  EEADRSAEGFYIRSGITVIMKNATIKDGTVI  518



>ref|XP_007222521.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica]
 gb|EMJ23720.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica]
Length=527

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEF DPKTPFYTSPRFLPPTK++ C+I DAI+SHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  377  KFEFNDPKTPFYTSPRFLPPTKVEKCRIIDAIVSHGCFLRECSVQHSIVGVRSRLESGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASL+A G VP+GVG NTKI N IIDKN +IG++V+I N DGV
Sbjct  437  LKDTMMMGADYYQTESEIASLVALGKVPVGVGSNTKIWNCIIDKNAKIGRNVMITNTDGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR +EGFYIRSGIT++++ ATI DGTVI
Sbjct  497  EEADRAEEGFYIRSGITVVLKNATIKDGTVI  527



>ref|XP_010540326.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Tarenaya hassleriana]
Length=522

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPPTK+D C+I D+I+SHGCFLREC+V+ SI+G RSRL+ GVE
Sbjct  372  KFEFYDPKTPFYTSPRFLPPTKVDRCRILDSIVSHGCFLRECSVQRSIVGVRSRLESGVE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE EIASLLA G VPIGVG +TKIRN IIDKN +IGK+V+I N DGV
Sbjct  432  LQDTMMMGADFYQTEVEIASLLAQGKVPIGVGPDTKIRNCIIDKNAKIGKNVIITNADGV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR +EGFYIRSGIT++++ ATI DG VI
Sbjct  492  EEADRAEEGFYIRSGITVVLKNATIRDGLVI  522



>sp|P12299.2|GLGL2_WHEAT RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Triticum aestivum]
 emb|CAA79980.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
 gb|ABG88200.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
Length=522

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G E
Sbjct  372  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  432  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I + ATI DGTV+
Sbjct  492  QEADRPEEGYYIRSGIVVIQKNATIKDGTVV  522



>ref|XP_008220832.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X1 [Prunus mume]
Length=527

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEF DPKTPFYTSPRFLPPTK++ C+I DAI+SHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  377  KFEFNDPKTPFYTSPRFLPPTKVEKCRIIDAIVSHGCFLRECSVQHSIVGVRSRLESGVE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TESEIASL+A G VP+GVG NTKI N IIDKN +IG++V+I N DGV
Sbjct  437  LKDTMMMGADYYQTESEIASLVALGKVPVGVGSNTKIWNCIIDKNAKIGRNVMITNADGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR +EGFYIRSGIT++++ ATI DGTV+
Sbjct  497  EEADRAEEGFYIRSGITVVLKNATIKDGTVV  527



>emb|CAA32532.1| ADP-glucose pyrophosophorylase (1 is 2nd base in codon) [Triticum 
aestivum]
 prf||1609236B ADP glucose pyrophosphatase AGA.3
Length=296

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AII HGCFLREC +EHSIIG  SRL+ G E
Sbjct  146  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIILHGCFLRECKIEHSIIGVPSRLNSGSE  205

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  206  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  265

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I + ATI DGTV+
Sbjct  266  QEADRPEEGYYIRSGIVVIQKNATIKDGTVV  296



>gb|AHA11391.1| cytosolic ADP-glucose pyrophosphorylase large subunit [Hordeum 
vulgare]
Length=523

 Score =   243 bits (619),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G E
Sbjct  373  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSE  432

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  433  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  492

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I + ATI DGTV+
Sbjct  493  QEADRPEEGYYIRSGIVVIQKNATIKDGTVV  523



>emb|CAD98749.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
Length=522

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G E
Sbjct  372  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  432  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I + ATI DGTV+
Sbjct  492  QEADRPEEGYYIRSGIVVIQKNATIKDGTVV  522



>sp|P30524.2|GLGL1_HORVU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
1, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; AltName: Full=BEPL; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA47626.1| glucose-1-phosphate adenylyltransferase [Hordeum vulgare subsp. 
vulgare]
 emb|CAX51355.1| large subunit of ADP-glucose pyrophosphorylase [Hordeum vulgare 
subsp. vulgare]
 dbj|BAK04629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93393.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93437.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AHA11390.1| cytosolic ADP-glucose pyrophosphorylase large subunit [Hordeum 
vulgare]
Length=523

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G E
Sbjct  373  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSE  432

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  433  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  492

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I + ATI DGTV+
Sbjct  493  QEADRPEEGYYIRSGIVVIQKNATIKDGTVV  523



>ref|XP_009416548.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=529

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP TPF+TSPRFLPPTKI+ C++ DAIISHGCFLREC+VE SI+G RSRLD GVE
Sbjct  379  KFQFYDPMTPFFTSPRFLPPTKIEKCRVMDAIISHGCFLRECSVERSIVGVRSRLDFGVE  438

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD YETE+EI+S LAD  VPIGVG+ TKIRN +ID N RIGK+VVI NKDGV
Sbjct  439  LKDTMMMGADIYETEAEISSHLADDKVPIGVGQKTKIRNCVIDMNARIGKNVVIANKDGV  498

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DR  EGFY+RSGI +I++ ATI DGTVI
Sbjct  499  QEADRASEGFYVRSGIVVILKNATIKDGTVI  529



