BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046M09

Length=789
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD02268.1|  aspartate aminotransferase                             335   1e-112   Nicotiana tabacum [American tobacco]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    340   5e-111   Nicotiana sylvestris
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    340   5e-111   Solanum tuberosum [potatoes]
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    338   2e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    337   9e-110   Solanum lycopersicum
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     336   1e-109   Solanum tuberosum [potatoes]
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        336   2e-109   Populus trichocarpa [western balsam poplar]
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         334   9e-109   Jatropha curcas
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        334   1e-108   
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    333   3e-108   Populus euphratica
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    332   3e-108   
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    332   7e-108   Populus euphratica
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    332   8e-108   Nelumbo nucifera [Indian lotus]
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             332   9e-108   Citrus clementina [clementine]
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   330   9e-108   Citrus sinensis [apfelsine]
emb|CDP18792.1|  unnamed protein product                                334   1e-107   Coffea canephora [robusta coffee]
dbj|BAD94538.1|  aspartate aminotransferase                             321   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515455.1|  aspartate aminotransferase, putative               329   9e-107   Ricinus communis
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    328   2e-106   Prunus mume [ume]
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    328   2e-106   Malus domestica [apple tree]
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             328   3e-106   Prunus persica
gb|AFK46621.1|  unknown                                                 320   3e-106   Lotus japonicus
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    326   8e-106   Elaeis guineensis
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    325   1e-105   
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    326   1e-105   Vitis vinifera
emb|CAN76227.1|  hypothetical protein VITISV_000267                     326   1e-105   Vitis vinifera
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             325   1e-105   Capsella rubella
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    323   3e-105   Cucumis melo [Oriental melon]
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    324   7e-105   Eucalyptus grandis [rose gum]
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   324   9e-105   Citrus sinensis [apfelsine]
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    324   1e-104   Cucumis melo [Oriental melon]
ref|XP_010089944.1|  Aspartate aminotransferase                         324   1e-104   
gb|ABK24563.1|  unknown                                                 323   1e-104   Picea sitchensis
gb|ACN40845.1|  unknown                                                 323   2e-104   Picea sitchensis
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             323   2e-104   
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    323   2e-104   Cucumis sativus [cucumbers]
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    322   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             322   4e-104   
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    322   5e-104   Brassica rapa
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    322   6e-104   Camelina sativa [gold-of-pleasure]
gb|AAC12674.1|  aspartate aminotransferase                              321   7e-104   Lotus corniculatus
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    322   1e-103   Camelina sativa [gold-of-pleasure]
emb|CDJ26231.1|  putative aspartate aminotransferase                    320   2e-103   Brassica oleracea
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                320   2e-103   Erythranthe guttata [common monkey flower]
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                320   2e-103   Erythranthe guttata [common monkey flower]
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          321   2e-103   Amborella trichopoda
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    320   2e-103   Phoenix dactylifera
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    320   2e-103   Camelina sativa [gold-of-pleasure]
ref|NP_194927.1|  aspartate aminotransferase                            320   3e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CAA56932.1|  aspartate aminotransferase                             320   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190885.1|  aspartate aminotransferase                         319   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             319   8e-103   
emb|CDX75211.1|  BnaA01g04910D                                          318   9e-103   
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    318   1e-102   Brassica rapa
ref|XP_007161154.1|  hypothetical protein PHAVU_001G0470000g            311   1e-102   Phaseolus vulgaris [French bean]
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    318   2e-102   Cicer arietinum [garbanzo]
gb|AAB46611.1|  aspartate aminotransferase                              317   2e-102   Medicago sativa [alfalfa]
emb|CDY13467.1|  BnaA03g51850D                                          317   2e-102   Brassica napus [oilseed rape]
ref|XP_007011759.1|  Aspartate aminotransferase                         318   3e-102   
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    317   3e-102   Glycine max [soybeans]
emb|CDX68807.1|  BnaC01g06460D                                          319   3e-102   
prf||1908424A  Asp aminotransferase                                     317   4e-102
gb|KEH39860.1|  aspartate aminotransferase                              317   4e-102   Medicago truncatula
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    315   5e-102   
gb|AAM67272.1|  aspartate aminotransferase                              316   7e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16448.1|  unknown                                                 315   8e-102   Picea sitchensis
ref|NP_001031767.1|  aspartate aminotransferase                         316   9e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    316   1e-101   Glycine max [soybeans]
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     315   3e-101   Eucalyptus grandis [rose gum]
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    314   5e-101   Fragaria vesca subsp. vesca
gb|AAO23563.1|  aspartate aminotransferase                              312   6e-101   Oryza sativa [red rice]
gb|KJB55008.1|  hypothetical protein B456_009G060500                    311   7e-101   Gossypium raimondii
gb|KJB65890.1|  hypothetical protein B456_010G117400                    313   7e-101   Gossypium raimondii
gb|KJB65891.1|  hypothetical protein B456_010G117400                    313   8e-101   Gossypium raimondii
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   313   9e-101   Panicum miliaceum [broom millet]
emb|CDX72339.1|  BnaC07g43610D                                          313   1e-100   
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    313   1e-100   Phaseolus vulgaris [French bean]
gb|ACU24502.1|  unknown                                                 313   1e-100   Glycine max [soybeans]
ref|NP_001237987.1|  aspartate aminotransferase                         313   2e-100   
gb|KJB55006.1|  hypothetical protein B456_009G060500                    313   2e-100   Gossypium raimondii
ref|NP_001048397.1|  Os02g0797500                                       313   2e-100   
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    311   2e-100   
gb|KJB55007.1|  hypothetical protein B456_009G060500                    313   2e-100   Gossypium raimondii
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    312   5e-100   Gossypium arboreum [tree cotton]
gb|ACR34530.1|  unknown                                                 311   6e-100   Zea mays [maize]
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    311   7e-100   Setaria italica
gb|KJB55009.1|  hypothetical protein B456_009G060500                    312   8e-100   Gossypium raimondii
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    310   2e-99    Lupinus angustifolius
ref|NP_001149005.1|  aspartate aminotransferase                         309   4e-99    
ref|XP_001785888.1|  predicted protein                                  309   6e-99    
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    309   6e-99    Glycine max [soybeans]
dbj|BAJ97030.1|  predicted protein                                      305   9e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               306   1e-97    Triticum urartu
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    305   1e-97    Brachypodium distachyon [annual false brome]
dbj|BAJ92741.1|  predicted protein                                      305   2e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               305   3e-97    
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             302   4e-97    
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             302   5e-97    
dbj|BAJ96638.1|  predicted protein                                      303   8e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  302   3e-96    Canavalia lineata
prf||2009357A  Asp aminotransferase                                     301   6e-96 
gb|ACG59771.1|  chloroplast aspartate aminotransferase                  293   5e-94    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...    287   3e-91    
emb|CAA04697.1|  aspartate aminotransferase 2                           288   9e-91    Canavalia lineata
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...    279   1e-87    Phoenix dactylifera
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            277   1e-86    Glycine soja [wild soybean]
ref|XP_008784800.1|  PREDICTED: aspartate aminotransferase, chlor...    259   2e-80    
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...    259   2e-79    
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...    250   2e-76    Nicotiana tomentosiformis
ref|XP_005642879.1|  aspartate aminotransferase                         245   3e-74    Coccomyxa subellipsoidea C-169
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             244   7e-74    Chlorella variabilis
gb|EPS71467.1|  aspartate aminotransferase                              231   7e-73    Genlisea aurea
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...    239   2e-72    Tarenaya hassleriana [spider flower]
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial       236   9e-72    Auxenochlorella protothecoides
ref|XP_010042868.1|  PREDICTED: aspartate aminotransferase P2, mi...    218   4e-68    Eucalyptus grandis [rose gum]
ref|XP_002501168.1|  aspartate aminotransferase                         222   5e-66    Micromonas commoda
ref|XP_001700039.1|  aspartate aminotransferase                         218   4e-64    Chlamydomonas reinhardtii
tpg|DAA57533.1|  TPA: hypothetical protein ZEAMMB73_000065              211   5e-64    
gb|KIZ05915.1|  aspartate aminotransferase                              214   8e-64    Monoraphidium neglectum
ref|XP_010519716.1|  PREDICTED: aspartate aminotransferase, cytop...    214   1e-63    Tarenaya hassleriana [spider flower]
ref|XP_002514283.1|  aspartate aminotransferase, putative               216   1e-63    
ref|XP_010519717.1|  PREDICTED: aspartate aminotransferase, cytop...    214   4e-63    Tarenaya hassleriana [spider flower]
gb|AAM91546.1|  aspartate aminotransferase Asp2                         208   5e-63    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA57534.1|  TPA: hypothetical protein ZEAMMB73_000065              207   5e-63    
sp|P37833.1|AATC_ORYSJ  RecName: Full=Aspartate aminotransferase,...    214   7e-63    Oryza sativa Japonica Group [Japonica rice]
gb|KDP33689.1|  hypothetical protein JCGZ_07260                         214   1e-62    Jatropha curcas
ref|XP_002950644.1|  aspartate aminotransferase                         214   2e-62    Volvox carteri f. nagariensis
emb|CDX70399.1|  BnaC03g04830D                                          214   2e-62    
ref|XP_006644742.1|  PREDICTED: aspartate aminotransferase, cytop...    214   2e-62    Oryza brachyantha
ref|XP_003064597.1|  aspartate amino transferase                        213   2e-62    Micromonas pusilla CCMP1545
ref|XP_009131210.1|  PREDICTED: aspartate aminotransferase 3, chl...    214   2e-62    Brassica rapa
ref|NP_001044317.1|  Os01g0760600                                       214   2e-62    
ref|XP_011043495.1|  PREDICTED: aspartate aminotransferase, cytop...    213   2e-62    Populus euphratica
ref|XP_007013138.1|  Aspartate aminotransferase, cytoplasmic            212   4e-62    
ref|XP_004970037.1|  PREDICTED: aspartate aminotransferase, cytop...    213   5e-62    Setaria italica
ref|XP_011048396.1|  PREDICTED: aspartate aminotransferase, cytop...    212   5e-62    Populus euphratica
gb|ACU21245.1|  unknown                                                 209   7e-62    Glycine max [soybeans]
emb|CDP03316.1|  unnamed protein product                                211   1e-61    Coffea canephora [robusta coffee]
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640          212   1e-61    Amborella trichopoda
ref|XP_005643912.1|  aspartate aminotransferase                         211   1e-61    Coccomyxa subellipsoidea C-169
ref|XP_006450636.1|  hypothetical protein CICLE_v10008274mg             212   2e-61    Citrus clementina [clementine]
gb|ABY58643.1|  aspartate aminotransferase                              209   2e-61    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008466236.1|  PREDICTED: aspartate aminotransferase, cytop...    212   2e-61    Cucumis melo [Oriental melon]
ref|XP_011019648.1|  PREDICTED: aspartate aminotransferase, cytop...    211   2e-61    Populus euphratica
ref|XP_002308618.1|  aspartate transaminase family protein              211   2e-61    Populus trichocarpa [western balsam poplar]
ref|XP_004136291.1|  PREDICTED: aspartate aminotransferase, chlor...    212   2e-61    Cucumis sativus [cucumbers]
ref|XP_002324997.1|  aspartate aminotransferase family protein          210   2e-61    Populus trichocarpa [western balsam poplar]
ref|XP_006476088.1|  PREDICTED: aspartate aminotransferase 3, chl...    211   2e-61    Citrus sinensis [apfelsine]
emb|CBI20886.3|  unnamed protein product                                210   2e-61    Vitis vinifera
gb|AAC50015.1|  aspartate aminotransferase cytosolic isozyme AAT2       210   2e-61    Glycine max [soybeans]
gb|KDP34208.1|  hypothetical protein JCGZ_07779                         211   3e-61    Jatropha curcas
emb|CDM84293.1|  unnamed protein product                                211   3e-61    Triticum aestivum [Canadian hard winter wheat]
gb|KHG23914.1|  Aspartate aminotransferase, chloroplastic -like p...    211   3e-61    Gossypium arboreum [tree cotton]
gb|KHN10226.1|  Aspartate aminotransferase 1                            210   4e-61    Glycine soja [wild soybean]
emb|CAN70394.1|  hypothetical protein VITISV_020521                     209   4e-61    Vitis vinifera
ref|XP_002284136.1|  PREDICTED: aspartate aminotransferase, cytop...    211   4e-61    Vitis vinifera
gb|KHG24168.1|  Aspartate aminotransferase, cytoplasmic                 209   4e-61    Gossypium arboreum [tree cotton]
ref|XP_002873517.1|  hypothetical protein ARALYDRAFT_487989             210   5e-61    Arabidopsis lyrata subsp. lyrata
ref|XP_007012061.1|  Aspartate aminotransferase 3                       210   5e-61    
ref|XP_010100270.1|  Aspartate aminotransferase                         211   5e-61    Morus notabilis
ref|NP_001237541.1|  aspartate aminotransferase glyoxysomal isozy...    210   6e-61    Glycine max [soybeans]
ref|XP_008789337.1|  PREDICTED: aspartate aminotransferase, cytop...    210   6e-61    Phoenix dactylifera
ref|XP_010420761.1|  PREDICTED: aspartate aminotransferase, cytop...    209   7e-61    Camelina sativa [gold-of-pleasure]
ref|XP_002284313.1|  PREDICTED: aspartate aminotransferase, cytop...    209   7e-61    Vitis vinifera
gb|AEX09182.1|  putative aspartate aminotransferase 1                   209   7e-61    Gossypium hirsutum [American cotton]
ref|XP_002516566.1|  aspartate aminotransferase, putative               209   7e-61    Ricinus communis
ref|XP_010454237.1|  PREDICTED: aspartate aminotransferase, cytop...    209   7e-61    Camelina sativa [gold-of-pleasure]
ref|NP_001141224.1|  uncharacterized protein LOC100273311               210   8e-61    Zea mays [maize]
ref|XP_009395718.1|  PREDICTED: aspartate aminotransferase, cytop...    209   8e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401092.1|  PREDICTED: aspartate aminotransferase, chlor...    205   8e-61    
ref|NP_196713.1|  aspartate aminotransferase 3                          210   8e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001771002.1|  predicted protein                                  208   9e-61    
ref|XP_002871893.1|  hypothetical protein ARALYDRAFT_909992             208   1e-60    Arabidopsis lyrata subsp. lyrata
gb|KJB07521.1|  hypothetical protein B456_001G028100                    209   1e-60    Gossypium raimondii
ref|XP_002954714.1|  aspartate aminotransferase                         209   1e-60    Volvox carteri f. nagariensis
ref|XP_011090162.1|  PREDICTED: aspartate aminotransferase, cytop...    209   1e-60    Sesamum indicum [beniseed]
emb|CDP16161.1|  unnamed protein product                                208   2e-60    Coffea canephora [robusta coffee]
ref|XP_010693429.1|  PREDICTED: aspartate aminotransferase, cytop...    209   2e-60    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...    209   2e-60    Solanum lycopersicum
ref|XP_001695040.1|  aspartate aminotransferase                         208   2e-60    Chlamydomonas reinhardtii
ref|XP_009762342.1|  PREDICTED: aspartate aminotransferase, cytop...    208   2e-60    Nicotiana sylvestris
ref|XP_003569862.1|  PREDICTED: aspartate aminotransferase, cytop...    209   2e-60    Brachypodium distachyon [annual false brome]
gb|EMT25743.1|  Aspartate aminotransferase, cytoplasmic                 207   2e-60    
ref|XP_005843806.1|  hypothetical protein CHLNCDRAFT_59799              207   2e-60    Chlorella variabilis
ref|XP_004501184.1|  PREDICTED: aspartate aminotransferase 1-like       209   2e-60    Cicer arietinum [garbanzo]
ref|XP_006289742.1|  hypothetical protein CARUB_v10003310mg             209   2e-60    Capsella rubella
ref|XP_006287876.1|  hypothetical protein CARUB_v10001103mg             207   2e-60    Capsella rubella
ref|XP_009617506.1|  PREDICTED: aspartate aminotransferase, cytop...    207   2e-60    Nicotiana tomentosiformis
ref|XP_010254083.1|  PREDICTED: aspartate aminotransferase, cytop...    209   3e-60    Nelumbo nucifera [Indian lotus]
gb|AAA79370.1|  aspartate aminotransferase                              207   3e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920378.1|  PREDICTED: aspartate aminotransferase, cytop...    209   3e-60    Elaeis guineensis
gb|KFK25414.1|  aspartate aminotransferase                              208   3e-60    Arabis alpina [alpine rockcress]
ref|XP_010493028.1|  PREDICTED: aspartate aminotransferase, cytop...    207   3e-60    Camelina sativa [gold-of-pleasure]
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...    208   3e-60    Nicotiana tomentosiformis
ref|XP_011078312.1|  PREDICTED: aspartate aminotransferase, cytop...    207   4e-60    Sesamum indicum [beniseed]
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...    208   4e-60    Solanum tuberosum [potatoes]
ref|NP_197456.1|  aspartate aminotransferase                            207   4e-60    Arabidopsis thaliana [mouse-ear cress]
gb|AEX09183.1|  putative aspartate aminotransferase 2                   208   4e-60    Gossypium hirsutum [American cotton]
ref|XP_006451184.1|  hypothetical protein CICLE_v10008489mg             207   4e-60    Citrus clementina [clementine]
ref|XP_006399658.1|  hypothetical protein EUTSA_v10013515mg             208   5e-60    Eutrema salsugineum [saltwater cress]
ref|XP_010250350.1|  PREDICTED: aspartate aminotransferase, cytop...    208   5e-60    
emb|CAA45023.1|  aspartate aminotransferase                             207   5e-60    Panicum miliaceum [broom millet]
gb|KJB64944.1|  hypothetical protein B456_010G072900                    206   5e-60    Gossypium raimondii
ref|XP_009410920.1|  PREDICTED: aspartate aminotransferase, cytop...    208   5e-60    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL09704.1|AF419301_1  aspartate aminotransferase                    204   6e-60    Securigera parviflora
ref|XP_010688229.1|  PREDICTED: aspartate aminotransferase, cytop...    206   6e-60    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...    207   7e-60    Nicotiana sylvestris
ref|XP_006476087.1|  PREDICTED: aspartate aminotransferase 3, chl...    207   8e-60    Citrus sinensis [apfelsine]
ref|XP_010491885.1|  PREDICTED: aspartate aminotransferase 3, chl...    207   1e-59    Camelina sativa [gold-of-pleasure]
ref|XP_010419724.1|  PREDICTED: aspartate aminotransferase 3, chl...    207   1e-59    Camelina sativa [gold-of-pleasure]
ref|XP_010453196.1|  PREDICTED: aspartate aminotransferase 3, chl...    207   1e-59    Camelina sativa [gold-of-pleasure]
gb|KCW81535.1|  hypothetical protein EUGRSUZ_C02894                     207   1e-59    Eucalyptus grandis [rose gum]
ref|XP_008378104.1|  PREDICTED: aspartate aminotransferase, cytop...    206   1e-59    Malus domestica [apple tree]
ref|XP_010532471.1|  PREDICTED: aspartate aminotransferase 3, chl...    206   2e-59    Tarenaya hassleriana [spider flower]
ref|XP_008220042.1|  PREDICTED: aspartate aminotransferase, cytop...    206   2e-59    Prunus mume [ume]
sp|P28734.1|AATC_DAUCA  RecName: Full=Aspartate aminotransferase,...    205   2e-59    Daucus carota [carrots]
ref|XP_008361035.1|  PREDICTED: aspartate aminotransferase, cytop...    206   2e-59    
ref|XP_008352022.1|  PREDICTED: aspartate aminotransferase, cytop...    206   2e-59    
gb|KFK26196.1|  hypothetical protein AALP_AA8G215200                    204   3e-59    Arabis alpina [alpine rockcress]
ref|XP_009120876.1|  PREDICTED: aspartate aminotransferase, cytop...    204   4e-59    Brassica rapa
emb|CDX92520.1|  BnaA10g15590D                                          204   4e-59    
emb|CDY65959.1|  BnaC09g54080D                                          204   4e-59    Brassica napus [oilseed rape]
ref|XP_010048107.1|  PREDICTED: aspartate aminotransferase, cytop...    204   4e-59    Eucalyptus grandis [rose gum]
ref|XP_007222958.1|  hypothetical protein PRUPE_ppa005315mg             205   6e-59    Prunus persica
gb|AAA50160.1|  aspartate aminotransferase P1                           204   6e-59    Lupinus angustifolius
ref|XP_009367911.1|  PREDICTED: aspartate aminotransferase, cytop...    205   6e-59    Pyrus x bretschneideri [bai li]
gb|AAA33408.1|  aspartate aminotransferase P1                           204   7e-59    Lupinus angustifolius
ref|XP_006400515.1|  hypothetical protein EUTSA_v10013703mg             203   9e-59    Eutrema salsugineum [saltwater cress]
emb|CDY44925.1|  BnaA02g04300D                                          203   9e-59    Brassica napus [oilseed rape]
ref|XP_006352160.1|  PREDICTED: aspartate aminotransferase, cytop...    203   1e-58    Solanum tuberosum [potatoes]
ref|XP_004291203.1|  PREDICTED: aspartate aminotransferase, cytop...    204   1e-58    Fragaria vesca subsp. vesca
ref|XP_009367910.1|  PREDICTED: aspartate aminotransferase, cytop...    204   1e-58    Pyrus x bretschneideri [bai li]