>ref|NP_174089.1| glucose-1-phosphate adenylyltransferase large subunit 2 [Arabidopsis 
thaliana]
 sp|P55230.2|GLGL2_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: Full=AGPase 
S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF24945.1|AC012375_8 T22C5.13 [Arabidopsis thaliana]
 gb|AAL36283.1| putative ADP-glucose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAM14190.1| putative ADP-glucose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE30862.1| glucose-1-phosphate adenylyltransferase large subunit 2 [Arabidopsis 
thaliana]
Length=518

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYD KTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  368  KFQFYDQKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRLESGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VP+GVG+NTKI+N IIDKN +IGK+VVI N DGV
Sbjct  428  LQDTMMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIKNCIIDKNAKIGKNVVIANADGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DRP+EGF+IRSGIT++++ ATI DG  I
Sbjct  488  EEGDRPEEGFHIRSGITVVLKNATIRDGLHI  518



>gb|EMT32758.1| hypothetical protein F775_52189 [Aegilops tauschii]
Length=574

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G E
Sbjct  378  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  438  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I + ATI DGTV+
Sbjct  498  QEADRPEEGYYIRSGIVVIQKNATIKDGTVV  528



>ref|XP_011007451.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Populus euphratica]
Length=518

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  736  KTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMM  557
            +TPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT+MM
Sbjct  375  QTPFFTSPRFLPPTKVDRCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDTMMM  434

Query  556  GADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPD  377
            GAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN RIGKDV+I N DGVQE+DRP 
Sbjct  435  GADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNARIGKDVIITNADGVQEADRPA  494

Query  376  EGFYIRSGITIIMEKATIPDGTVI  305
            EGFYIRSGIT +++ ATI DGT+I
Sbjct  495  EGFYIRSGITAVLKNATIKDGTLI  518



>prf||1909370A ADP glucose pyrophosphorylase:SUBUNIT=L
Length=527

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G E
Sbjct  377  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSE  436

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  437  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  496

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I + ATI DGTV+
Sbjct  497  QEADRPEEGYYIRSGIVVIQKNATIKDGTVV  527



>gb|AEH27531.1| putative ADP-glucose pyrophosphorylase [Amorphophallus konjac]
Length=543

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDP+TPFYTSPR+LPPTK+D C+I D+IISHGCFL +C++EHSI+G+RSRL+  VE
Sbjct  393  KFQFYDPQTPFYTSPRYLPPTKVDKCRIVDSIISHGCFLDQCSIEHSIVGDRSRLEYNVE  452

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE E A+LLA+G VPIGVG+ TK+RN IIDKN +IGK+V+I NKDGV
Sbjct  453  LKDTMMMGADYYQTEVERAALLAEGKVPIGVGQQTKMRNCIIDKNAKIGKNVIITNKDGV  512

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFYIRSG TII++  TI DGTVI
Sbjct  513  QEADRPSEGFYIRSGHTIILKNTTIKDGTVI  543



>ref|NP_001056424.2| Os05g0580000 [Oryza sativa Japonica Group]
 gb|AAU10700.1| putative glucose-1-phosphate adenylyltransferase [Oryza sativa 
Japonica Group]
 gb|EAY99171.1| hypothetical protein OsI_21129 [Oryza sativa Indica Group]
 gb|ACA50479.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 dbj|BAG94825.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64817.1| hypothetical protein OsJ_19673 [Oryza sativa Japonica Group]
 dbj|BAF18338.2| Os05g0580000 [Oryza sativa Japonica Group]
 gb|ACY56044.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56045.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56046.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56047.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56048.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56049.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56050.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56051.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56052.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56053.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56054.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56055.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56056.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56057.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
Length=519

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLRECT+EHSI+G RSRL+   E
Sbjct  369  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECTIEHSIVGVRSRLNSACE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++VVI N +GV
Sbjct  429  LKNTMMMGADLYETEDEISRLLSEGKVPIGVGENTKINNCIIDMNARVGRNVVITNSEGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRP+EG+YIRSGI +I++ ATI DG VI
Sbjct  489  QESDRPEEGYYIRSGIVVILKNATIKDGKVI  519



>gb|AAD39597.1|AC007858_11 10A19I.12 [Oryza sativa Japonica Group]
Length=529

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLRECT+EHSI+G RSRL+   E
Sbjct  379  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECTIEHSIVGVRSRLNSACE  438

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++VVI N +GV
Sbjct  439  LKNTMMMGADLYETEDEISRLLSEGKVPIGVGENTKINNCIIDMNARVGRNVVITNSEGV  498

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRP+EG+YIRSGI +I++ ATI DG VI
Sbjct  499  QESDRPEEGYYIRSGIVVILKNATIKDGKVI  529



>gb|KJB63621.1| hypothetical protein B456_010G008700 [Gossypium raimondii]
Length=523

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPRFLPP+KID C+I +AIISHGCFLR C+V+ S++G RSRL+ GVE
Sbjct  373  KFEFYDPKTPFYTSPRFLPPSKIDQCRIVNAIISHGCFLRNCSVKRSVVGVRSRLESGVE  432

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE EI SLL +G VPIGVG+NTKI+N IIDKN +IGK+V+I N DGV
Sbjct  433  LEDTMMMGADFYQTEMEIMSLLKEGKVPIGVGQNTKIKNCIIDKNAKIGKNVIISNSDGV  492

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP++GFYIRSGIT+IM+ ATI DG+VI
Sbjct  493  EEAERPEQGFYIRSGITVIMKNATIKDGSVI  523



>gb|EMS53815.1| Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic/amyloplastic 
[Triticum urartu]
Length=458

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G E
Sbjct  252  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSE  311

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GV
Sbjct  312  LKNAMMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGV  371

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGT  311
            QE+DRP+EG+YIRSGI +I + ATI DG+
Sbjct  372  QEADRPEEGYYIRSGIVVIQKNATIKDGS  400



>ref|NP_001284415.1| myeloid leukemia factor 2 [Cucumis melo]
 gb|AAB91464.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo]
Length=518

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPFYTSPR  PP+K++ C+I DAIISHGCFLRECTVE  I+G RSRL+ GVE
Sbjct  368  KFEFYDPKTPFYTSPRSCPPSKVEKCRIVDAIISHGCFLRECTVEPLIVGVRSRLEYGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGA  Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN +IG++VVI N D V
Sbjct  428  LKDTMMMGAYYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNAKIGRNVVIANTDDV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EGFYIRSGIT+ ++ ATI DGT+I
Sbjct  488  QEADRPEEGFYIRSGITVTLKNATIKDGTII  518



>gb|AGT17180.1| glucose-1-phosphate adenylyltransferase [Saccharum hybrid cultivar 
R570]
Length=519

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLREC +EHSI+G RSRL+ G E
Sbjct  369  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++V I N +GV
Sbjct  429  LKNTMMMGADLYETEDEISRLLSEGKVPIGVGENTKISNCIIDMNARVGRNVSITNTEGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++G+YIRSG+ +I++ ATI DGTVI
Sbjct  489  QEADRPEQGYYIRSGVVVILKNATIKDGTVI  519



>ref|XP_004961109.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Setaria italica]
Length=518

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D  +IKDAIISHGCFLRECT+EHSI+G RSRL+ G E
Sbjct  368  KFEFYDPKTPFFTSPRYLPPTKSDKSRIKDAIISHGCFLRECTIEHSIVGVRSRLNSGCE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++V I N +GV
Sbjct  428  LKNTMMMGADLYETEDEISRLLSEGKVPIGVGENTKISNCIIDMNARVGRNVSITNSEGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+EG+YIRSGI +I++ ATI DGTVI
Sbjct  488  QEADRPEEGYYIRSGIVVILKNATIKDGTVI  518



>gb|AAC49942.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=518

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPFYTS RFLPPTK+D  +I DAIISHG FLREC ++HSI+G RSRLD GVE
Sbjct  368  KFDFNDPKTPFYTSARFLPPTKVDKSRIVDAIISHGGFLRECNIQHSIVGVRSRLDYGVE  427

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
             KDT+MMGAD Y+TESEIASLLA+G VPIGVG NTKI+  IIDKN +IGKDVVI+NK GV
Sbjct  428  FKDTMMMGADYYQTESEIASLLAEGKVPIGVGPNTKIQKCIIDKNAKIGKDVVILNKQGV  487

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR  EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  488  EEADRSAEGFYIRSGITVIMKNATIKDGTVI  518



>ref|XP_002440313.1| hypothetical protein SORBIDRAFT_09g029610 [Sorghum bicolor]
 gb|EES18743.1| hypothetical protein SORBIDRAFT_09g029610 [Sorghum bicolor]
Length=519

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLREC +EHSI+G RSRL+ G E
Sbjct  369  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++V I N +GV
Sbjct  429  LKNTMMMGADLYETEDEISRLLSEGKVPIGVGENTKISNCIIDMNARVGRNVSITNTEGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP+ G+YIRSGI +I++ ATI DGTVI
Sbjct  489  QEADRPELGYYIRSGIVVILKNATIKDGTVI  519



>ref|XP_006491439.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like [Citrus sinensis]
Length=526

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP+ P +TSPRFLPP+KI+ C+++D+IISHGCFLREC+VEHSI+G RSRL+ GVE
Sbjct  376  KFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE+EIA+LLA+G VP+G+G +TKI+N IIDKN +IGK+V+I NKDGV
Sbjct  436  LKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP +GFYIRSGIT++++  TI DGT+I
Sbjct  496  EEAERPSDGFYIRSGITVVLKNTTIKDGTII  526



>ref|XP_006444661.1| hypothetical protein CICLE_v10023395mg [Citrus clementina]
 gb|ESR57901.1| hypothetical protein CICLE_v10023395mg [Citrus clementina]
Length=526

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP+ P +TSPRFLPP+KI+ C+++D+IISHGCFLREC+VEHSI+G RSRL+ GVE
Sbjct  376  KFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE+EIA+LLA+G VP+G+G +TKI+N IIDKN +IGK+V+I NKDGV
Sbjct  436  LKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP +GFYIRSGIT++++  TI DGT+I
Sbjct  496  EEAERPSDGFYIRSGITVVLKNTTIKDGTII  526



>gb|KDO86722.1| hypothetical protein CISIN_1g043870mg [Citrus sinensis]
Length=526

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP+ P +TSPRFLPP+KI+ C+++D+IISHGCFLREC+VEHSI+G RSRL+ GVE
Sbjct  376  KFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVE  435

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE+EIA+LLA+G VP+G+G +TKI+N IIDKN +IGK+V+I NKDGV
Sbjct  436  LKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGV  495

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP +GFYIRSGIT++++  TI DGT+I
Sbjct  496  EEAERPSDGFYIRSGITVVLKNTTIKDGTII  526



>ref|XP_003567817.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Brachypodium distachyon]
 ref|XP_010230974.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Brachypodium distachyon]
Length=522