ref|XP_004243159.1|  PREDICTED: aspartate aminotransferase, cytop...    202   1e-58    
gb|AFK40370.1|  unknown                                                 203   2e-58    Medicago truncatula
emb|CDY71396.1|  BnaCnng72730D                                          197   2e-58    Brassica napus [oilseed rape]
ref|XP_002989786.1|  hypothetical protein SELMODRAFT_184818             202   3e-58    
emb|CAA43779.1|  aspartate aminotransferase                             202   3e-58    Medicago sativa [alfalfa]
gb|KEH36022.1|  aspartate aminotransferase                              202   3e-58    Medicago truncatula
ref|XP_010049084.1|  PREDICTED: aspartate aminotransferase, cytop...    206   4e-58    
gb|EYU29270.1|  hypothetical protein MIMGU_mgv1a006139mg                202   5e-58    Erythranthe guttata [common monkey flower]
gb|KJB07520.1|  hypothetical protein B456_001G028000                    199   6e-58    Gossypium raimondii
ref|XP_002990136.1|  hypothetical protein SELMODRAFT_235954             201   7e-58    
emb|CDY42276.1|  BnaC02g08820D                                          201   7e-58    Brassica napus [oilseed rape]
gb|KEH36020.1|  aspartate aminotransferase                              202   7e-58    Medicago truncatula
gb|KJB64945.1|  hypothetical protein B456_010G072900                    200   2e-57    Gossypium raimondii
sp|P28011.2|AAT1_MEDSA  RecName: Full=Aspartate aminotransferase ...    199   4e-57    Medicago sativa [alfalfa]
gb|KJB07518.1|  hypothetical protein B456_001G028000                    199   4e-57    Gossypium raimondii
emb|CAA63894.1|  aspartate aminotransferase                             199   4e-57    Lotus japonicus
gb|KHG23915.1|  Aspartate aminotransferase, cytoplasmic                 199   4e-57    Gossypium arboreum [tree cotton]
ref|XP_002308617.2|  hypothetical protein POPTR_0006s25820g             200   8e-57    
gb|ABR16105.1|  unknown                                                 199   9e-57    Picea sitchensis
ref|XP_010048111.1|  PREDICTED: aspartate aminotransferase, cytop...    197   9e-57    
ref|XP_009126373.1|  PREDICTED: aspartate aminotransferase, cytop...    198   9e-57    Brassica rapa
gb|ACN40894.1|  unknown                                                 198   2e-56    Picea sitchensis
ref|XP_010048110.1|  PREDICTED: aspartate aminotransferase, cytop...    197   3e-56    Eucalyptus grandis [rose gum]
ref|XP_011019649.1|  PREDICTED: aspartate aminotransferase, cytop...    196   5e-56    Populus euphratica
gb|KCW80240.1|  hypothetical protein EUGRSUZ_C01585                     196   8e-56    Eucalyptus grandis [rose gum]
dbj|BAE99790.1|  aspartate aminotransferase                             190   1e-55    Arabidopsis thaliana [mouse-ear cress]
emb|CDS12997.1|  Putative Aspartate aminotransferase                    194   3e-55    Lichtheimia ramosa
emb|CBK20182.2|  unnamed protein product                                195   4e-55    Blastocystis hominis
ref|XP_009112705.1|  PREDICTED: aspartate aminotransferase, cytop...    194   4e-55    Brassica rapa
gb|KIL70778.1|  hypothetical protein M378DRAFT_183367                   194   5e-55    Amanita muscaria Koide BX008
emb|CDH50946.1|  aspartate aminotransferase                             193   1e-54    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007012062.1|  Aspartate aminotransferase 3, putative             196   1e-54    
emb|CDY39814.1|  BnaA09g10660D                                          192   2e-54    Brassica napus [oilseed rape]
ref|XP_010473503.1|  PREDICTED: aspartate aminotransferase, cytop...    191   4e-54    Camelina sativa [gold-of-pleasure]
ref|XP_004339901.1|  aspartate aminotransferase, putative               192   4e-54    Acanthamoeba castellanii str. Neff
emb|CDY34689.1|  BnaC04g19940D                                          192   4e-54    Brassica napus [oilseed rape]
ref|XP_005842469.1|  hypothetical protein GUITHDRAFT_83779              191   4e-54    Guillardia theta CCMP2712
ref|XP_007004780.1|  hypothetical protein TREMEDRAFT_68635              191   5e-54    Tremella mesenterica DSM 1558
ref|XP_011401594.1|  Aspartate aminotransferase 1                       191   6e-54    Auxenochlorella protothecoides
ref|XP_004340638.1|  aspartate aminotransferase, cytoplasmic, put...    191   6e-54    Acanthamoeba castellanii str. Neff
ref|XP_006476085.1|  PREDICTED: aspartate aminotransferase, cytop...    191   8e-54    Citrus sinensis [apfelsine]
ref|XP_002516565.1|  aspartate aminotransferase, putative               190   1e-53    
ref|XP_009113043.1|  PREDICTED: aspartate aminotransferase, cytop...    189   1e-53    Brassica rapa
ref|NP_849838.1|  aspartate aminotransferase 4                          189   1e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886453.1|  hypothetical protein ARALYDRAFT_475071             189   2e-53    
ref|XP_002680594.1|  aspartate aminotransferase                         191   2e-53    Naegleria gruberi strain NEG-M
ref|NP_564803.1|  aspartate aminotransferase 4                          189   2e-53    Arabidopsis thaliana [mouse-ear cress]
gb|AAA79372.1|  aspartate aminotransferase                              189   2e-53    
ref|XP_006476084.1|  PREDICTED: aspartate aminotransferase, cytop...    189   2e-53    
emb|CDY31847.1|  BnaC09g13020D                                          189   3e-53    
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828             189   4e-53    
ref|XP_008347631.1|  PREDICTED: aspartate aminotransferase, cytop...    188   5e-53    
gb|ADP03191.1|  aspartate transaminase                                  186   6e-53    
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517                 188   6e-53    
emb|CDY20276.1|  BnaC04g36800D                                          188   7e-53    
gb|ADP03197.1|  aspartate transaminase                                  186   7e-53    
gb|ADP03185.1|  aspartate transaminase                                  186   7e-53    
emb|CDY46924.1|  BnaA09g12700D                                          187   8e-53    
ref|XP_008220045.1|  PREDICTED: aspartate aminotransferase, cytop...    187   9e-53    
ref|XP_009123404.1|  PREDICTED: aspartate aminotransferase, cytop...    187   1e-52    
ref|XP_010430356.1|  PREDICTED: aspartate aminotransferase, cytop...    187   1e-52    
ref|XP_007298245.1|  hypothetical protein STEHIDRAFT_88821              188   1e-52    
emb|CEL53865.1|  aspartate aminotransferase                             187   1e-52    
ref|XP_005705870.1|  aspartate aminotransferase                         187   1e-52    
gb|AIT70258.1|  aspartate aminotransferase                              187   2e-52    
gb|KIR78943.1|  aspartate aminotransferase                              187   2e-52    
gb|KIR97164.1|  aspartate aminotransferase                              187   2e-52    
gb|ADP03202.1|  aspartate transaminase                                  185   2e-52    
gb|AFR98265.1|  aspartate aminotransferase                              187   2e-52    
gb|AIT70257.1|  aspartate aminotransferase                              186   2e-52    
gb|ADP03187.1|  aspartate transaminase                                  185   3e-52    
ref|XP_002168444.2|  PREDICTED: aspartate aminotransferase, mitoc...    186   3e-52    
emb|CDY32206.1|  BnaA03g54610D                                          186   3e-52    
ref|XP_007378607.1|  hypothetical protein PUNSTDRAFT_109873             186   4e-52    
ref|XP_003197192.1|  aspartate transaminase                             186   5e-52    
ref|XP_002391771.1|  hypothetical protein MPER_08751                    180   5e-52    
gb|KIR50768.1|  aspartate aminotransferase                              186   5e-52    
gb|KIR44346.1|  aspartate aminotransferase                              186   5e-52    
gb|KIJ27386.1|  hypothetical protein M422DRAFT_37801                    186   5e-52    
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                   186   6e-52    
gb|KGB78925.1|  aspartate transaminase                                  185   6e-52    
ref|XP_568366.1|  aspartate transaminase                                186   6e-52    
ref|XP_006302336.1|  hypothetical protein CARUB_v10020394mg             185   7e-52    
gb|AIT70254.1|  aspartate aminotransferase                              185   8e-52    
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                   186   9e-52    
gb|KIR82897.1|  aspartate aminotransferase                              185   1e-51    
gb|AIT70267.1|  aspartate aminotransferase                              185   1e-51    
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242              185   1e-51    
gb|AFR98315.2|  aspartate aminotransferase, mitchondrial                185   1e-51    
gb|ESA01319.1|  hypothetical protein GLOINDRAFT_338037                  185   1e-51    
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475             185   2e-51    
gb|AFJ23640.1|  plasma membrane fatty acid binding protein              178   2e-51    
ref|XP_003036007.1|  hypothetical protein SCHCODRAFT_65913              184   2e-51    
ref|XP_009058471.1|  hypothetical protein LOTGIDRAFT_217673             184   2e-51    
ref|XP_008378103.1|  PREDICTED: aspartate aminotransferase, cytop...    187   2e-51    
gb|AIT70256.1|  aspartate aminotransferase                              184   2e-51    
gb|EPZ32806.1|  Aspartate aminotransferase, mitochondrial               184   2e-51    
ref|XP_006391820.1|  hypothetical protein EUTSA_v10023500mg             184   2e-51    
ref|XP_004365869.1|  aspartate aminotransferase P1                      184   2e-51    
ref|XP_007338662.1|  aspartate aminotransferase                         184   2e-51    
gb|EFZ21338.1|  hypothetical protein SINV_02306                         184   3e-51    
ref|XP_003038704.1|  hypothetical protein SCHCODRAFT_42521              184   3e-51    
gb|AIT70262.1|  aspartate aminotransferase                              184   4e-51    
ref|XP_011175557.1|  PREDICTED: aspartate aminotransferase, mitoc...    184   4e-51    
ref|XP_007265164.1|  glutamic oxaloacetic transaminase AAT1             184   4e-51    
emb|CEI89409.1|  Putative Aspartate aminotransferase                    184   4e-51    
ref|XP_010418279.1|  PREDICTED: aspartate aminotransferase, cytop...    183   4e-51    
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644             184   5e-51    
gb|EIE83310.1|  aspartate aminotransferase                              183   5e-51    
gb|KIR35408.1|  aspartate aminotransferase, mitochondrial               183   6e-51    
gb|KFH12158.1|  aspartate aminotransferase                              181   6e-51    
gb|KDR10996.1|  Aspartate aminotransferase, mitochondrial               183   6e-51    
ref|XP_003886076.1|  Contig An16c0190, complete genome. (Precurso...    183   6e-51    
gb|EMD38441.1|  hypothetical protein CERSUDRAFT_82693                   183   6e-51    
gb|KIJ34684.1|  hypothetical protein M422DRAFT_213094                   183   7e-51    
gb|KGB78963.1|  aspartate aminotransferase                              183   7e-51    
gb|KIO33848.1|  hypothetical protein M407DRAFT_178303                   183   8e-51    
ref|NP_998544.1|  aspartate aminotransferase 2a                         183   8e-51    
gb|AID18683.1|  aspartate aminotransferase                              183   8e-51    
gb|KIR78862.1|  aspartate aminotransferase, mitochondrial               183   8e-51    
ref|XP_003197284.1|  aspartate aminotransferase, mitochondrial pr...    183   9e-51    
gb|AIT70252.1|  aspartate aminotransferase                              183   9e-51    
gb|KFM62856.1|  Aspartate aminotransferase, mitochondrial               176   9e-51    
gb|KIR84694.1|  aspartate aminotransferase, mitochondrial               183   9e-51    
gb|KFG54125.1|  aspartate aminotransferase                              182   9e-51    
gb|KII93192.1|  hypothetical protein PLICRDRAFT_35377                   182   1e-50    
gb|KIR52756.1|  aspartate aminotransferase, mitochondrial               183   1e-50    
ref|XP_568414.1|  aspartate aminotransferase mitochondrial precursor    183   1e-50    
gb|EMD41819.1|  hypothetical protein CERSUDRAFT_128978                  182   1e-50    
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115             182   1e-50    
gb|AFK44136.1|  unknown                                                 174   1e-50    
ref|XP_004483033.1|  PREDICTED: aspartate aminotransferase, mitoc...    182   1e-50    
gb|KIR59017.1|  aspartate aminotransferase, mitochondrial               182   1e-50    
gb|KIR45953.1|  aspartate aminotransferase, mitochondrial               182   1e-50    
emb|CEG72748.1|  Putative Aspartate aminotransferase                    182   1e-50    
gb|AIT70259.1|  aspartate aminotransferase                              182   1e-50    
gb|EKD02362.1|  aspartate aminotransferase                              182   2e-50    
dbj|GAN02936.1|  aspartate aminotransferase                             182   2e-50    
gb|KIK06942.1|  hypothetical protein K443DRAFT_673835                   182   2e-50    
gb|EPB81442.1|  aspartate aminotransferase                              182   2e-50    
ref|XP_001873821.1|  glutamic oxaloacetic transaminase AAT1             182   2e-50    
ref|XP_003706300.1|  PREDICTED: aspartate aminotransferase, mitoc...    182   2e-50    
gb|KFH15985.1|  aspartate aminotransferase                              180   2e-50    
ref|XP_007945864.1|  PREDICTED: aspartate aminotransferase, mitoc...    181   3e-50    
gb|EJT48226.1|  aspartate transaminase                                  181   3e-50    
emb|CEP19900.1|  hypothetical protein                                   181   3e-50    
ref|XP_011348908.1|  PREDICTED: aspartate aminotransferase, mitoc...    181   3e-50    
gb|KFG64384.1|  aspartate aminotransferase                              181   3e-50    
ref|XP_007223291.1|  hypothetical protein PRUPE_ppa005576mg             182   3e-50    
ref|XP_007407231.1|  hypothetical protein MELLADRAFT_42605              181   3e-50    
ref|XP_008883875.1|  aspartate aminotransferase                         181   3e-50    
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15               181   3e-50    
gb|AIT70250.1|  aspartate aminotransferase                              181   4e-50    
ref|XP_003758636.1|  PREDICTED: aspartate aminotransferase, mitoc...    181   4e-50    
ref|XP_002765977.1|  aspartate aminotransferase, cytoplasmic isoz...    176   4e-50    
ref|XP_006878783.1|  PREDICTED: aspartate aminotransferase, mitoc...    180   4e-50    
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                  181   5e-50    
ref|XP_003331101.1|  aspartate aminotransferase, mitochondrial          181   5e-50    
ref|XP_007359882.1|  PLP-dependent transferase                          181   6e-50    
ref|XP_007670159.1|  PREDICTED: aspartate aminotransferase, mitoc...    181   7e-50    
ref|XP_007945851.1|  PREDICTED: aspartate aminotransferase, mitoc...    181   7e-50    
ref|XP_772230.1|  hypothetical protein CNBM0360                         180   7e-50    
gb|KDP34207.1|  hypothetical protein JCGZ_07778                         180   8e-50    
ref|XP_004600686.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   9e-50    
ref|XP_006878782.1|  PREDICTED: aspartate aminotransferase, mitoc...    180   9e-50    
gb|KIK43563.1|  hypothetical protein CY34DRAFT_803728                   180   1e-49    
ref|XP_002764661.1|  aspartate aminotransferase, cytoplasmic, put...    179   1e-49    
gb|EJT99836.1|  aspartate aminotransferase                              180   1e-49    
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                   179   1e-49    
ref|XP_010195211.1|  PREDICTED: aspartate aminotransferase, mitoc...    174   1e-49    
gb|KJA29187.1|  hypothetical protein HYPSUDRAFT_32564                   180   1e-49    
gb|KDE07915.1|  aspartate aminotransferase                              180   1e-49    
ref|XP_004395810.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   1e-49    
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                   179   1e-49    
ref|XP_007468386.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   1e-49    
ref|XP_006732871.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   1e-49    
ref|XP_002711597.1|  PREDICTED: aspartate aminotransferase, mitoc...    180   1e-49    
gb|EPT04274.1|  hypothetical protein FOMPIDRAFT_1021952                 179   1e-49    
ref|XP_011054104.1|  PREDICTED: aspartate aminotransferase, mitoc...    180   1e-49    
gb|EJU05387.1|  aspartate aminotransferase                              179   2e-49    
gb|KFG46516.1|  aspartate aminotransferase                              182   2e-49    
gb|KEP52891.1|  aspartate aminotransferase                              179   2e-49    
ref|XP_004600685.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   2e-49    
ref|XP_011258211.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   2e-49    
ref|XP_006977858.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   2e-49    
gb|EPR63537.1|  aspartate aminotransferase                              182   2e-49    
gb|KDO34648.1|  hypothetical protein SPRG_00710                         179   2e-49    
ref|XP_009677969.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   2e-49    
ref|XP_003402856.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   2e-49    
ref|XP_010965547.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   2e-49    
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                   179   2e-49    
ref|XP_007852807.1|  aspartate aminotransferase                         179   2e-49    
ref|XP_004744353.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   2e-49    
ref|XP_003998142.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   3e-49    
ref|NP_001273953.1|  aspartate aminotransferase, mitochondrial          179   3e-49    
gb|KEH36021.1|  aspartate aminotransferase                              179   3e-49    
gb|EFB22248.1|  hypothetical protein PANDA_000063                       178   3e-49    
ref|XP_004317705.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   3e-49    
dbj|BAK02685.1|  predicted protein                                      179   3e-49    
gb|KIJ21699.1|  aspartate transaminase                                  179   3e-49    
ref|XP_004690564.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   3e-49    
ref|XP_007198093.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   3e-49    
ref|XP_006193091.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...    179   3e-49    
ref|XP_001655159.1|  AAEL002399-PA                                      179   3e-49    
ref|XP_004265006.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   3e-49    
ref|NP_001080255.1|  aspartate aminotransferase 2                       179   3e-49    
ref|XP_006732870.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   3e-49    
gb|AGR65730.1|  aspartate aminotransferase                              179   3e-49    
ref|XP_004395809.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   3e-49    
ref|XP_006005346.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   3e-49    
ref|XP_002367206.1|  aspartate aminotransferase, putative               181   3e-49    
ref|XP_007468385.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   4e-49    
gb|KFG48451.1|  aspartate aminotransferase                              181   4e-49    
ref|XP_005899977.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   4e-49    
gb|KFV73576.1|  hypothetical protein N308_13552                         178   4e-49    
ref|XP_007637330.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   4e-49    
ref|XP_003509628.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   4e-49    
gb|ELK38479.1|  Aspartate aminotransferase, mitochondrial               177   4e-49    
gb|KGB35954.1|  Aspartate aminotransferase, mitochondrial               178   4e-49    
ref|XP_008555500.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   4e-49    
ref|XP_003472097.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   4e-49    
ref|XP_006641457.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   5e-49    
gb|EUC63953.1|  aspartate aminotransferase                              179   5e-49    
ref|XP_006863644.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   5e-49    
ref|XP_007875099.1|  hypothetical protein PNEG_03044                    178   5e-49    
ref|XP_006214551.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   5e-49    
ref|XP_010224070.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   5e-49    
gb|KIP12008.1|  hypothetical protein PHLGIDRAFT_27620                   178   5e-49    
ref|XP_002912325.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   5e-49    
gb|KCW80245.1|  hypothetical protein EUGRSUZ_C01588                     177   5e-49    
ref|XP_008138092.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   5e-49    
ref|XP_004371582.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   5e-49    
ref|XP_007395810.1|  hypothetical protein PHACADRAFT_256136             178   6e-49    
gb|EFA86317.1|  aspartate aminotransferase                              178   6e-49    
ref|XP_007090444.1|  PREDICTED: aspartate aminotransferase, mitoc...    179   6e-49    
gb|KDR85045.1|  hypothetical protein GALMADRAFT_218131                  178   6e-49    
ref|XP_008700791.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   6e-49    
gb|AIT70255.1|  aspartate aminotransferase                              177   6e-49    
gb|EPT25025.1|  aspartate aminotransferase                              181   6e-49    
ref|XP_002644843.1|  Hypothetical protein CBG05011                      177   6e-49    
emb|CDM87357.1|  mitochondrial aspartate aminotransferase               175   7e-49    
ref|XP_006110233.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   7e-49    
ref|XP_005345603.1|  PREDICTED: aspartate aminotransferase, mitoc...    178   7e-49    
ref|XP_005873554.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   7e-49    
ref|XP_009870982.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...    177   7e-49    
dbj|BAO48147.2|  mitochondrial aspartate aminotransferase               175   8e-49    
ref|XP_007882640.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   8e-49    
ref|XP_004690563.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   8e-49    
ref|XP_006099282.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   8e-49    
ref|XP_003486130.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   8e-49    
ref|XP_010329683.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   9e-49    
ref|XP_010860133.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   9e-49    
ref|XP_006052520.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   9e-49    
gb|KGL84885.1|  hypothetical protein N309_05764                         177   9e-49    
ref|XP_006863643.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   9e-49    
ref|XP_006214550.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   9e-49    
gb|EPY74624.1|  Aspartate aminotransferase, mitochondrial precurs...    179   9e-49    
ref|XP_005899976.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   9e-49    
ref|XP_010983999.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   9e-49    
ref|NP_001016933.1|  aspartate aminotransferase, mitochondrial pr...    177   1e-48    
ref|XP_004015092.1|  PREDICTED: aspartate aminotransferase, mitoc...    176   1e-48    
ref|XP_010615470.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   1e-48    
ref|XP_006863642.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   1e-48    
ref|XP_010138136.1|  PREDICTED: aspartate aminotransferase, mitoc...    176   1e-48    
ref|XP_008067406.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   1e-48    
ref|XP_008868102.1|  hypothetical protein H310_05218                    177   1e-48    
ref|XP_007112902.1|  PREDICTED: aspartate aminotransferase, mitoc...    177   1e-48    
gb|KFH62511.1|  aspartate aminotransferase                              177   1e-48    



>dbj|BAD02268.1| aspartate aminotransferase [Nicotiana tabacum]
Length=227

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLY ERIGAINV CSSADAA RVKSQLKRLARPMYSNPP
Sbjct  54   VRLFAARGMELLVAQSYSKNLGLYGERIGAINVPCSSADAATRVKSQLKRLARPMYSNPP  113

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KDKSGKDW +ILKQIG
Sbjct  114  IHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSAKDKSGKDWPYILKQIG  173

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  174  MFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  227



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLY ERIGAINV+CSSADAA RVKSQLKRLARPMYSNPP
Sbjct  289  VRLFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSADAATRVKSQLKRLARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KDKSGKDW++ILKQIG
Sbjct  349  IHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSTKDKSGKDWSYILKQIG  408

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  409  MFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  462



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMFA+RG ELLVAQSYSKNLGLY ERIGAINV+CSSADAA RVKSQLKRLARPMYSNPP
Sbjct  296  VRMFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSADAATRVKSQLKRLARPMYSNPP  355

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KDKSGKDW+FILKQIG
Sbjct  356  IHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKSGKDWSFILKQIG  415

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSENM++KWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  416  MFSFTGLNKAQSENMADKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  469



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +R+FASRG ELLVAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKRLARPMYSNPP
Sbjct  286  MRLFASRGMELLVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRLARPMYSNPP  345

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA+IVANVVGNP+LFNEWK+EMEMMAGRIKSVRQKLYD+L  KDKSGKDW++ILKQIG
Sbjct  346  VHGAKIVANVVGNPDLFNEWKEEMEMMAGRIKSVRQKLYDNLISKDKSGKDWSYILKQIG  405

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  406  MFSFTGLNKAQSDNMTNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  459



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   337 bits (863),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMFA+RG ELLVAQSYSKNLGLY ERIGAINV+CSSADAA RVKSQLKRLARPMYSNPP
Sbjct  289  VRMFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSADAATRVKSQLKRLARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KDKSGK+W+FILKQIG
Sbjct  349  IHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKSGKNWSFILKQIG  408

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGL++AQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  409  MFSFTGLDRAQSENMANKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  462



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMFA+RG ELLVAQSYSKNLGLY ERIGAINV+CSSA AA RVKSQLKRLARPMYSNPP
Sbjct  289  VRMFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSAYAATRVKSQLKRLARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KDKSGKDW+FILKQIG
Sbjct  349  IHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKSGKDWSFILKQIG  408

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSENM++KWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  409  MFSFTGLNKAQSENMADKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  462



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKR+ARPMYSNPP
Sbjct  293  VRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRIARPMYSNPP  352

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWK EMEMMAGRIK+VRQKL+DSLS KDKSGKDW+FILKQIG
Sbjct  353  VHGARIVANVVGDPALFNEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIG  412

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  413  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   334 bits (857),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP
Sbjct  293  VRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  352

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWK EMEMMAGRIK VRQKL+DSLS KDKSGKDW+FILKQIG
Sbjct  353  VHGARIVANVVGDPTLFNEWKAEMEMMAGRIKGVRQKLFDSLSAKDKSGKDWSFILKQIG  412

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  413  MFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELL+AQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKR+ARPMYSNPP
Sbjct  293  VRLFAARGMELLIAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRIARPMYSNPP  352

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWK+EMEM+AGRIK+VRQKL+DSLS KDKSGKDW+FILKQIG
Sbjct  353  VHGARIVANVVGDPILFNEWKEEMEMLAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIG  412

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  413  MFSFTGLNKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELL+AQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKR+ARPMYSNPP
Sbjct  293  VRLFAARGMELLIAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRIARPMYSNPP  352

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWK+EMEM+AGRIK+VRQKL+DSLS KDKSGKDW+FILKQIG
Sbjct  353  VHGARIVANVVGDPTLFNEWKEEMEMLAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIG  412

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGL K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  413  MFSFTGLTKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG E LVAQSYSKNLGLYAERIGAINVVCSS+D A RVKSQLKRLARPMYSNPP
Sbjct  278  VRLFAARGMEFLVAQSYSKNLGLYAERIGAINVVCSSSDIAKRVKSQLKRLARPMYSNPP  337

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVGNPELFN+WK+EME+MAGRIKSVR+KLYDSLS KD SGKDW+F+LKQIG
Sbjct  338  IHGARIVANVVGNPELFNDWKEEMELMAGRIKSVRKKLYDSLSAKDNSGKDWSFVLKQIG  397

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN AQSENM+NKWH+YMTKDGRISLAGLS+AKCEYLADAIIDSYYN+S
Sbjct  398  MFSFTGLNDAQSENMTNKWHVYMTKDGRISLAGLSSAKCEYLADAIIDSYYNIS  451



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKR+ARPMYSNP 
Sbjct  293  VRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRIARPMYSNPS  352

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWK EMEMMAGRIK+VRQKL+DSLS KDKSGKDW+FILKQIG
Sbjct  353  VHGARIVANVVGDPALFNEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIG  412

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  413  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+ G ELLVAQSYSKNLGLYAERIGAINVVCSS+DAAARVKSQLKRLARPMYSNPP
Sbjct  297  VRLFAACGLELLVAQSYSKNLGLYAERIGAINVVCSSSDAAARVKSQLKRLARPMYSNPP  356

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEW++EME+MAGRIK+VRQKL+DSLS KDKSGKDW+FILKQIG
Sbjct  357  VHGARIVANVVGDPALFNEWREEMELMAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIG  416

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  417  MFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  470



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   332 bits (850),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGA+NVVCSS+D AARVKSQLKRLARPMYSNPP
Sbjct  286  VRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARVKSQLKRLARPMYSNPP  345

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL+DSLS KDKSGKDW+FIL+QIG
Sbjct  346  VHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILRQIG  405

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  406  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  459



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   330 bits (845),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGA+NVVCSS+D AARVKSQLKRLARPMYSNPP
Sbjct  237  VRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARVKSQLKRLARPMYSNPP  296