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLRECT+EHSI+G RSRL+ G E
Sbjct  372  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECTIEHSIVGVRSRLNSGCE  431

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+ +MMGAD YETE EI+ LL++G VPIGVGEN KI N IID N RIG+DV+I N +GV
Sbjct  432  LKNAMMMGADLYETEDEISRLLSEGKVPIGVGENAKISNCIIDMNARIGRDVIIANSEGV  491

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DR +EG+YIRSGI +I++ ATI DGTV+
Sbjct  492  EEADRAEEGYYIRSGIVVILKNATIKDGTVV  522



>dbj|BAA23490.1| ADP glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
Length=519

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK D C+IKDAIISHGC LRECT+ HSI+G RSRL+   E
Sbjct  369  KFEFYDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCLLRECTIGHSIVGVRSRLNSACE  428

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++VVI N +GV
Sbjct  429  LKNTMMMGADLYETEDEISRLLSEGKVPIGVGENTKINNCIIDMNARVGRNVVITNSEGV  488

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QESDRP+EG+YIRSGI +I++ ATI DG VI
Sbjct  489  QESDRPEEGYYIRSGIVVILKNATIKDGKVI  519



>gb|AFO84073.1| ADP glucose pyrophosphorylase [Actinidia deliciosa]
Length=520

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+F DPKTPF TSPRFLPPTK++ C+I DAIISHGCFL EC ++HSI+G RSRL+ GV+
Sbjct  370  KFDFNDPKTPFCTSPRFLPPTKMEKCRIVDAIISHGCFLHECNIKHSIVGVRSRLETGVK  429

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD+Y+TE+EIAS LA G VPIGVG NT IRN IID N +IG+DVVI NKDGV
Sbjct  430  LQDTMMMGADDYQTEAEIASHLAWGKVPIGVGRNTNIRNCIIDMNAKIGRDVVIANKDGV  489

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP+EGFYIRSGIT++++ ATI DGT+I
Sbjct  490  EEADRPEEGFYIRSGITVVLKNATIKDGTII  520



>ref|XP_009113739.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
 ref|XP_009113740.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
 ref|XP_009113742.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
Length=543

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 137/177 (77%), Gaps = 26/177 (15%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  367  KFQFYDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRVESGVE  426

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKI-----------------------  467
            L+DT+MMGAD Y+TE+EIASLLA+G VPIGVGENTKI                       
Sbjct  427  LQDTMMMGADFYQTEAEIASLLAEGKVPIGVGENTKIRYLIPNKAESSVVAIHCLTSVVL  486

Query  466  ---RNAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
               RN IIDKN +IGK+VVI N DGV+E DRP+EGFYIRSGIT++++ ATI DG V+
Sbjct  487  FKCRNCIIDKNAKIGKNVVIANADGVEEGDRPEEGFYIRSGITVVLKNATIRDGLVL  543



>gb|AEV40474.1| ADP-glucose pyrophosphorylase 3 [Spirodela polyrhiza]
 gb|AEV40475.1| ADP-glucose pyrophosphorylase 3 [Spirodela polyrhiza]
Length=539

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+FYDP+TPFYTSPR+LPPTK+D CKI D+I+SHGCFL  C+++HSI+G+RSRL+ GV+
Sbjct  389  RFQFYDPRTPFYTSPRYLPPTKMDKCKIVDSIVSHGCFLDHCSIQHSIVGDRSRLEYGVQ  448

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD ++MGADNY+TE+E A+LLA+G VPIG+G++T+I+N I+DKN RIG+DVVI N  GV
Sbjct  449  LKDAIVMGADNYQTEAERAALLAEGKVPIGIGQHTRIQNCIVDKNARIGRDVVIANTAGV  508

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP EGFY+RSGI ++++ +TI DGTVI
Sbjct  509  QEADRPSEGFYVRSGIVVLLKNSTIKDGTVI  539



>gb|AGT17354.1| ADP-glucose pyrophosphorylase [Saccharum hybrid cultivar R570]
Length=490

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYDPKTPF+TSPR+LPPTK + C+IKDAIISHGCFLREC +EHSI+G RSRL+ G E
Sbjct  340  KFEFYDPKTPFFTSPRYLPPTKSEKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCE  399

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LK+T+MMGAD YETE EI+ LL++  VPIGVGENTKI N IID N R+G++V I N +GV
Sbjct  400  LKNTMMMGADLYETEDEISRLLSECKVPIGVGENTKISNCIIDMNARVGRNVSITNTEGV  459

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+DRP++G+YIRSG+ +I++ ATI DGTVI
Sbjct  460  QEADRPEQGYYIRSGVVVILKNATIKDGTVI  490



>gb|KCW46725.1| hypothetical protein EUGRSUZ_K00547 [Eucalyptus grandis]
Length=445

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP+ P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  295  KFHFYDPQKPIFTSPRFLPPTKIEKCQVIDSIISHGCFLRECSVQHSIVGVRSRLEYGVE  354

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KDT+MMGAD Y+TE+E A+ LA+G VPIGVG +TKIRN IIDKN RIGK+VVI+NK  V
Sbjct  355  IKDTMMMGADYYQTEAERAAFLAEGQVPIGVGRDTKIRNCIIDKNARIGKNVVIVNKGNV  414

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
             E+DRP +GFYIRSGIT+I++ + IPDGT I
Sbjct  415  TEADRPSDGFYIRSGITVILKNSVIPDGTTI  445



>ref|XP_003545270.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Glycine max]
Length=523