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL+DSLS KDKSGKDW+FIL+QIG
Sbjct  297  VHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILRQIG  356

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  357  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  410



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAIN+VCSSADAA RVKSQ+KRLARPMYSNPP
Sbjct  376  VRLFAARGLELLVAQSYSKNLGLYAERIGAINIVCSSADAATRVKSQIKRLARPMYSNPP  435

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+PELFNEWK+EME+MAGRIKSVRQKLYDSL  KDKSGKDW+FIL+QIG
Sbjct  436  VHGARIVANVVGDPELFNEWKEEMEVMAGRIKSVRQKLYDSLRAKDKSGKDWSFILRQIG  495

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+AKCEYLADAI DSY+NVS
Sbjct  496  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSAKCEYLADAIFDSYHNVS  549



>dbj|BAD94538.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=187

 Score =   321 bits (822),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  14   VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  73

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  74   VHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  133

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  134  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  187



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   329 bits (843),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGA+NVVCSSADAAARVKSQLKR+ARPMYSNPP
Sbjct  291  VRLFAARGMELLVAQSYSKNLGLYAERIGALNVVCSSADAAARVKSQLKRIARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  LFNEWK EMEMMAGRIK VRQKLYDSLS KDKSGKDW+FILKQIG
Sbjct  351  VHGARIVANVVGDQSLFNEWKDEMEMMAGRIKGVRQKLYDSLSAKDKSGKDWSFILKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  411  MFSYTGLNKTQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  464



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVC+S+D A RVKSQLKR+ARPMYSNPP
Sbjct  291  VRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSSDTATRVKSQLKRIARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LF+EWK EMEMMAGRIK+VRQKLYD+L+ KDKSGKDW+FILKQIG
Sbjct  351  VHGARIVANVVGDPTLFSEWKAEMEMMAGRIKNVRQKLYDNLTAKDKSGKDWSFILKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAIIDSY+NVS
Sbjct  411  MFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAIIDSYHNVS  464



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVC+S+DAA RVKSQLKR+ARPMYSNPP
Sbjct  291  VRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCASSDAATRVKSQLKRIARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P LFNEWK EMEMMAGRIK VRQKLYD+L+  DKSGKDW+FILKQIG
Sbjct  351  IHGARIVANVVGDPALFNEWKAEMEMMAGRIKGVRQKLYDNLTATDKSGKDWSFILKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAIIDSY+NVS
Sbjct  411  MFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAIIDSYHNVS  464



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVC+S+D A RVKSQLKR+ARPMYSNPP
Sbjct  291  VRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSSDTATRVKSQLKRIARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LF EWK EMEMMAGRIK+VRQKLYD+L+ KDKSGKDW+FILKQIG
Sbjct  351  VHGARIVANVVGDPTLFGEWKAEMEMMAGRIKNVRQKLYDNLTAKDKSGKDWSFILKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAIIDSY+NVS
Sbjct  411  MFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAIIDSYHNVS  464



>gb|AFK46621.1| unknown [Lotus japonicus]
Length=241

 Score =   320 bits (819),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F SRG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKSQLKR+ARPMYSNPP
Sbjct  68   VRLFVSRGMEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRIARPMYSNPP  127

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA++VGNP+LFNEWK EMEMMAGRIK+VRQKLYDS+S KDKSGKDW+FIL+QIG
Sbjct  128  VHGARIVADIVGNPDLFNEWKAEMEMMAGRIKNVRQKLYDSISSKDKSGKDWSFILEQIG  187

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  188  MFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  241



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   326 bits (836),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG ELLVAQSYSKNLGLYAERIGAINVVCSS+DAAARVKSQLKRLARPMYSNPP
Sbjct  281  VRLFVERGLELLVAQSYSKNLGLYAERIGAINVVCSSSDAAARVKSQLKRLARPMYSNPP  340

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KDKSGKDW+FILKQIG
Sbjct  341  VHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSRKDKSGKDWSFILKQIG  400

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSE+M+NKWH+YMTKDGRISLAGLS +KCEYLADAIIDS++NVS
Sbjct  401  MFSFTGLNKAQSEHMTNKWHVYMTKDGRISLAGLSLSKCEYLADAIIDSFHNVS  454



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG ELLVAQSYSKNLGLYAERIGAINVVCSS+DAAARVKSQLKRLARPMYSNPP
Sbjct  265  VRLFVERGLELLVAQSYSKNLGLYAERIGAINVVCSSSDAAARVKSQLKRLARPMYSNPP  324

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KDKSGKDW+FILKQIG
Sbjct  325  VHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSRKDKSGKDWSFILKQIG  384

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSE+M+NKWH+YMTKDGRISLAGLS +KCEYLADAIIDS++NVS
Sbjct  385  MFSFTGLNKAQSEHMTNKWHVYMTKDGRISLAGLSLSKCEYLADAIIDSFHNVS  438



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKR+ARPMYSNPP
Sbjct  289  VRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRIARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P LFNEWK+EME+MAGRIK+VRQKL+DSLS KDK GKDW+FILKQIG
Sbjct  349  IHGARIVANVVGDPALFNEWKEEMELMAGRIKNVRQKLFDSLSAKDKCGKDWSFILKQIG  408

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDS++ VS
Sbjct  409  MFSFTGLSKVQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHCVS  462



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKR+ARPMYSNPP
Sbjct  289  VRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRIARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P LFNEWK+EME+MAGRIK+VRQKL+DSLS KDK GKDW+FILKQIG
Sbjct  349  IHGARIVANVVGDPALFNEWKEEMELMAGRIKNVRQKLFDSLSAKDKCGKDWSFILKQIG  408

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDS++ VS
Sbjct  409  MFSFTGLSKVQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHCVS  462



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDPTMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  453



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVC+SADAA RVKSQLKRLARPMYSNPP
Sbjct  237  VRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSADAATRVKSQLKRLARPMYSNPP  296

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KDKSGKDW+FILKQIG
Sbjct  297  VHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIG  356

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NV
Sbjct  357  MFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNV  409



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   324 bits (830),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FASRG ELLVAQSYSKNLGLYAERIGAINVVCS+ADAA RVKSQLKRLARPMYSNPP
Sbjct  289  VRLFASRGMELLVAQSYSKNLGLYAERIGAINVVCSTADAATRVKSQLKRLARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA+IVAN+V +P LFNEWK EMEMMAGRIK+VRQKLYDSLS KDKSGKDW+FILKQIG
Sbjct  349  VHGAKIVANIVSDPALFNEWKAEMEMMAGRIKNVRQKLYDSLSAKDKSGKDWSFILKQIG  408

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCE LADAI+DSY+NVS
Sbjct  409  MFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEDLADAIVDSYHNVS  462



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   324 bits (830),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 168/182 (92%), Gaps = 8/182 (4%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAAR--------VKSQLKRLA  567
            VR+FA+RG ELLVAQSYSKNLGLYAERIGA+NVVCSS+D AAR        VKSQLKRLA
Sbjct  286  VRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARCCEVAVIQVKSQLKRLA  345

Query  566  RPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDW  387
            RPMYSNPP+HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL+DSLS KDKSGKDW
Sbjct  346  RPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDW  405

Query  386  TFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            +FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  406  SFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHN  465

Query  206  VS  201
            VS
Sbjct  466  VS  467



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVC+SADAA RVKSQLKRLARPMYSNPP
Sbjct  292  VRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSADAATRVKSQLKRLARPMYSNPP  351

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KDKSGKDW+FILKQIG
Sbjct  352  VHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIG  411

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NV
Sbjct  412  MFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNV  464



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+RG EL VAQSYSKNLGLYAERIGA+NVVC+SADAAARVKSQLKRLARPMYSNPP
Sbjct  309  VRSFAARGMELFVAQSYSKNLGLYAERIGAMNVVCTSADAAARVKSQLKRLARPMYSNPP  368

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P LFNEWK EME+MAGRIK+VRQKLYDSL  KDKSGKDW+FILKQIG
Sbjct  369  IHGARIVANVVGDPVLFNEWKAEMELMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIG  428

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN+AQS+ M+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  429  MFSFTGLNEAQSDKMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS  482



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+ VAQSYSKNLGLYAERIGAINVVCSS+DAA RVKSQLKRLARPMYSNPP
Sbjct  291  VRLFVARGMEVFVAQSYSKNLGLYAERIGAINVVCSSSDAAIRVKSQLKRLARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LYD+LS KDK+GKDW+F+L+QIG
Sbjct  351  VHGAQIVANVVGNPTLFDEWKSEMELMSGRIKGVRQRLYDNLSAKDKTGKDWSFVLRQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS +KCEYLADAI+DSYYNVS
Sbjct  411  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSLSKCEYLADAIVDSYYNVS  464



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+ VAQSYSKNLGLYAERIGAINVVCSS+DAA RVKSQLKRLARPMYSNPP
Sbjct  280  VRLFVARGMEVFVAQSYSKNLGLYAERIGAINVVCSSSDAAIRVKSQLKRLARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LYD+LS KDK+GKDW+F+L+QIG
Sbjct  340  VHGAQIVANVVGNPTLFDEWKSEMELMSGRIKGVRQRLYDNLSAKDKTGKDWSFVLRQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS +KCEYLADAI+DSYYNVS
Sbjct  400  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSLSKCEYLADAIVDSYYNVS  453



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFADRGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQKLYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDAAMFGEWKAEMEMMAGRIKTVRQKLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVC+SADAA RVKSQLKRLARPMYSNPP
Sbjct  291  VRLFAARGLELLVAQSYSKNLGLYAERIGAINVVCTSADAAIRVKSQLKRLARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KDKSGKDW+FILKQIG
Sbjct  351  VHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NV
Sbjct  411  MFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNV  463



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  453



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQKLYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDATMFSEWKAEMEMMAGRIKTVRQKLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   322 bits (824),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  453



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   321 bits (823),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F SRG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKSQLKR+ARPMYSNPP
Sbjct  284  VRLFVSRGMEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRIARPMYSNPP  343

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA++VGNP+LFNEWK EMEMMAGRIK+VRQKLYDS+S KDKSGKDW+FILKQIG
Sbjct  344  VHGARIVADIVGNPDLFNEWKAEMEMMAGRIKNVRQKLYDSISSKDKSGKDWSFILKQIG  403

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  404  MFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  457



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  322  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  381

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  382  VHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  441

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  442  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  495



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  400  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSHHNVS  453



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMFA+RG ELL+AQSYSKNLGLYAERIGAINVVCSS+D A RVKSQLKRLARPMYSNPP
Sbjct  289  VRMFAARGLELLIAQSYSKNLGLYAERIGAINVVCSSSDVAHRVKSQLKRLARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVAN+VGN +LF+EWK+EM  MAGRIKSVR+KLYDSL  KD SGKDW+FILKQIG
Sbjct  349  IHGARIVANIVGNSDLFSEWKEEMASMAGRIKSVRKKLYDSLCAKDNSGKDWSFILKQIG  408

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+A CEYLADAIIDSY+NVS
Sbjct  409  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSANCEYLADAIIDSYHNVS  462



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMFA+RG ELL+AQSYSKNLGLYAERIGAINVVCSS+D A RVKSQLKRLARPMYSNPP
Sbjct  290  VRMFAARGLELLIAQSYSKNLGLYAERIGAINVVCSSSDVAHRVKSQLKRLARPMYSNPP  349

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVAN+VGN +LF+EWK+EM  MAGRIKSVR+KLYDSL  KD SGKDW+FILKQIG
Sbjct  350  IHGARIVANIVGNSDLFSEWKEEMASMAGRIKSVRKKLYDSLCAKDNSGKDWSFILKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+A CEYLADAIIDSY+NVS
Sbjct  410  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSANCEYLADAIIDSYHNVS  463



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F SRG EL VAQSYSKNLGLYAERIGA+NV+CSS+DAAARVKSQLKRLARPMYSNPP
Sbjct  296  VRLFVSRGMELFVAQSYSKNLGLYAERIGAVNVICSSSDAAARVKSQLKRLARPMYSNPP  355

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LF+EWK EME MAGRIKSVR++L+++LS KDKSGKDW+FILKQIG
Sbjct  356  VHGARIVANVVGDPALFSEWKSEMEFMAGRIKSVRKRLFENLSQKDKSGKDWSFILKQIG  415

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS +KCEYLADAIIDSY+NV+
Sbjct  416  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLSKCEYLADAIIDSYHNVN  469



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG ELLVAQSYSKNLGLYAERIGAINVVCSS+DAAARVKSQLKRLARPMYSNPP
Sbjct  281  VRLFVERGLELLVAQSYSKNLGLYAERIGAINVVCSSSDAAARVKSQLKRLARPMYSNPP  340

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KDKSGKDW+FILKQIG
Sbjct  341  VHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSQKDKSGKDWSFILKQIG  400

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS++M+NKW +YMTKDGRISLAGLS +KCEYLADAI+DS++NVS
Sbjct  401  MFSFTGLNKAQSDHMTNKWRVYMTKDGRISLAGLSLSKCEYLADAIMDSFHNVS  454



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  453



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  275  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  334

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  335  VHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  394

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  395  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  448



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   319 bits (817),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFADRGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQKLYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDAAMFGEWKAEMEMMAGRIKTVRQKLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            MFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  400  MFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHN  451



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   318 bits (816),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  400  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHN  451



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  400  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHN  451



>ref|XP_007161154.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
 gb|ESW33148.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
Length=261

 Score =   311 bits (797),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKSQLKRLARPMYSNPP
Sbjct  88   VRLFVARGMEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRLARPMYSNPP  147

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA+VVGNP LFNEW+ EMEMMAGRIK+VRQ+LY+S++ KD SGKDW+FILKQIG
Sbjct  148  VHGARIVADVVGNPVLFNEWRAEMEMMAGRIKNVRQQLYNSITSKDNSGKDWSFILKQIG  207

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK Q++NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  208  MFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  261



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F SRG E+LVAQSYSKNLGLYAER+GAINV+ SS ++AARVKSQLKRLARPMYSNPP
Sbjct  294  VRLFVSRGMEVLVAQSYSKNLGLYAERVGAINVISSSPESAARVKSQLKRLARPMYSNPP  353

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKSGKDW+FILKQIG
Sbjct  354  VHGARIVANIVGTPALFDEWKAEMEMMAGRIKNVRQALYDSISSKDKSGKDWSFILKQIG  413

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  414  MFSFTGLNKNQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  467



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F SRG E+LVAQSYSKNLGLYAER+GAINV+ SS ++A RVKSQLKRLARPMYSNPP
Sbjct  282  VRLFESRGMEVLVAQSYSKNLGLYAERVGAINVISSSPESATRVKSQLKRLARPMYSNPP  341

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKSGKDW+FILKQIG
Sbjct  342  VHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKDKSGKDWSFILKQIG  401

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  402  MFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  455



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 162/175 (93%), Gaps = 1/175 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKA-QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKA QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKAQQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  454



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF +RG E++ AQSYSKNLGLYAERIGAINVVCSS DAA+RVKSQLKR+ARPMYSNPP
Sbjct  291  VRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAASRVKSQLKRIARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LF EW  EMEMMAGRIK+VRQKL+DSLS KDKSGKDW+F+LKQIG
Sbjct  351  VHGARIVANVVGDPALFKEWNVEMEMMAGRIKNVRQKLFDSLSSKDKSGKDWSFVLKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NV
Sbjct  411  MFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNV  463



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKSQLKR+ARPMYSNPP
Sbjct  290  VRLFVARGIEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRIARPMYSNPP  349

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKSGKDW+FILKQIG
Sbjct  350  VHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  410  MFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  331  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  390

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  391  VHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKSGKDWSFILKQIG  450

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  451  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHN  502



>prf||1908424A Asp aminotransferase
Length=465

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F SRG E+LVAQSYSKNLGLYAER+GAINV+ SS ++A RVKSQLKRLARPMYSNPP
Sbjct  292  VRLFVSRGMEVLVAQSYSKNLGLYAERVGAINVISSSPESATRVKSQLKRLARPMYSNPP  351

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKSGKDW+FILKQIG
Sbjct  352  VHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKDKSGKDWSFILKQIG  411

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  412  MFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  465



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F SRG E+LVAQSYSKNLGLYAER+GAINV+ SS ++A RVKSQLKRLARPMYSNPP
Sbjct  292  VRLFVSRGMEVLVAQSYSKNLGLYAERVGAINVISSSPESATRVKSQLKRLARPMYSNPP  351

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKSGKDW+FILKQIG
Sbjct  352  VHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKDKSGKDWSFILKQIG  411

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  412  MFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  465



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG ELLVAQSYSKNLGLYAERIGAINVVCSS+DA  RVKSQLKRLARPMYSNPP
Sbjct  252  VRLFVKRGFELLVAQSYSKNLGLYAERIGAINVVCSSSDAGTRVKSQLKRLARPMYSNPP  311

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+LY++LS KDKSGKDW+F+LKQIG
Sbjct  312  VHGARIVANVVGDPNLFNEWKQEMELMAGRIKNVRQRLYENLSQKDKSGKDWSFVLKQIG  371

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGL+KAQS++M++KWHIYMTKDGRISLAGLS +KCEYLADAIIDS++NV 
Sbjct  372  MFSYTGLHKAQSDHMTDKWHIYMTKDGRISLAGLSLSKCEYLADAIIDSFHNVD  425



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK+QS+NM++KWH+Y TKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  400  MFSFTGLNKSQSDNMTDKWHVYXTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+ VAQSYSKNLGLYAERIGAINVVCSS++ A RVKSQLKRLARPMYSNPP
Sbjct  237  VRLFVARGMEVFVAQSYSKNLGLYAERIGAINVVCSSSEVANRVKSQLKRLARPMYSNPP  296

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LY +LS KDKSGKDW+F+L+QIG
Sbjct  297  VHGAQIVANVVGNPVLFDEWKSEMELMSGRIKGVRQRLYANLSAKDKSGKDWSFVLRQIG  356

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQSENMS+KWHIYMTKDGRISLAGLS +KCEYLADAIIDSYYNVS
Sbjct  357  MFSFTGLNKAQSENMSSKWHIYMTKDGRISLAGLSLSKCEYLADAIIDSYYNVS  410



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   316 bits (810),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  400  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHN  451



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYAERIGAINVV SS ++AARVKSQLKR+ARPMYSNPP
Sbjct  290  VRLFVARGMEVLVAQSYSKNLGLYAERIGAINVVSSSPESAARVKSQLKRIARPMYSNPP  349

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKSGKDW+FILKQIG
Sbjct  350  VHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN  QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  410  MFSFTGLNTNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLYAERIGAINVVCS+ADAA RVKSQLK+LAR MYSNPP
Sbjct  288  VRLFAARGMELLVAQSYSKNLGLYAERIGAINVVCSTADAATRVKSQLKQLARLMYSNPP  347

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA+IVAN+V +P LFN+WK EMEMMAGRIK+VRQKL DSLS KDKSGKDW+FILKQIG
Sbjct  348  VHGAKIVANIVSDPALFNDWKAEMEMMAGRIKNVRQKLNDSLSAKDKSGKDWSFILKQIG  407

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCEYLADAI+DSY+NVS
Sbjct  408  MFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEYLADAIVDSYHNVS  461



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG ELLVAQSYSKNLGLYAERIGAINVV +S+D AARVKSQLKRLARPMYSNPP
Sbjct  280  VRLFVARGMELLVAQSYSKNLGLYAERIGAINVVLTSSDTAARVKSQLKRLARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVAN+VG+P LF EWK EMEMMAGRIK+VRQKLYDSL  KDKSGKDW+FILKQIG
Sbjct  340  IHGAKIVANIVGDPTLFGEWKAEMEMMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN  Q+ENM+ KWH++MTKDGRISLAGL+ AKCEYL+DAIIDSY+NVS
Sbjct  400  MFSFTGLNTTQTENMTKKWHVFMTKDGRISLAGLNLAKCEYLSDAIIDSYHNVS  453



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   312 bits (800),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAINVVCS+ + A RVKSQLKRLARPMYSNPP
Sbjct  241  VRLFVQRGLEVFVAQSYSKNLGLYAERIGAINVVCSTPEVANRVKSQLKRLARPMYSNPP  300

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD SGKDW+FIL+QIG
Sbjct  301  IHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKDDSGKDWSFILRQIG  360

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  361  MFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS  414



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF +RG E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKSQLKR+ARPMYSNPP
Sbjct  223  VRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKSQLKRIARPMYSNPP  282

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKSGKDW+F+LKQIG
Sbjct  283  VHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIG  342

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N S
Sbjct  343  MFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNGS  396



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   313 bits (803),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF +RG E++ AQSYSKNLGLYAERIGAINVVCSS +AAARVKSQLKR+ARPMYSNPP
Sbjct  287  VRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPEAAARVKSQLKRIARPMYSNPP  346

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKSGKDW+F+LKQIG
Sbjct  347  VHGARIVANIVGDSALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIG  406

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  407  MFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  460



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   313 bits (803),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF +RG E++ AQSYSKNLGLYAERIGAINVVCSS +AAARVKSQLKR+ARPMYSNPP
Sbjct  287  VRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPEAAARVKSQLKRIARPMYSNPP  346

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKSGKDW+F+LKQIG
Sbjct  347  VHGARIVANIVGDSALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIG  406

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  407  MFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  460



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   313 bits (803),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAINVVCS+ + A RVKSQLKRLARPMYSNPP
Sbjct  284  VRLFVKRGMEVFVAQSYSKNLGLYAERIGAINVVCSAPEVADRVKSQLKRLARPMYSNPP  343

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVAN+VG+P +F EWKQEME MAGRIK+VRQKLYDSLS KDKSGKDW+FIL+QIG
Sbjct  344  IHGARIVANIVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSAKDKSGKDWSFILRQIG  403

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKC+YLADAIIDS++NVS
Sbjct  404  MFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCDYLADAIIDSFHNVS  457



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 160/173 (92%), Gaps = 1/173 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAINVVCSSADAA RVKSQLKR+ARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKA-QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            MFSFTGLNKA QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  400  MFSFTGLNKAQQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHN  452



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKSQLKRLARPMYSNPP
Sbjct  288  VRLFVARGMEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRLARPMYSNPP  347

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA+VVGNP LFNEW+ EMEMMAGRIK+VRQ+LY+S++ KD SGKDW+FILKQIG
Sbjct  348  VHGARIVADVVGNPVLFNEWRAEMEMMAGRIKNVRQQLYNSITSKDNSGKDWSFILKQIG  407

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK Q++NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  408  MFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  461



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKSQLKR+ARPMYSNPP
Sbjct  290  VRLFVARGIEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRIARPMYSNPP  349

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKSGKDW+FILKQIG
Sbjct  350  VHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFSFT LNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NV
Sbjct  410  MFSFTSLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNV  462



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AAR  SQLKR+ARPMYSNPP
Sbjct  290  VRLFVARGIEVLVAQSYSKNLGLYAERIGAINVISSSPESAARETSQLKRIARPMYSNPP  349

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKSGKDW+FILKQIG
Sbjct  350  VHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  410  MFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF +RG E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKSQLKR+ARPMYSNPP
Sbjct  291  VRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKSQLKRIARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKSGKDW+F+LKQIG
Sbjct  351  VHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N S
Sbjct  411  MFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNGS  464



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAINVVCS+ + A RVKSQLKRLARPMYSNPP
Sbjct  285  VRLFVQRGLEVFVAQSYSKNLGLYAERIGAINVVCSTPEVANRVKSQLKRLARPMYSNPP  344

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD SGKDW+FIL+QIG
Sbjct  345  IHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKDDSGKDWSFILRQIG  404

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  405  MFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS  458



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLY+ERIGAINVVCS+ + A RVKSQLKRLARPMYSNPP
Sbjct  249  VRLFVKRGLEVFVAQSYSKNLGLYSERIGAINVVCSTPEVADRVKSQLKRLARPMYSNPP  308

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD SGKDW+FIL+QIG
Sbjct  309  IHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKDNSGKDWSFILRQIG  368

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  369  MFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS  422



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF +RG E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKSQLKR+ARPMYSNPP
Sbjct  295  VRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKSQLKRIARPMYSNPP  354

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKSGKDW+F+LKQIG
Sbjct  355  VHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIG  414

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N S
Sbjct  415  MFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNGS  468



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF +RG E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKSQLKR+ARPMYSNPP
Sbjct  291  VRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKSQLKRIARPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS +DKSGKDW+F+LKQIG
Sbjct  351  VHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRDKLFDSLSSEDKSGKDWSFVLKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ +NM+ KWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  411  MFSFTGLNKAQCDNMTTKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  464



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLY+ER+GAINVVCS+ + A RVKSQLKRLARPMYSNPP
Sbjct  286  VRLFVKRGMEVFVAQSYSKNLGLYSERVGAINVVCSAPEVADRVKSQLKRLARPMYSNPP  345

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG+P +F EWKQEME+MAGRIK+VRQKLYDSLS KDKSGKDW+FIL+QIG
Sbjct  346  IHGAKIVANVVGDPTMFGEWKQEMELMAGRIKNVRQKLYDSLSAKDKSGKDWSFILRQIG  405

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNKAQS+NM++KWHIYMTKDGRISLAGLS AKC+YLADAIIDS++NV+
Sbjct  406  MFSYTGLNKAQSDNMTDKWHIYMTKDGRISLAGLSLAKCDYLADAIIDSFHNVN  459



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   311 bits (797),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLY+ERIGAINVVCS+   A RVKSQLKRLARPMYSNPP
Sbjct  285  VRLFVKRGMEVFVAQSYSKNLGLYSERIGAINVVCSAPGVADRVKSQLKRLARPMYSNPP  344

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS+KDKSGKDW+FIL+QIG
Sbjct  345  IHGARIVANVVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSVKDKSGKDWSFILRQIG  404

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKC+YLADAIIDS++NV+
Sbjct  405  MFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCDYLADAIIDSFHNVN  458



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   312 bits (800),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF +RG E++ AQSYSKNLGLYAERIGAINVVCSS DAAARVKSQLKR+ARPMYSNPP
Sbjct  323  VRMFVARGMEVIAAQSYSKNLGLYAERIGAINVVCSSPDAAARVKSQLKRIARPMYSNPP  382

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKSGKDW+F+LKQIG
Sbjct  383  VHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIG  442

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N S
Sbjct  443  MFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNGS  496



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKSQLKR+ARPMYSNPP
Sbjct  281  VRLFVARGLEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRIARPMYSNPP  340

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA++VGNP LF+EWK EMEMMAGRIK+VRQ+LYDS+S KDKSGKDW+FILKQIG
Sbjct  341  VHGARIVADIVGNPALFDEWKVEMEMMAGRIKNVRQQLYDSISSKDKSGKDWSFILKQIG  400

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDS++ VS
Sbjct  401  MFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHYVS  454



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLY+ER+GAINVVCS+ + A RV SQLKRLARPMYSNPP
Sbjct  286  VRLFVKRGMEVFVAQSYSKNLGLYSERVGAINVVCSAPEVADRVNSQLKRLARPMYSNPP  345

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG+P +F EWKQEME+MAGRIK+VRQKLYDSLS KDKSGKDW+FIL+QIG
Sbjct  346  IHGAKIVANVVGDPTMFGEWKQEMELMAGRIKNVRQKLYDSLSAKDKSGKDWSFILRQIG  405

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLNKAQS+NM++KWHIYMTKDGRISLAGLS AKC+YLADAIIDS++NV+
Sbjct  406  MFSYTGLNKAQSDNMTDKWHIYMTKDGRISLAGLSLAKCDYLADAIIDSFHNVN  459



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F +RG E+ VAQSYSKNLGLYAER+GAIN + SSAD AARVKSQLKR+ARPMYSNPP
Sbjct  288  VRKFVARGMEVFVAQSYSKNLGLYAERVGAINAIVSSADVAARVKSQLKRIARPMYSNPP  347

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG P +F+EW+ EM+MMAGRIK+VRQ+LYD LS KDKSGKDW+F+LKQIG
Sbjct  348  VHGARIVANVVGEPTMFDEWRAEMQMMAGRIKTVRQRLYDELSTKDKSGKDWSFVLKQIG  407

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGL+ AKC YLADAIIDSYYN+
Sbjct  408  MFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLNLAKCAYLADAIIDSYYNI  460



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYA+RIGAINV+ SS ++AAR  SQLKR+ARPMYSNPP
Sbjct  290  VRLFVARGIEVLVAQSYSKNLGLYAQRIGAINVISSSPESAARETSQLKRIARPMYSNPP  349

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKSGKDW+FILKQIG
Sbjct  350  VHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QS+NM+NKWH+YMTKDGRIS AGLS AKCEYLADAIIDSY+NVS
Sbjct  410  MFSFTGLNKNQSDNMTNKWHVYMTKDGRISSAGLSLAKCEYLADAIIDSYHNVS  463



>dbj|BAJ97030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   305 bits (780),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAINV+C++ + A RVKSQLKRLARPMYSNPP
Sbjct  172  VRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICTAPEVADRVKSQLKRLARPMYSNPP  231

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+SGKDW+FIL QIG
Sbjct  232  IHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIG  291

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  292  MFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  345



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAINV+CS+ + A RVKSQLKRLARPMYSNPP
Sbjct  295  VRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICSAPEVADRVKSQLKRLARPMYSNPP  354

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+SGKDW+FIL QIG
Sbjct  355  IHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIG  414

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  415  MFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  468



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLY+ER+GAINV+CS+ + A RVKSQLKRLARPMYSNPP
Sbjct  282  VRLFVERGLEVFVAQSYSKNLGLYSERVGAINVICSAPEVADRVKSQLKRLARPMYSNPP  341

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD+SGKDW+FIL QIG
Sbjct  342  IHGARIVANVVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSAKDQSGKDWSFILSQIG  401

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFS+TGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  402  MFSYTGLNRNQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  455



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAINV+C++ + A RVKSQLKRLARPMYSNPP
Sbjct  284  VRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICTAPEVADRVKSQLKRLARPMYSNPP  343

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+SGKDW+FIL QIG
Sbjct  344  IHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIG  403

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  404  MFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  457



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAINV+CS+ + A RVKSQLKRLARPMYSNPP
Sbjct  310  VRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICSAPEVADRVKSQLKRLARPMYSNPP  369

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+SGKDW+FIL QIG
Sbjct  370  IHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTEKDQSGKDWSFILSQIG  429

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  430  MFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  483



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FASRG E+ VAQSYSKNLGLYAERIGAINV+  +AD AARVKSQLKRLARPMYSNPP
Sbjct  237  VRKFASRGFEMFVAQSYSKNLGLYAERIGAINVILPTADLAARVKSQLKRLARPMYSNPP  296

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  LF+EW+ EM+MMAGRIK VRQKLY++L  KDKSGKDW+FILKQIG
Sbjct  297  VHGARIVANVVGDSVLFDEWRAEMQMMAGRIKGVRQKLYEALLSKDKSGKDWSFILKQIG  356

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFSFTGL K+QS+NM++KWH+YMTKDGRISLAGL+ AKC+YLADAIIDSYYNV
Sbjct  357  MFSFTGLTKSQSDNMTDKWHVYMTKDGRISLAGLNLAKCDYLADAIIDSYYNV  409



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FASRG E+ VAQSYSKNLGLYAERIGAINV+  +AD AARVKSQLKRLARPMYSNPP
Sbjct  237  VRKFASRGFEMFVAQSYSKNLGLYAERIGAINVILPTADLAARVKSQLKRLARPMYSNPP  296

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+  LF+EW+ EM+MMAGRIK VRQKLY++L  KDKSGKDW+FILKQIG
Sbjct  297  VHGARIVANVVGDSVLFDEWRAEMQMMAGRIKGVRQKLYEALLSKDKSGKDWSFILKQIG  356

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFSFTGL K+QS+NM++KWH+YMTKDGRISLAGL+ AKC+YLADAIIDSYYNV
Sbjct  357  MFSFTGLTKSQSDNMTDKWHVYMTKDGRISLAGLNLAKCDYLADAIIDSYYNV  409



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   303 bits (776),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAINV+C++ + A RVKSQLKRLARPMYSNPP
Sbjct  284  VRLFVKRGLEVFVAQSYSKNLGLYAERIGAINVICTAPEVADRVKSQLKRLARPMYSNPP  343

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+SGKDW+FIL QIG
Sbjct  344  IHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIG  403

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLA+AIIDS++NV+
Sbjct  404  MFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLAEAIIDSFHNVN  457



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+  +RG EL +AQSYSKNLGLYA+RIGAINV+ SS ++AAR+ SQLKR+ARPMYSNPP
Sbjct  292  VRLLVARGIELFIAQSYSKNLGLYAQRIGAINVISSSPESAARLTSQLKRIARPMYSNPP  351