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            FEFYD ++PF+TSPRFLPPTK   CKI DAIISHGCFL EC V+HSI+G RSRL+ G EL
Sbjct  374  FEFYDQESPFFTSPRFLPPTKAIKCKIVDAIISHGCFLSECRVQHSIVGVRSRLESGSEL  433

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+T+SEIA+LL +G VPIGVGENTKIRN IIDKN RIG++V+I N DGVQ
Sbjct  434  QDTMMMGADYYQTDSEIATLLKEGKVPIGVGENTKIRNCIIDKNARIGRNVIIANTDGVQ  493

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP EGFYIRSGI ++   ATI DGTVI
Sbjct  494  EADRPMEGFYIRSGIVVVANNATIEDGTVI  523



>gb|KHN20962.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=523

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            FEFYD ++PF+TSPRFLPPTK   CKI DAIISHGCFL EC V+HSI+G RSRL+ G EL
Sbjct  374  FEFYDQESPFFTSPRFLPPTKAIKCKIVDAIISHGCFLSECRVQHSIVGVRSRLESGSEL  433

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+T+SEIA+LL +G VPIGVGENTKIRN IIDKN RIG++V+I N DGVQ
Sbjct  434  QDTMMMGADYYQTDSEIATLLKEGKVPIGVGENTKIRNCIIDKNARIGRNVIIANTDGVQ  493

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP EGFYIRSGI ++   ATI DGTVI
Sbjct  494  EADRPMEGFYIRSGIVVVANNATIEDGTVI  523



>emb|CDX84911.1| BnaC05g21440D [Brassica napus]
Length=510

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 132/151 (87%), Gaps = 5/151 (3%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTKI      D+I+SHGCFLREC+V+HSI+G RSR++ GVE
Sbjct  365  KFQFYDPKTPFFTSPRFLPPTKI-----LDSIVSHGCFLRECSVQHSIVGIRSRVESGVE  419

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L+DT+MMGAD Y+TE+EIASLLA+G VPIGVGENTKIRN IIDKN +IGK+VVI N DGV
Sbjct  420  LQDTMMMGADFYQTEAEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGKNVVIANADGV  479

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E DR +EGFYIRSGIT++++ ATI DG V+
Sbjct  480  EEGDRQEEGFYIRSGITVVLKNATIRDGLVL  510



>ref|XP_004289659.1| PREDICTED: LOW QUALITY PROTEIN: glucose-1-phosphate adenylyltransferase 
large subunit 1-like [Fragaria vesca subsp. vesca]
Length=507

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF+FYDPKTPF+TSPRFLPPTKIDN ++ DAIISHGCFL+EC V+ SI+GERSRLD GVE
Sbjct  365  KFQFYDPKTPFFTSPRFLPPTKIDNSRVVDAIISHGCFLQECLVQSSIVGERSRLDYGVE  424

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKD++MMGAD+Y+TESEIA+LLA G VPIG+G NTKIR  IIDKN +IGKDV+IMNKDGV
Sbjct  425  LKDSIMMGADSYQTESEIAALLARGKVPIGIGRNTKIRKCIIDKNAKIGKDVIIMNKDGV  484

Query  397  QESDRPDEGFYIR  359
            QE+DRPDEGFYIR
Sbjct  485  QEADRPDEGFYIR  497



>ref|XP_002515141.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF47125.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=528

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            +F+F+DP  P +TSPRFLPPTKI+ C++KD+IISHGCFLREC+VEHSI+G RSRL+ GVE
Sbjct  378  EFQFFDPLKPIFTSPRFLPPTKIERCQVKDSIISHGCFLRECSVEHSIVGVRSRLEYGVE  437

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE+E+A+ LA G VPIGVG+ TKI N IIDKN RIGK+VVI NKD V
Sbjct  438  LKDTMMMGADYYQTEAEVAASLAGGKVPIGVGQETKIMNCIIDKNARIGKNVVIANKDHV  497

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP EGFYIRSGIT++++ + I DGT+I
Sbjct  498  EEADRPSEGFYIRSGITVVLKNSEIKDGTII  528



>emb|CBI37074.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP  P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+VEHSI+G RSRLD GVE
Sbjct  326  KFHFYDPLKPIFTSPRFLPPTKIEKCRVMDSIISHGCFLRECSVEHSIVGIRSRLDYGVE  385

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KDT+MMGAD Y+TE EIA+ LA+G VPIGVG+ TKI N IIDKN RIGK+VVI NKD V
Sbjct  386  MKDTMMMGADYYQTEEEIAAFLAEGKVPIGVGKGTKIMNCIIDKNARIGKNVVITNKDKV  445

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP EGFYIRSGIT++++ + I D T+I
Sbjct  446  EEADRPSEGFYIRSGITVVLKNSVIMDETII  476



>ref|XP_010035362.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
Length=524

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP+ P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  374  KFHFYDPQKPIFTSPRFLPPTKIEKCQVIDSIISHGCFLRECSVQHSIVGVRSRLEYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KDT+MMGAD Y+TE+E A+ LA+G VPIGVG +TKIRN IIDKN RIGK+VVI+NK  V
Sbjct  434  IKDTMMMGADYYQTEAERAAFLAEGQVPIGVGRDTKIRNCIIDKNARIGKNVVIVNKGNV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
             E+DRP +GFYIRSGIT+I++ + IPDGT I
Sbjct  494  TEADRPSDGFYIRSGITVILKNSVIPDGTTI  524



>ref|XP_003549440.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Glycine max]
Length=524

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            FEFYD +TPF+TSPRFLPPTK   CKI DAIISHGCFL E  V+HSI+G RSRL+ G EL
Sbjct  375  FEFYDQETPFFTSPRFLPPTKAIKCKIMDAIISHGCFLSESRVQHSIVGVRSRLESGSEL  434

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+T+SEIA+LL +G VPIGVGENT+IRN IIDKN RIG++V+I N DGVQ
Sbjct  435  QDTMMMGADYYQTDSEIATLLEEGKVPIGVGENTRIRNCIIDKNARIGRNVIIANTDGVQ  494

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP EGFYIRSGI ++++ ATI DGTVI
Sbjct  495  EADRPAEGFYIRSGIVVVVKNATIEDGTVI  524



>ref|XP_002994500.1| hypothetical protein SELMODRAFT_138695, partial [Selaginella 
moellendorffii]
 gb|EFJ04435.1| hypothetical protein SELMODRAFT_138695, partial [Selaginella 
moellendorffii]
Length=447

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYD   P YTSPR+LPPTKI+ C++ D+I+SHGCFL+EC+V HS+IG RSR++ G E
Sbjct  297  KFRFYDAAKPIYTSPRYLPPTKIEKCRVLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAE  356

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            ++DT+M+GAD YETE+EIAS++A+G VP+GVG+N KIRN I+DKNVRIGK+VVI NKD V
Sbjct  357  IQDTMMLGADFYETEAEIASMVAEGKVPVGVGQNAKIRNCILDKNVRIGKNVVIANKDNV  416

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+++P EG+YIRSGIT+I++ ATI DGTVI
Sbjct  417  QEAEKPSEGYYIRSGITVILKNATIADGTVI  447



>ref|XP_006841529.1| hypothetical protein AMTR_s00003p00152830 [Amborella trichopoda]
 gb|ERN03204.1| hypothetical protein AMTR_s00003p00152830 [Amborella trichopoda]
Length=531

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP  P +TSPRFLPP+K++ C++ DAI+SHGCFLREC+V+H+I+G RSRL+ GVE
Sbjct  381  KFHFYDPLKPIFTSPRFLPPSKMEKCQVVDAIVSHGCFLRECSVQHAIVGIRSRLEYGVE  440

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE+EIA+ LA G VPIGVG+NTKIR  IIDKN +IGK+V+I N+D V
Sbjct  441  LKDTMMMGADYYQTEAEIAACLARGEVPIGVGQNTKIRKCIIDKNAKIGKNVIISNRDDV  500

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE++RP EGFYIRSGIT++++ ATI DGTVI
Sbjct  501  QEAERPTEGFYIRSGITVVLKNATIEDGTVI  531



>ref|XP_010652349.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X2 [Vitis vinifera]
Length=486

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP  P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+VEHSI+G RSRLD GVE
Sbjct  336  KFHFYDPLKPIFTSPRFLPPTKIEKCRVMDSIISHGCFLRECSVEHSIVGIRSRLDYGVE  395

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KDT+MMGAD Y+TE EIA+ LA+G VPIGVG+ TKI N IIDKN RIGK+VVI NKD V
Sbjct  396  MKDTMMMGADYYQTEEEIAAFLAEGKVPIGVGKGTKIMNCIIDKNARIGKNVVITNKDKV  455

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP EGFYIRSGIT++++ + I D T+I
Sbjct  456  EEADRPSEGFYIRSGITVVLKNSVIMDETII  486



>ref|XP_002970384.1| hypothetical protein SELMODRAFT_231637 [Selaginella moellendorffii]
 gb|EFJ28514.1| hypothetical protein SELMODRAFT_231637 [Selaginella moellendorffii]
Length=460

 Score =   231 bits (588),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYD   P YTSPR+LPPTKI+ C++ D+I+SHGCFL+EC+V HS+IG RSR++ G E
Sbjct  310  KFRFYDAAKPIYTSPRYLPPTKIEKCRVLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAE  369

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            ++DT+M+GAD YETE+EIAS++A+G VP+GVG+N KIRN I+DKNVRIGK+VVI NKD V
Sbjct  370  IQDTMMLGADFYETEAEIASMVAEGKVPVGVGQNAKIRNCILDKNVRIGKNVVIANKDNV  429

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+++P EG+YIRSGIT+I++ ATI DGTVI
Sbjct  430  QEAEKPSEGYYIRSGITVILKNATIADGTVI  460



>gb|KHN12692.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=524

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            FEFYD ++PF+TSPRFLPPTK   CKI DAIISHGCFL E  V+HSI+G RSRL+ G EL
Sbjct  375  FEFYDQESPFFTSPRFLPPTKAIKCKIMDAIISHGCFLSESRVQHSIVGVRSRLESGSEL  434

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            +DT+MMGAD Y+T+SEIA+LL +G VPIGVGENT+IRN IIDKN RIG++V+I N DGVQ
Sbjct  435  QDTMMMGADYYQTDSEIATLLEEGKVPIGVGENTRIRNCIIDKNARIGRNVIIANTDGVQ  494

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP EGFYIRSGI ++++ ATI DGTVI
Sbjct  495  EADRPAEGFYIRSGIVVVVKNATIEDGTVI  524



>ref|XP_002274245.2| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Vitis vinifera]
 ref|XP_010652348.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Vitis vinifera]
Length=514