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA++VGNP LF EWK  MEMMAGRIK+VRQ LYDS+S KDKSGKDW+FILKQIG
Sbjct  352  VHGARIVADLVGNPLLFEEWKAFMEMMAGRIKNVRQLLYDSISSKDKSGKDWSFILKQIG  411

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  412  MFSFTGLNKEQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  465



>prf||2009357A Asp aminotransferase
Length=463

 Score =   301 bits (771),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 160/175 (91%), Gaps = 4/175 (2%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F SRG E+LVAQSYSKNLGLYAER+G   V+ SS ++A RVKSQLKRLARPMYSNPP
Sbjct  292  VRLFVSRGMEVLVAQSYSKNLGLYAERVG---VISSSPESATRVKSQLKRLARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKSGKDW+FILKQIG
Sbjct  349  VHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKDKSGKDWSFILKQIG  408

Query  362  MFSFTGLNKAQSEN-MSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK+QS+N M+NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  409  MFSFTGLNKSQSDNMMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>gb|ACG59771.1| chloroplast aspartate aminotransferase [Triticum aestivum]
Length=368

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG E+ VAQSYSKNLGLYAERIGAI+V+CS+ + A RVKSQLKRLARPMYSNPP
Sbjct  202  VRLFVKRGLEVFVAQSYSKNLGLYAERIGAISVICSAPEVADRVKSQLKRLARPMYSNPP  261

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+SGKDW+FIL QIG
Sbjct  262  IHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIG  321

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAII  222
            MFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAII
Sbjct  322  MFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAII  368



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKN+GLYAERIGAINVVCSS D+A RVKSQLKRLAR M+SNPP
Sbjct  233  VRLFAARGMELLVAQSYSKNMGLYAERIGAINVVCSSPDSAQRVKSQLKRLARAMHSNPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIV NVVGN +LF+EW++E+ +MAGRIKSVR+KLYD LS KD SGKDW+F +K IG
Sbjct  293  VHGARIVTNVVGNSDLFSEWEEELRLMAGRIKSVRKKLYDCLSAKDMSGKDWSFFVKHIG  352

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            M+S++GLN+AQ ENM NKWH+YMTKDGR++L G+S AKCEYLADA IDSY+ V
Sbjct  353  MYSYSGLNEAQRENMRNKWHVYMTKDGRMALTGVSQAKCEYLADAFIDSYHYV  405



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+  +RG EL +A SY K++GLYA+RIGAINV+ SS ++AAR  SQLKR+ARPMYSNPP
Sbjct  292  VRLLVARGIELFIADSYPKDVGLYAQRIGAINVISSSPESAARDTSQLKRIARPMYSNPP  351

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA++V  P+LF+EWK EMEMMAGRIK+VRQ LYD +S KDKSGKDW+FILKQIG
Sbjct  352  VHGARIVADLVSKPQLFDEWKAEMEMMAGRIKNVRQLLYDPISSKDKSGKDWSFILKQIG  411

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            MFSFTGLNK QS+NM+NKWH+ MTKDGRIS AGLS AKCEYLADAIIDSY+NVS
Sbjct  412  MFSFTGLNKEQSDNMTNKWHVLMTKDGRISPAGLSLAKCEYLADAIIDSYHNVS  465



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG ELLVAQSY KNLGLY ERIGAIN+VCSS++ A RVKSQLK L RP YSNPP
Sbjct  280  VRLFVERGLELLVAQSYGKNLGLYGERIGAINIVCSSSETAVRVKSQLKWLIRPEYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD+SG+DW+FI+K+ G
Sbjct  340  LHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKDRSGRDWSFIVKENG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            +FSF GLNKAQ +NM NKWH+YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  400  IFSFIGLNKAQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  453



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F +RG E+LVAQSYSKNLGLYAERIGAINV+ SS ++AARVKSQLKR+ARPMYSNPP
Sbjct  290  VRLFVARGIEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRIARPMYSNPP  349

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKSG+  +       
Sbjct  350  VHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGQSASQYPDNCV  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            +    GLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  410  LPFIPGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>ref|XP_008784800.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=386

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 154/213 (72%), Gaps = 39/213 (18%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG ELLVAQSY KNLGLY ERIGAIN+VCSS++ A RVKSQLK L RP YSNPP
Sbjct  174  VRLFVERGLELLVAQSYGKNLGLYGERIGAINIVCSSSETAVRVKSQLKWLIRPEYSNPP  233

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD+SG+DW+FI+K+ G
Sbjct  234  LHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKDRSGRDWSFIVKENG  293

Query  362  MFSFTGLNKA---------------------------------------QSENMSNKWHI  300
            +FSF GLNKA                                       Q +NM NKWH+
Sbjct  294  IFSFIGLNKAQISNPHGSAYQIAHALAVSVFLILHAFWYVLHCVFVRLSQIDNMRNKWHV  353

Query  299  YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  354  YMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  386



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 154/213 (72%), Gaps = 39/213 (18%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F  RG ELLVAQSY KNLGLY ERIGAIN+VCSS++ A RVKSQLK L RP YSNPP
Sbjct  280  VRLFVERGLELLVAQSYGKNLGLYGERIGAINIVCSSSETAVRVKSQLKWLIRPEYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD+SG+DW+FI+K+ G
Sbjct  340  LHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKDRSGRDWSFIVKENG  399

Query  362  MFSFTGLNKA---------------------------------------QSENMSNKWHI  300
            +FSF GLNKA                                       Q +NM NKWH+
Sbjct  400  IFSFIGLNKAQISNPHGSAYQIAHALAVSVFLILHAFWYVLHCVFVRLSQIDNMRNKWHV  459

Query  299  YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  460  YMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  492



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+RG ELLVAQSYSKNLGLY ERIGAINV+CSSADAA RVKSQLKRLARPMYSNPP
Sbjct  289  VRLFAARGMELLVAQSYSKNLGLYGERIGAINVLCSSADAATRVKSQLKRLARPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KDKSGKDW++ILKQIG
Sbjct  349  IHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSAKDKSGKDWSYILKQIG  408

Query  362  MFSFTGLNKAQ  330
            MFSFTGLNKAQ
Sbjct  409  MFSFTGLNKAQ  419



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  719  RMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPI  540
            R FA RG ELLVAQSYSKNLGLYAER+GAIN V S A+AA RV SQLKR+AR +YSNPP+
Sbjct  283  RYFAGRGIELLVAQSYSKNLGLYAERVGAINFVLSDAEAAKRVMSQLKRIARALYSNPPV  342

Query  539  HGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGM  360
            HGARI + VV  PELF EW +EME M+GRIK VRQ L+D L+ K    KDW+FIL+Q+GM
Sbjct  343  HGARIASLVVSRPELFQEWNEEMEYMSGRIKDVRQVLHDELA-KLNGDKDWSFILRQLGM  401

Query  359  FSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            FSFTGLN AQ +NM+NK HIYMTKDGRISLAGL ++K  YLA AI DS+ N
Sbjct  402  FSFTGLNPAQVDNMTNKHHIYMTKDGRISLAGLPSSKAAYLAAAIDDSFRN  452



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = -2

Query  719  RMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPI  540
            R F  RG E  VAQSYSKNLGLYAER+GA++ V S A AA RV SQ+KR+AR +YSNPP+
Sbjct  271  RYFVERGLEFAVAQSYSKNLGLYAERVGAMSFVLSEAGAAQRVLSQMKRIARAIYSNPPV  330

Query  539  HGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGM  360
            HGARIVA VVG+ E+F EWK EMEMMAGRIK VRQ LYD+L ++    KDW+F+LKQIGM
Sbjct  331  HGARIVAEVVGSEEMFGEWKGEMEMMAGRIKGVRQDLYDAL-VEINPDKDWSFVLKQIGM  389

Query  359  FSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            F+FTG+   Q +NM+NKWH+YMTKDGR+SLAGLS+AK  YLA AI DS  N
Sbjct  390  FTFTGMTPQQCDNMTNKWHVYMTKDGRLSLAGLSSAKAAYLARAIDDSVRN  440



>gb|EPS71467.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=133

 Score =   231 bits (588),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -2

Query  605  AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY  426
            +A RV+SQ+KR+ARPMYSNPP+HGARIVANVVGNP+LF EWK EME+MAGRIKSVR+ LY
Sbjct  1    SACRVRSQIKRIARPMYSNPPVHGARIVANVVGNPDLFKEWKDEMEVMAGRIKSVRKLLY  60

Query  425  DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC  246
            + LS  D +GKDW+FIL+QIGMFSFTGLNK QSE M+ KWH+YMTKDGRISLAGLS+AKC
Sbjct  61   EELSRSDGTGKDWSFILRQIGMFSFTGLNKEQSEKMTGKWHVYMTKDGRISLAGLSSAKC  120

Query  245  EYLADAIIDSYYN  207
             YLA AI+DSY+N
Sbjct  121  SYLAGAIVDSYHN  133



>ref|XP_010527116.1| PREDICTED: aspartate aminotransferase, chloroplastic, partial 
[Tarenaya hassleriana]
Length=431

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA RG E  VAQSYSKNLGLYAERIGAIN +CSSADAAARVKSQLKRLARPMYSNPP
Sbjct  280  VRLFAERGMEFFVAQSYSKNLGLYAERIGAINAICSSADAAARVKSQLKRLARPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVANVVG+P LF EWK EME+MAGRIK+VRQ LYD L+ KDKSGKDW+FILKQIG
Sbjct  340  VHGARIVANVVGDPTLFGEWKAEMELMAGRIKNVRQMLYDRLAEKDKSGKDWSFILKQIG  399

Query  362  MFSFTGLNKAQ  330
            MFSFTGLNKAQ
Sbjct  400  MFSFTGLNKAQ  410



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 137/171 (80%), Gaps = 5/171 (3%)
 Frame = -2

Query  719  RMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPI  540
            R+F  RG E+LVAQSYSKNLGLYAERIGA+N+V +S+ AA RV SQLKR+AR +YSNPP+
Sbjct  220  RLFVERGLEVLVAQSYSKNLGLYAERIGALNIVLASSQAADRVLSQLKRIARAIYSNPPV  279

Query  539  HGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGM  360
            HGARIVA VVG+  +F EW  EME MAGRIK+VRQ LYD L+    S KDW+F    IGM
Sbjct  280  HGARIVAEVVGDAAMFGEWNVEMEEMAGRIKTVRQDLYDHLTRLLPS-KDWSF----IGM  334

Query  359  FSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            FSFTGL+  Q ENM+NKWH++MTKDGRISLAGL+ AK  YLA+AI+DS  N
Sbjct  335  FSFTGLSPQQVENMTNKWHVFMTKDGRISLAGLNRAKAGYLAEAIVDSVQN  385



>ref|XP_010042868.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Eucalyptus grandis]
Length=120

 Score =   218 bits (556),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  560  MYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTF  381
            MY +PP+HGA+IVAN+V +P LFN+WK EMEMMAGRIK+VRQKL DSLS KDKSGKDW+F
Sbjct  1    MYCSPPVHGAKIVANIVSDPALFNDWKAEMEMMAGRIKNVRQKLNDSLSAKDKSGKDWSF  60

Query  380  ILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  201
            ILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCEYLADAI+DSY+NVS
Sbjct  61   ILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEYLADAIVDSYHNVS  120



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 128/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  719  RMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPI  540
            R+F  RG E   AQSYSKNLGLYAERIGAIN V +  + AA+  SQ+ R+AR +YSNPP+
Sbjct  240  RLFERRGIEFFCAQSYSKNLGLYAERIGAINAVVNDKETAAKTLSQMNRIARAIYSNPPV  299

Query  539  HGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGM  360
            HGARI A V+ +P LF  W +EM  MAGRIK+VR  LYD+L  K    KDW+F+ +QIGM
Sbjct  300  HGARIAATVINDPALFARWNEEMGEMAGRIKTVRAMLYDNL-CKLNPDKDWSFVTRQIGM  358

Query  359  FSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSY  213
            FSFTGLN  Q ++M+ K  IYMT DGRISLAGLS AKCEYLA+AI+DS+
Sbjct  359  FSFTGLNPNQVKHMTEKHAIYMTGDGRISLAGLSQAKCEYLANAIVDSF  407



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = -2

Query  719  RMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPI  540
            R+F  +G E++V+QSYSKNLGLY ER+GA+ +V +  +AA R  SQLKRLAR +YSNPP 
Sbjct  258  RLFVEKGLEIVVSQSYSKNLGLYGERVGALVMVLNDKEAATRCLSQLKRLARALYSNPPT  317

Query  539  HGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGM  360
            HGARI A VV + ELF EWK EM  MAGRI+ VR +L  SL  K  S KDW+FI KQIGM
Sbjct  318  HGARIAAEVVNDKELFEEWKGEMRGMAGRIERVRGELQRSLESKYPS-KDWSFITKQIGM  376

Query  359  FSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            FSFTGL  AQ +NM+NK  I+MT+DGRISLAGL++AK +YLA+AI+DS  N
Sbjct  377  FSFTGLTPAQVDNMTNKHAIFMTRDGRISLAGLNSAKVDYLAEAIVDSVRN  427



>tpg|DAA57533.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=201

 Score =   211 bits (536),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  29   VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCKSADVAVRVESQLKLVIRPMYSNPP  88

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ + E+FNEW  E++ MA RI ++RQ+L+++L  +   G DW+ I+KQIG
Sbjct  89   LHGASIVATILRDSEMFNEWTLELKAMADRIINMRQQLFNALKSRGTPG-DWSHIIKQIG  147

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  148  MFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSMRTVPHLADAI  193



>gb|KIZ05915.1| aspartate aminotransferase [Monoraphidium neglectum]
Length=345

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = -2

Query  719  RMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPI  540
            R+F   G E++VAQSYSKNLGLY ER+GA+N V + +++A RV SQLKR+AR ++SNPP 
Sbjct  175  RLFVDNGLEVVVAQSYSKNLGLYGERVGALNFVLADSESAKRVLSQLKRIARALWSNPPT  234

Query  539  HGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGM  360
            HGARI A VVG+  +F EWK EM  MAGRI  VR +L  +L  K  + KDW+F+ KQIGM
Sbjct  235  HGARIAAEVVGDAAMFEEWKGEMAGMAGRISKVRGELRAALE-KRMADKDWSFVTKQIGM  293

Query  359  FSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            FS+TG++  Q +NM+NK  +YMT+DGRISLAGLS+AK +YLADAI+DS  N
Sbjct  294  FSYTGMSPQQVDNMTNKHAVYMTRDGRISLAGLSSAKVDYLADAIVDSVRN  344



>ref|XP_010519716.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X1 [Tarenaya hassleriana]
Length=340

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L+AQSY+KNLGLY ER+GA+++VC SAD A++V+SQ+K + RPMYSNPP
Sbjct  168  VRMFVADGGECLIAQSYAKNLGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSNPP  227

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ N E++NEW  E++ MA RI S+R +LYD+L  +   G DW+ I+KQIG
Sbjct  228  IHGASIVATILKNSEMYNEWTIELKGMADRIISMRHQLYDALQARGTPG-DWSHIIKQIG  286

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  287  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  332



>ref|XP_002514283.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF48237.1| aspartate aminotransferase, putative [Ricinus communis]
Length=404

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  232  VRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTADVASRVESQLKLVIRPMYSNPP  291

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS +   G DW+ I+KQIG
Sbjct  292  IHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARGTPG-DWSHIIKQIG  350

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  351  MFTFTGLNSEQVAFMTKEYHIYMTADGRISMAGLSSKTVPHLADAI  396



>ref|XP_010519717.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X2 [Tarenaya hassleriana]
Length=405

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L+AQSY+KNLGLY ER+GA+++VC SAD A++V+SQ+K + RPMYSNPP
Sbjct  233  VRMFVADGGECLIAQSYAKNLGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSNPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ N E++NEW  E++ MA RI S+R +LYD+L  +   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKNSEMYNEWTIELKGMADRIISMRHQLYDALQARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  352  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>gb|AAM91546.1| aspartate aminotransferase Asp2 [Arabidopsis thaliana]
Length=201

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  29   VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  88

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  +   G DW+ I+KQIG
Sbjct  89   IHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTPG-DWSHIIKQIG  147

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  148  MFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  193



>tpg|DAA57534.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=171

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = -2

Query  716  MFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPIH  537
            MF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP+H
Sbjct  1    MFVADGGELLMAQSYAKNMGLYGERVGALSIVCKSADVAVRVESQLKLVIRPMYSNPPLH  60

Query  536  GARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMF  357
            GA IVA ++ + E+FNEW  E++ MA RI ++RQ+L+++L  +   G DW+ I+KQIGMF
Sbjct  61   GASIVATILRDSEMFNEWTLELKAMADRIINMRQQLFNALKSRGTPG-DWSHIIKQIGMF  119

Query  356  SFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            +FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  120  TFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSMRTVPHLADAI  163



>sp|P37833.1|AATC_ORYSJ RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Oryza sativa Japonica Group]
 dbj|BAA03504.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAB61211.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC78585.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|ABL74572.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|EAY75902.1| hypothetical protein OsI_03821 [Oryza sativa Indica Group]
 gb|EAZ13614.1| hypothetical protein OsJ_03530 [Oryza sativa Japonica Group]
Length=407

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  235  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVESQLKLVIRPMYSNPP  294

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++  G DW+ I+KQIG
Sbjct  295  IHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQLFDALKTRETPG-DWSHIIKQIG  353

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  354  MFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  399



>gb|KDP33689.1| hypothetical protein JCGZ_07260 [Jatropha curcas]
Length=407

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F   G E LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  235  VRLFVGDGGECLVAQSYAKNMGLYGERVGALSIVCKTADVASRVESQLKLVIRPMYSNPP  294

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ N +L+NEW  E++ MA RI S+R +L+D+L+ +   G DW+ I+KQIG
Sbjct  295  IHGASIVATILKNSDLYNEWTIELKAMADRIISMRHQLFDALTARGTPG-DWSHIMKQIG  353

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  354  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  399



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 129/171 (75%), Gaps = 1/171 (1%)
 Frame = -2

Query  719  RMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPI  540
            R+F  RG E++V+QSYSKNLGLY ER+GA+ +V    + A R  SQLKRLAR +YSNPP 
Sbjct  268  RLFVDRGLEIMVSQSYSKNLGLYGERVGALVMVLKDKEPATRCLSQLKRLARALYSNPPT  327

Query  539  HGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGM  360
            HGARI A VV + ELF EWK EM  MAGRI+ VR +L  +L  K    KDW+FI KQIGM
Sbjct  328  HGARIAAEVVNDKELFEEWKGEMRGMAGRIERVRGELQRALEAK-YPDKDWSFITKQIGM  386

Query  359  FSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            F+FTGL  AQ +NM+NK  ++MT+DGRISLAGL++AK EYLA+AI++S  N
Sbjct  387  FTFTGLTPAQVDNMTNKHSVFMTRDGRISLAGLNSAKVEYLANAIVESVRN  437



>emb|CDX70399.1| BnaC03g04830D [Brassica napus]
Length=450

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G ELLVAQSY+KN+GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  278  IRMFVADGGELLVAQSYAKNMGLYGERVGALSIVCKAADVAGRVESQLKLVIRPMYSNPP  337

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DWT I+KQIG
Sbjct  338  IHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWTHIIKQIG  396

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  397  MFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  442



>ref|XP_006644742.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Oryza 
brachyantha]
Length=458

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  286  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVESQLKLVIRPMYSNPP  345

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++  G DW+ I+KQIG
Sbjct  346  IHGASIVATILKDSVMFNEWTVELKAMADRIISMRQQLFDALKTRETPG-DWSHIIKQIG  404

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  405  MFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  450



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = -2

Query  719  RMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPI  540
            R+FA  G E   AQSYSKNLGLYAERIGA+N V + A AA    SQ+ R+AR MYSNPP+
Sbjct  240  RLFAEMGMEFFCAQSYSKNLGLYAERIGALNAVLNDATAATNTLSQMNRIARAMYSNPPV  299

Query  539  HGARIVANVVGNPELF---NEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQ  369
            HGARI A V+ +PELF   + W  EM  MAGRIK+VR++L++ L+ +    KDW+F+ +Q
Sbjct  300  HGARIAATVINDPELFQARSRWNDEMGTMAGRIKTVRRELFEELT-RLNPDKDWSFVTRQ  358

Query  368  IGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            IGMFSFTGL+ AQ E M+    I+MTKDGRISLAGLS+AK +YLA+AI DS+ N
Sbjct  359  IGMFSFTGLSPAQVERMTGTHKIFMTKDGRISLAGLSSAKVKYLANAIDDSFRN  412



>ref|XP_009131210.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Brassica 
rapa]
 emb|CDX78428.1| BnaA03g03400D [Brassica napus]
Length=452

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G ELLVAQSY+KN+GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  280  IRMFVADGGELLVAQSYAKNMGLYGERVGALSIVCKAADVAGRVESQLKLVIRPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DWT I+KQIG
Sbjct  340  IHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWTHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  399  MFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|NP_001044317.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAD87343.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06231.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAG96155.1| unnamed protein product [Oryza sativa Japonica Group]
Length=460

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  288  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVESQLKLVIRPMYSNPP  347

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++  G DW+ I+KQIG
Sbjct  348  IHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQLFDALKTRETPG-DWSHIIKQIG  406

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  407  MFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  452



>ref|XP_011043495.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
 ref|XP_011014875.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=407

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  235  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASRVESQLKLVIRPMYSNPP  294

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS +   G DW+ I+KQIG
Sbjct  295  IHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARGTPG-DWSHIIKQIG  353

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  354  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPLLADAI  399



>ref|XP_007013138.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
 gb|EOY30757.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
Length=405

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  233  VRMFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVESQLKLVIRPMYSNPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA I A ++ N +++NEWK E++ MA RI S+R++L+D+LS +   G DW+ I+KQIG
Sbjct  293  IHGASIAATILKNSDMYNEWKIELKAMAERIISMRKQLFDALSARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  352  MFTFTGLNSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_004970037.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Setaria 
italica]
Length=460

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  288  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVESQLKLVIRPMYSNPP  347

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HG  IVA ++ + E+FNEW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  348  LHGPSIVATILKDSEMFNEWTLELKAMADRIISMRQQLFDALKSRGTPG-DWSHIIKQIG  406

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  407  MFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSTRTVPHLADAI  452



>ref|XP_011048396.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Populus 
euphratica]
Length=407

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  235  VRMFVADGGECLAAQSYAKNMGLYGERVGALSMVCKTADVASRVESQLKLVIRPMYSNPP  294

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS +   G DW+ I+KQIG
Sbjct  295  IHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARGTPG-DWSHIIKQIG  353

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  354  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPLLADAI  399



>gb|ACU21245.1| unknown [Glycine max]
Length=344

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SAD A+RV+SQLK + RPMYS+PP
Sbjct  172  VRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVESQLKLVIRPMYSSPP  231

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFN+W  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  232  IHGASIVAAILKDRDLFNDWTIELKAMADRIINMRQELFDALRSRGTPG-DWSHIIKQIG  290

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  291  MFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAGLSSKTVPLLADAI  336



>emb|CDP03316.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF S G E LVAQSY+KN+G+Y ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  238  VRMFVSDGGECLVAQSYAKNMGMYGERVGALSIVCKSADVAVRVESQLKLVIRPMYSNPP  297

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +++EW  E++ MA RI S+RQKL+D+L  +   G DW+ I+KQIG
Sbjct  298  IHGASIVAAILKDSHMYHEWTVELKAMADRIISMRQKLFDALQARGTPG-DWSHIIKQIG  356

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  357  MFTFTGLNAQQVAFMTKEYHIYMTSDGRISMAGLSSQTVPLLADAI  402



>ref|XP_006833326.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
 gb|ERM98604.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
Length=452

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G EL  AQSY+KN+GLY ER+GA++VVC SA  A RV+SQLK + RPMYSNPP
Sbjct  280  VRMFVADGGELFAAQSYAKNMGLYGERVGALSVVCKSAAVAGRVESQLKLVIRPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++G+  LFNEW  E++ MA RI S+R++LYD+L  +   G DW+ I+KQIG
Sbjct  340  LHGASIVAKILGDRNLFNEWTVELKAMADRIISMRKQLYDALCSRGTPG-DWSHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  399  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  444



>ref|XP_005643912.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE19368.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=440

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +R+FA  G ELL+AQSY+KN+GLY ER+GA++V+  SAD   RV+SQLK++ RPM+SNPP
Sbjct  269  IRLFADAGLELLLAQSYAKNMGLYGERVGALSVITKSADVTKRVESQLKQVIRPMFSNPP  328

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
             HGA IV  V+ +P L+ EW++E++ MAGRI  +RQ+L+ +L      G  W  IL QIG
Sbjct  329  RHGAAIVVEVLSDPSLYAEWREELKGMAGRIMQMRQELFRALQQVGAPG-SWNHILDQIG  387

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  216
            MFSFTGL K Q   M++KWH+YMT DGRIS+AGLS++KC YLA+AI D+
Sbjct  388  MFSFTGLTKEQVRVMTDKWHVYMTFDGRISMAGLSSSKCHYLAEAINDA  436



>ref|XP_006450636.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63876.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=449

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E  +AQSY+KNLGLY ER+GA+++VC +AD A RV+SQ+K + RPMYSNPP
Sbjct  277  VRMFVADGGECFIAQSYAKNLGLYGERVGALSIVCKTADVAGRVESQVKLVIRPMYSNPP  336

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  +   G DW+ I+KQIG
Sbjct  337  IHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRARGTPG-DWSHIIKQIG  395

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  396  MFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>gb|ABY58643.1| aspartate aminotransferase [Triticum aestivum]
Length=380

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A +V+SQLK + RPMYSNPP
Sbjct  214  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADIAVKVESQLKLVIRPMYSNPP  273

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+D+L +++  G DW+ I+KQIG
Sbjct  274  LHGASIVATILKDSAMFDEWTVELKAMADRIISMREQLFDALKIRETPG-DWSHIIKQIG  332

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  333  MFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  378



>ref|XP_008466236.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Cucumis melo]
Length=460

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G E  VAQSY+KNLGLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  288  VRLFVADGGECFVAQSYAKNLGLYGERVGALSIVCKNADVASRVESQLKLVIRPMYSNPP  347

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA V+ + +LFNEW  E++ MA RI S+RQ+L+++L  +   G DW+ I+KQIG
Sbjct  348  IHGASIVATVLKDRDLFNEWTVELKAMADRIISMRQQLFEALRARGTPG-DWSHIIKQIG  406

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  407  MFTFTGLNSEQVSFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  452



>ref|XP_011019648.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=449

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ERIGA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  277  VRMFVADGGELLLAQSYAKNMGLYGERIGALSIVCKTADVAGRVESQLKLVIRPMYSNPP  336

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+NEW  E++ MA RI S+RQKL+++L  +   G DW+ I+KQIG
Sbjct  337  IHGASIVAAILKDRDLYNEWTIELKAMADRIISMRQKLFEALRARGTPG-DWSHIVKQIG  395

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  396  MFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAM  441



>ref|XP_002308618.1| aspartate transaminase family protein [Populus trichocarpa]
 gb|EEE92141.1| aspartate transaminase family protein [Populus trichocarpa]
Length=449

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ERIGA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  277  VRMFVADGGELLLAQSYAKNMGLYGERIGALSIVCKTADVAGRVESQLKLVIRPMYSNPP  336

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+NEW  E++ MA RI S+RQKL+++L  +   G DW+ I+KQIG
Sbjct  337  IHGASIVAAILKDRDLYNEWTIELKAMADRIISMRQKLFEALHARGTPG-DWSHIVKQIG  395

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  396  MFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAM  441



>ref|XP_004136291.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004168053.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN60208.1| hypothetical protein Csa_3G889160 [Cucumis sativus]
Length=464

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G E  VAQSY+KNLGLY ER+GA+++VC +AD A+RV+SQLK + RPMYS+PP
Sbjct  292  VRLFVADGGECFVAQSYAKNLGLYGERVGALSIVCKNADVASRVESQLKLVIRPMYSSPP  351

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA V+ + +LFNEW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  352  IHGASIVATVLKDRDLFNEWTVELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  411  MFTFTGLNSEQVSFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  456



>ref|XP_002324997.1| aspartate aminotransferase family protein [Populus trichocarpa]
 gb|ABK95824.1| unknown [Populus trichocarpa]
 gb|EEF03562.1| aspartate aminotransferase family protein [Populus trichocarpa]
Length=407

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC  AD A+RV+SQLK + RPMYSNPP
Sbjct  235  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKKADVASRVESQLKLVIRPMYSNPP  294

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++NEW  E++ MA RI S+RQ+L+D+LS +   G DW+ I+KQIG
Sbjct  295  IHGASIVATILKDRDMYNEWTVELKAMADRIISMRQQLFDALSARGTPG-DWSHIIKQIG  353

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  354  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  399



>ref|XP_006476088.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=449

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E  +AQSY+KNLGLY ER+GA+++VC +AD A RV+SQ+K + RPMYSNPP
Sbjct  277  VRMFVADGGECFIAQSYAKNLGLYGERVGALSIVCKTADVAGRVESQVKLVIRPMYSNPP  336

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  +   G DW+ I KQIG
Sbjct  337  IHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRARGTPG-DWSHIFKQIG  395

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  396  MFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>emb|CBI20886.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQ+K + RPM+SNPP
Sbjct  250  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASRVESQVKLVIRPMFSNPP  309

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ N +++NEW  E++ MA RI S+RQ+L+D+L  +   G DW  ILKQIG
Sbjct  310  IHGASIVAIILKNRDMYNEWTVELKAMADRIISMRQQLFDALRARGTPG-DWNHILKQIG  368

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++H+YMT DGRIS+AGLS+    +LADAI
Sbjct  369  MFTFTGLNTAQVAFMTKEYHVYMTSDGRISMAGLSSKTVPHLADAI  414



>gb|AAC50015.1| aspartate aminotransferase cytosolic isozyme AAT2 [Glycine max]
Length=419

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SAD A+RV+SQLK + RPMYS+PP
Sbjct  247  VRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVESQLKLVIRPMYSSPP  306

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFN+W  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  307  IHGASIVAAILKDRNLFNDWTIELKAMADRIISMRQELFDALCSRGTPG-DWSHIIKQIG  365

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  366  MFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAGLSSKTVPLLADAI  411



>gb|KDP34208.1| hypothetical protein JCGZ_07779 [Jatropha curcas]
Length=454

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELLVAQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  282  VRMFVADGGELLVAQSYAKNMGLYGERVGALSIVCRTADVASRVESQLKLVIRPMYSNPP  341

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  L+NEW  E++ MA RI  +RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  342  IHGASIVAFILKDRNLYNEWTIELKAMADRIICMRQQLFDALHARGTPG-DWSHIIKQIG  400

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  401  MFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  446



>emb|CDM84293.1| unnamed protein product [Triticum aestivum]
Length=454

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A +V+SQLK + RPMYSNPP
Sbjct  282  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADIAVKVESQLKLVIRPMYSNPP  341

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+D+L +++  G DW+ I+KQIG
Sbjct  342  LHGASIVATILKDSAMFDEWTVELKAMADRIISMREQLFDALKIRETPG-DWSHIIKQIG  400

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  401  MFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  446



>gb|KHG23914.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=452

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E  VAQSY+KN+GLY ER+GA++VVC++AD A++V+SQLK + RPM+SNPP
Sbjct  280  IRMFVADGGECFVAQSYAKNMGLYGERVGALSVVCTAADVASKVESQLKLVIRPMFSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  +   G DW+ I+KQIG
Sbjct  340  IHGASIVATILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARGTPG-DWSHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  399  MFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>gb|KHN10226.1| Aspartate aminotransferase 1 [Glycine soja]
Length=416

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SAD A+RV+SQLK + RPMYS+PP
Sbjct  244  VRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVESQLKLVIRPMYSSPP  303

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFN+W  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  304  IHGASIVAAILKDRDLFNDWTIELKAMADRIINMRQELFDALRSRGTPG-DWSHIIKQIG  362

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  363  MFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAGLSSKTVPLLADAI  408



>emb|CAN70394.1| hypothetical protein VITISV_020521 [Vitis vinifera]
Length=411

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  239  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKAADVASRVESQLKLVIRPMYSNPP  298

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++NEW  E++ MA RI S+RQ L+D+L  +   G DW+ I+KQIG
Sbjct  299  IHGASIVATILKDSDMYNEWTXELKAMADRIISMRQLLFDTLRDRGTPG-DWSHIIKQIG  357

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  358  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  403



>ref|XP_002284136.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
Length=450

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQ+K + RPM+SNPP
Sbjct  278  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASRVESQVKLVIRPMFSNPP  337