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP  P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+VEHSI+G RSRLD GVE
Sbjct  364  KFHFYDPLKPIFTSPRFLPPTKIEKCRVMDSIISHGCFLRECSVEHSIVGIRSRLDYGVE  423

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KDT+MMGAD Y+TE EIA+ LA+G VPIGVG+ TKI N IIDKN RIGK+VVI NKD V
Sbjct  424  MKDTMMMGADYYQTEEEIAAFLAEGKVPIGVGKGTKIMNCIIDKNARIGKNVVITNKDKV  483

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP EGFYIRSGIT++++ + I D T+I
Sbjct  484  EEADRPSEGFYIRSGITVVLKNSVIMDETII  514



>gb|AEV40472.1| ADP-glucose pyrophosphorylase 2 [Spirodela polyrhiza]
 gb|AEV40473.1| ADP-glucose pyrophosphorylase 2 [Spirodela polyrhiza]
Length=536

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP  P +TSPRFLPPTKI+ C++ ++I+SHGCFL ECTVEHSIIG RSRL+ G E
Sbjct  386  KFHFYDPSKPIFTSPRFLPPTKIEKCRVLNSIVSHGCFLNECTVEHSIIGVRSRLESGAE  445

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            L DT++MGAD Y+TE+EIAS+LA+G VPIG+G NTKIRN IIDKN +IG+DVVI N + V
Sbjct  446  LVDTMVMGADYYQTEAEIASILAEGKVPIGIGRNTKIRNCIIDKNAKIGRDVVIANSEKV  505

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E++RP EGFYIRSGIT++++ ATIP+GTVI
Sbjct  506  EEAERPSEGFYIRSGITVVVKNATIPNGTVI  536



>ref|XP_008799957.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Phoenix dactylifera]
 ref|XP_008799959.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Phoenix dactylifera]
Length=536

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF F+DPK P +TSPRFLPPTKI+ C++ D+IISHGCFL +C+V+HSI+G RSRL+ G E
Sbjct  386  KFHFHDPKKPIFTSPRFLPPTKIEKCRVVDSIISHGCFLTQCSVKHSIVGVRSRLEYGAE  445

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE+E AS LA+G VP+GVGENT+IRN IIDKN RIGKDV+I N D V
Sbjct  446  LKDTMMMGADYYQTEAERASFLAEGKVPVGVGENTRIRNCIIDKNARIGKDVIIANADNV  505

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+D+P +GFYIRSGIT++++ + IPDGT+I
Sbjct  506  EEADKPSDGFYIRSGITVVLKNSVIPDGTII  536



>ref|XP_002968152.1| hypothetical protein SELMODRAFT_169778 [Selaginella moellendorffii]
 gb|EFJ30406.1| hypothetical protein SELMODRAFT_169778 [Selaginella moellendorffii]
Length=463

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYD   P YTSPR+LPPTKI+ C++ D+I+SHGCFL+EC+V HS+IG RSR++ G E
Sbjct  313  KFRFYDAAKPIYTSPRYLPPTKIEKCRVLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAE  372

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            ++DT+M+GAD YETE+EIAS++A+G VP+GVG+N KIRN I+DKNVRIGK+VVI NKD V
Sbjct  373  IQDTMMLGADFYETEAEIASMVAEGKVPVGVGQNAKIRNCILDKNVRIGKNVVIANKDNV  432

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+++P EG+YIRSGIT+I++ ATI DGTVI
Sbjct  433  QEAEKPSEGYYIRSGITVILKNATIADGTVI  463



>emb|CAN67125.1| hypothetical protein VITISV_040166 [Vitis vinifera]
Length=452

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP  P +TS RFLPPTKI+ C++ D+IISHGCFLREC+VEHSI+G RSRLD GVE
Sbjct  302  KFHFYDPLKPIFTSSRFLPPTKIEKCRVMDSIISHGCFLRECSVEHSIVGIRSRLDYGVE  361

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            +KDT+MMGAD Y+TE EIA+ LA+G VPIGVG++TKI N IIDKN RIGK+VVI NKD V
Sbjct  362  MKDTMMMGADYYQTEEEIAAFLAEGKVPIGVGKDTKIMNCIIDKNARIGKNVVITNKDKV  421

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP EGFYIRSGIT++++ + I D T+I
Sbjct  422  EEADRPSEGFYIRSGITVVLKNSVIMDETII  452



>gb|KJB09550.1| hypothetical protein B456_001G149300 [Gossypium raimondii]
 gb|KJB09551.1| hypothetical protein B456_001G149300 [Gossypium raimondii]
Length=524

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF FYDP  P +TSPR+LPP++I+ C++ D+IISHGCFLREC+V+HSI+G RSRL+ GVE
Sbjct  374  KFHFYDPLKPIFTSPRYLPPSRIEQCRVVDSIISHGCFLRECSVKHSIVGIRSRLEYGVE  433

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDTLMMGAD+Y+TE+EIAS +++GN+P+G+G NTKI N IID N RIGK+VVI NKD V
Sbjct  434  LKDTLMMGADHYQTEAEIASCISEGNIPLGIGRNTKIMNCIIDTNTRIGKNVVIANKDNV  493

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+DRP EGFYIRSGIT++++ A I DGT+I
Sbjct  494  EEADRPSEGFYIRSGITVVVKNAVIKDGTII  524



>ref|XP_006658430.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like, partial [Oryza brachyantha]
Length=426

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDP  P +TSP+FLPPTK++NCK+ ++I+SHGCFL EC+VEHS+IG RSRL+ GV+L
Sbjct  277  FYFYDPVKPIFTSPKFLPPTKVENCKVVNSIVSHGCFLTECSVEHSVIGVRSRLEPGVQL  336

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+MMGAD Y+TE+E  S L+DG VPIG+GENTKIRN IIDKN RIGK+V+I N + VQ
Sbjct  337  KDTMMMGADYYQTEAERFSELSDGKVPIGLGENTKIRNCIIDKNARIGKNVLITNSENVQ  396

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E++RP EGFYIRSGIT+I++ A IPDGTVI
Sbjct  397  EAERPLEGFYIRSGITVILKNAVIPDGTVI  426



>ref|XP_010914841.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Elaeis guineensis]
Length=537

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF F+DPK P +TSPRFLPPTKI+ C++ D+IISHGCFL +C++EHSI+G RSRL+ GVE
Sbjct  387  KFHFHDPKKPIFTSPRFLPPTKIEQCRVVDSIISHGCFLTQCSIEHSIVGVRSRLEYGVE  446

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMGAD Y+TE+E AS LA+G VP+GVGEN+KIRN IIDKN RIGK V+I N D V
Sbjct  447  LKDTMMMGADYYQTEAERASFLAEGKVPVGVGENSKIRNCIIDKNGRIGKSVIIANADNV  506

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            +E+D+P +GFYIRSGIT++++ + IPDGT+I
Sbjct  507  EEADKPTDGFYIRSGITVVLKNSVIPDGTII  537



>ref|XP_011039886.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011039894.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011039900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=530

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F F+DP  P +TSPRFLPPTKI+ C++KD+I+SHGCFLREC+VEHSI+G RSRL+ GVEL
Sbjct  381  FHFFDPLKPIFTSPRFLPPTKIEKCRVKDSIVSHGCFLRECSVEHSIVGIRSRLEYGVEL  440

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+M+GAD Y+TE+EIA+ LA+G VP+GVG++TKI N IIDKN RIGK V I NK+GVQ
Sbjct  441  KDTMMIGADYYQTEAEIAASLAEGRVPVGVGKDTKIMNCIIDKNARIGKKVTIANKEGVQ  500

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E++RP EGFYIRSGIT++++ + I DGT+I
Sbjct  501  EAERPSEGFYIRSGITVVLKNSVIKDGTII  530



>ref|XP_004959119.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like [Setaria italica]
Length=652

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -1

Query  754  FEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVEL  575
            F FYDP  P +TSPRFLPPT+++NCK+ ++I+SHGCFL EC+VEHS+IG RSRL+ GV+L
Sbjct  503  FYFYDPVKPIFTSPRFLPPTRVENCKVLNSIVSHGCFLTECSVEHSVIGIRSRLEQGVQL  562

Query  574  KDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ  395
            KDT+MMGAD Y+TE+E  S L+DG VP+GVGENT IRN IIDKN RIGK+VVIMN D VQ
Sbjct  563  KDTMMMGADYYQTEAERCSELSDGKVPVGVGENTIIRNCIIDKNARIGKNVVIMNSDNVQ  622

Query  394  ESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            E+DRP EGFYIRSGIT++++ A IPDGT I
Sbjct  623  EADRPAEGFYIRSGITVVLKNAVIPDGTTI  652



>gb|KCW86631.1| hypothetical protein EUGRSUZ_B03259 [Eucalyptus grandis]
Length=286

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 130/167 (78%), Gaps = 16/167 (10%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KFEFYD +TPFYTSPRFLPP+K++ C+I  AIISHGCFL+EC++EHSI+G R RLD  VE
Sbjct  120  KFEFYDLQTPFYTSPRFLPPSKVEKCRIVGAIISHGCFLQECSIEHSIVGVRLRLDYDVE  179

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIR----------------NAIIDK  446
             KDT+MMG+D Y+TE+EIASLLA G VPIGVG+NTKIR                  + +K
Sbjct  180  FKDTVMMGSDYYQTEAEIASLLAQGKVPIGVGQNTKIRIVCNPSTDKFPCFSFLKELHNK  239

Query  445  NVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            N RIGK+VVI N DGVQE+D P+EGFYIRSGIT+I++ ATI DGTV+
Sbjct  240  NARIGKNVVIHNTDGVQEADSPEEGFYIRSGITVILKNATIKDGTVV  286



>gb|KDP28372.1| hypothetical protein JCGZ_14143 [Jatropha curcas]
Length=472

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -1

Query  757  KFEFYDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVE  578
            KF F+DP  P +TSPRFLPPTKI+ C+I+ +IIS GCFLREC+VEHSI+G RSRL+ GVE
Sbjct  322  KFHFFDPLKPIFTSPRFLPPTKIEKCRIQGSIISDGCFLRECSVEHSIVGIRSRLEYGVE  381

Query  577  LKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGV  398
            LKDT+MMG+D YETE+EIAS LA+G VPIGVG+NTKI N IIDKN RIG++VVI NKD V
Sbjct  382  LKDTMMMGSDYYETEAEIASSLAEGKVPIGVGKNTKIINCIIDKNARIGENVVIANKDHV  441

Query  397  QESDRPDEGFYIRSGITIIMEKATIPDGTVI  305
            QE+ RP EGFYIRSGIT++M+ + I DGT+I
Sbjct  442  QEAVRPSEGFYIRSGITVVMKNSVIKDGTII  472



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470