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ N +++NEW  E++ MA RI S+RQ+L+D+L  +   G DW  ILKQIG
Sbjct  338  IHGASIVAIILKNRDMYNEWTVELKAMADRIISMRQQLFDALRARGTPG-DWNHILKQIG  396

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++H+YMT DGRIS+AGLS+    +LADAI
Sbjct  397  MFTFTGLNTAQVAFMTKEYHVYMTSDGRISMAGLSSKTVPHLADAI  442



>gb|KHG24168.1| Aspartate aminotransferase, cytoplasmic [Gossypium arboreum]
Length=405

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  233  VRMFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVESQLKLVIRPMYSNPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K   G DW+ I+KQIG
Sbjct  293  IHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGL+  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  352  MFTFTGLDSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_002873517.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49776.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYS+PP
Sbjct  277  IRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVESQLKLVIRPMYSSPP  336

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DW+ I+KQIG
Sbjct  337  IHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRGTPG-DWSHIIKQIG  395

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  396  MFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_007012061.1| Aspartate aminotransferase 3 [Theobroma cacao]
 gb|EOY29680.1| Aspartate aminotransferase 3 [Theobroma cacao]
Length=450

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E  VAQSY+KN+GLY ER+GA++VVC +AD A+RV+SQLK + RPM+SNPP
Sbjct  279  VRMFVADGGECFVAQSYAKNMGLYGERVGALSVVCKTADVASRVESQLKLVIRPMFSNPP  338

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA V+ +  ++NEW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  339  IHGASIVATVLKDRNMYNEWTIELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIG  397

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  398  MFTFTGLNSEQVAFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  443



>ref|XP_010100270.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB82277.1| Aspartate aminotransferase [Morus notabilis]
Length=463

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  291  VRLFAADGGECLIAQSYAKNMGLYGERVGALSIVCKTADVASRVESQLKLVIRPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  351  IHGASIVAIILKDRDLYNEWTIELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  410  MFTFTGLNAEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLVDAI  455



>ref|NP_001237541.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|AAC50014.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|KHN18198.1| Aspartate aminotransferase 1 [Glycine soja]
Length=456

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SAD A+RV+SQLK + RPMYS+PP
Sbjct  284  VRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSADVASRVESQLKLVIRPMYSSPP  343

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFN+W  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  344  IHGASIVAAILKDRNLFNDWTIELKAMADRIISMRQELFDALCSRGTPG-DWSHIIKQIG  402

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  403  MFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAGLSSKTVPLLADAI  448



>ref|XP_008789337.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Phoenix dactylifera]
Length=463

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G E L AQSY+KN+GLY ER+GA+++VCSSAD A RV+SQLK + RPMYSNPP
Sbjct  291  VRIFVADGGECLTAQSYAKNMGLYGERVGALSIVCSSADVAVRVESQLKLVIRPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LF+EW  E++ MA RI S+RQ L+D+L  +   G DW+ I+KQIG
Sbjct  351  IHGASIVATILKDRALFHEWTIELKAMADRIISMRQLLFDALHARGTPG-DWSHIIKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN+ Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  410  MFTFTGLNREQVAFMTQEYHIYMTSDGRISMAGLSSKTVPHLADAI  455



>ref|XP_010420761.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Camelina sativa]
Length=405

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  +   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNNWTVELKEMADRIKSMRQQLFDAIQARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  352  MFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_002284313.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
 emb|CBI28052.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  239  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKAADVASRVESQLKLVIRPMYSNPP  298

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++NEW  E++ MA RI S+RQ L+D+L  +   G DW+ I+KQIG
Sbjct  299  IHGASIVATILKDSDMYNEWTLELKAMADRIISMRQLLFDTLRDRGTPG-DWSHIIKQIG  357

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  358  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  403



>gb|AEX09182.1| putative aspartate aminotransferase 1 [Gossypium hirsutum]
Length=405

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK L RPMYSNPP
Sbjct  233  VRMFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVESQLKLLIRPMYSNPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K   G DW+ I+KQIG
Sbjct  293  IHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGL+  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  352  MFTFTGLDSDQVAFMIKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_002516566.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF45907.1| aspartate aminotransferase, putative [Ricinus communis]
Length=440

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELLV QSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  268  VRMFVADGGELLVVQSYAKNMGLYGERVGALSIVCRTADVASRVESQLKLVIRPMYSNPP  327

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  L++EW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  328  IHGASIVAFILKDRNLYSEWTIELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIG  386

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  387  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  432



>ref|XP_010454237.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  +   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFDAIQARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  352  MFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|NP_001141224.1| uncharacterized protein LOC100273311 [Zea mays]
 gb|ACF85765.1| unknown [Zea mays]
 tpg|DAA57530.1| TPA: aspartate aminotransferase [Zea mays]
Length=459

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  287  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCKSADVAVRVESQLKLVIRPMYSNPP  346

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ + E+FNEW  E++ MA RI ++RQ+L+++L  +   G DW+ I+KQIG
Sbjct  347  LHGASIVATILRDSEMFNEWTLELKAMADRIINMRQQLFNALKSRGTPG-DWSHIIKQIG  405

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  406  MFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSMRTVPHLADAI  451



>ref|XP_009395718.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  249  VRMFVADGGECLTAQSYAKNMGLYGERVGALSIVCKSADVATRVESQLKLVIRPMYSNPP  308

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + EL++EW  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  309  IHGASIVATILKDRELYHEWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIG  367

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  368  MFTFTGLNTEQVTFMTKEYHIYMTSDGRISMAGLSSKTVPHLVDAI  413



>ref|XP_009401092.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   205 bits (521),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            + +F  RG ELLVAQSYSK LGLYAERIGAINVVC S+DAAARVK QLKRLARPMYSNPP
Sbjct  104  ISLFVDRGLELLVAQSYSKKLGLYAERIGAINVVCLSSDAAARVKIQLKRLARPMYSNPP  163

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGARIVAN+  +P LF+E KQEME+MAGRIK+VR++L+++LS KDK   DW++ILKQIG
Sbjct  164  VHGARIVANIARDPNLFDERKQEMELMAGRIKNVRRRLHENLSQKDKRRSDWSYILKQIG  223

Query  362  MFSFTGLNKAQ  330
              S+TGLN+AQ
Sbjct  224  TSSYTGLNEAQ  234



>ref|NP_196713.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
 sp|P46644.1|AAT3_ARATH RecName: Full=Aspartate aminotransferase 3, chloroplastic; AltName: 
Full=Protein YELLOW-LEAF-SPECIFIC GENE 4; AltName: Full=Transaminase 
A; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA79371.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB87712.1| aspartate aminotransferase (Asp3) [Arabidopsis thaliana]
 gb|AAK92700.1| putative aspartate aminotransferase Asp3 [Arabidopsis thaliana]
 gb|AAL85041.1| putative aspartate aminotransferase ASP3 [Arabidopsis thaliana]
 gb|AED91691.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
Length=449

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYS+PP
Sbjct  277  IRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVESQLKLVIRPMYSSPP  336

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DW+ I+KQIG
Sbjct  337  IHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRGTPG-DWSHIIKQIG  395

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  396  MFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_001771002.1| predicted protein [Physcomitrella patens]
 gb|EDQ64157.1| predicted protein [Physcomitrella patens]
Length=409

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G E  VAQSY+KN+GLY ER+GA++VVC++A  A+RV SQLK + RPMYS+PP
Sbjct  234  VRLFVADGGECFVAQSYAKNMGLYGERVGALSVVCTNAAVASRVDSQLKLVIRPMYSSPP  293

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
             HGA I A ++ +  LF EW  E++ MA RI S+RQ+LYD+L  +   G DWT +LKQIG
Sbjct  294  AHGAAIAATILADGRLFQEWTVELKGMADRIISMRQQLYDALQARGTPG-DWTHVLKQIG  352

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK+Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  353  MFTFTGLNKSQVEFMTRQYHIYMTSDGRISMAGLSSKTVPHLADAI  398



>ref|XP_002871893.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48152.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  +   G DWT I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTPG-DWTHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  352  MFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>gb|KJB07521.1| hypothetical protein B456_001G028100 [Gossypium raimondii]
Length=452

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E  VAQSY+KN+GLY ER+GA++VVC +AD A++V+SQLK + RPM+SNPP
Sbjct  280  IRMFVADGGECFVAQSYAKNMGLYGERVGALSVVCRAADVASKVESQLKLVIRPMFSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  +   G DW+ I+KQIG
Sbjct  340  IHGASIVATILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARGTPG-DWSHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  399  MFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_002954714.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ44120.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=426

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F   G EL++AQS++KN+GLY ER GA++VV  + + A RV+SQLK + RPMYSNPP
Sbjct  255  VRLFLEAGLELVLAQSFAKNMGLYGERAGALSVVSKTKEVATRVESQLKLVVRPMYSNPP  314

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA I A V+G+P+L   WK+E+  MA RIKS+RQ LYD L  ++  G DW+F+LKQIG
Sbjct  315  MHGAAIAARVMGDPKLNALWKEELRGMAERIKSMRQVLYDQLVARNVPG-DWSFVLKQIG  373

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            MFSFTG+ + Q E + +KWH+++T DGRIS+AGLSAA   YLA+AI D   N
Sbjct  374  MFSFTGMTRHQCEQLVSKWHVHLTLDGRISMAGLSAATAPYLAEAIADVIQN  425



>ref|XP_011090162.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=460

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMFA  G E LVAQSY+KN+GLY ER+GA+++VC SAD A+RV+SQLK + RPMYSNPP
Sbjct  288  VRMFAKDGGECLVAQSYAKNMGLYGERVGALSIVCRSADVASRVESQLKLVIRPMYSNPP  347

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  ++ EW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  348  IHGASIVATILKDRSMYQEWTIELKAMAERIISMRQQLFDALRSRGTPG-DWSHIIKQIG  406

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  407  MFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  452



>emb|CDP16161.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E LVAQSY+KN+GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  248  VRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCRAADVAGRVESQLKLVIRPMYSNPP  307

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +F+EW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  308  IHGASIVATILKDRNMFHEWTLELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIG  366

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  367  MFTFTGLNSEQVTFMRKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  412



>ref|XP_010693429.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L+AQSY+KN+GLY ER+GA+++VC++AD A RV+SQLK + RPM+SNPP
Sbjct  279  VRMFVADGGECLLAQSYAKNMGLYGERVGALSIVCNTADVANRVESQLKLVTRPMFSNPP  338

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +++EW  E++ MA RI S+RQKL+D+L  +   G DW+ I+KQIG
Sbjct  339  IHGASIVATILRDRNMYDEWTVELKAMAERIISMRQKLFDALQTRGTPG-DWSHIIKQIG  397

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  398  MFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSKTIPHLADAM  443



>ref|XP_004245266.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=452

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E+LVAQSY+KN+GLY ER+GA+++VC +AD  +RV+SQLK + RPMYSNPP
Sbjct  280  VRMFVADGGEVLVAQSYAKNMGLYGERVGALSIVCRNADVTSRVESQLKLVIRPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  L++EW  E++ MA RI  +RQ+L+D+L  K   G DW+ I+KQIG
Sbjct  340  IHGASIVATILKDRNLYHEWTLELKAMADRIIRMRQQLFDALRAKGTPG-DWSHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  399  MFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  444



>ref|XP_001695040.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP02192.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=433

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 131/174 (75%), Gaps = 3/174 (2%)
 Frame = -2

Query  722  VRMFASRG--XELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSN  549
            VR+FAS     E+++AQS++KN+GLY ER GA++VVC S + A RV+SQLK + RPMYSN
Sbjct  257  VRLFASAPGPQEMVLAQSFAKNMGLYGERAGALSVVCKSKEVAGRVESQLKLVIRPMYSN  316

Query  548  PPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQ  369
            PP+HGA I A V+ +P L   WK+E+  MA RIK++RQ LY  L  +   G DW+F+LKQ
Sbjct  317  PPMHGAAIAARVMADPRLNALWKEELAGMAHRIKAMRQALYGQLVARQLPG-DWSFVLKQ  375

Query  368  IGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  207
            IGMFS+TGL+KAQ E ++ KWHI++T DGRIS+AGLSAA C YLA+AI D   N
Sbjct  376  IGMFSYTGLSKAQCEVLTRKWHIHLTMDGRISMAGLSAASCPYLAEAIADVVTN  429



>ref|XP_009762342.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=409

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC  AD A+RV+SQLK + RPMYSNPP
Sbjct  237  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKDADVASRVESQLKLVIRPMYSNPP  296

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + ++++EW  E++ MA RI S+RQ+L+D+L  +  +G DW+ I+KQIG
Sbjct  297  IHGASIVATILKDRQMYDEWTIELKAMADRIISMRQQLFDALQARGTTG-DWSHIIKQIG  355

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  356  MFTFTGLNTEQVSFMTREHHIYMTSDGRISMAGLSSRTIPHLADAI  401



>ref|XP_003569862.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Brachypodium 
distachyon]
Length=464

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A +V+SQLK + RPMYSNPP
Sbjct  292  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVKVESQLKLVIRPMYSNPP  351

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ N ++F EW  E++ MA RI S+RQ+L+++L+++   G DW+ I+KQIG
Sbjct  352  LHGATIVATILNNRDMFEEWTIELKGMANRIISMRQQLFNALNIRGTPG-DWSHIIKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+   ++LA+AI
Sbjct  411  MFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVDHLANAI  456



>gb|EMT25743.1| Aspartate aminotransferase, cytoplasmic [Aegilops tauschii]
Length=407

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A +V+SQLK + RPMYSNPP
Sbjct  235  VRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADIAVKVESQLKLVIRPMYSNPP  294

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+++L +++  G DW+ I+KQIG
Sbjct  295  LHGASIVATILKDSAMFDEWTLELKAMADRIISMREQLFNALKIRETPG-DWSHIIKQIG  353

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  354  MFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  399



>ref|XP_005843806.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
 gb|EFN51704.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
Length=406

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +R+F   G ELL+AQS++KN+GLY ER+GA+ V+   + AA +V+SQLK  AR MYSNPP
Sbjct  235  IRLFCDAGLELLLAQSFAKNMGLYGERVGALTVIVGDSAAAKKVESQLKITARQMYSNPP  294

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
             HGA I   ++ +P+L+ +WK E++ MA RI ++RQ+LY +L      G DW  IL+QIG
Sbjct  295  RHGASIATRILADPQLYAQWKVELKGMADRILTMRQQLYQALQEVGAPG-DWGHILRQIG  353

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  204
            MFS+TGL KAQ ENM+NKWH+YMT DGRIS+AGLS++KC YLA A+ DS  N 
Sbjct  354  MFSYTGLTKAQVENMTNKWHVYMTFDGRISMAGLSSSKCGYLAQAMKDSVENC  406



>ref|XP_004501184.1| PREDICTED: aspartate aminotransferase 1-like [Cicer arietinum]
Length=458

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +R+F + G ELL AQSY+KN+GLY ER+GA+++VC SAD A+RV+SQLK + RPMYS+PP
Sbjct  286  IRLFVADGGELLAAQSYAKNMGLYGERVGALSIVCKSADVASRVESQLKLVIRPMYSSPP  345

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+NEW  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  346  IHGASIVAAILKDRDLYNEWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIG  404

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  405  MFTFTGLNPEQVSFMTKEYHIYMTSDGRISMAGLSSRTVSHLADAI  450



>ref|XP_006289742.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
 gb|EOA22640.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
Length=452

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQSY+KN+GLY ER+GA+++VC S+D A RV+SQLK + RPMYS+PP
Sbjct  280  IRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSSDVAGRVESQLKLVIRPMYSSPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DW+ I+KQIG
Sbjct  340  IHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRTRGTPG-DWSHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  399  MFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_006287876.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
 gb|EOA20774.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
Length=405

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVVSQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  +   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFDAIQARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  352  MFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_009617506.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=409

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC  AD A+RV+SQLK + RPMYSNPP
Sbjct  237  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKDADVASRVESQLKLVIRPMYSNPP  296

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + ++++EW  E++ MA RI S+RQ+L+D+L  +  +G DW+ I+KQIG
Sbjct  297  IHGASIVATILKDRQMYDEWTIELKAMADRIISMRQQLFDALQARGTAG-DWSHIIKQIG  355

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  356  MFTFTGLNTEQVSFMTREHHIYMTSDGRISMAGLSSRTIPHLADAI  401



>ref|XP_010254083.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Nelumbo 
nucifera]
Length=461

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  289  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCRTADVATRVESQLKLVIRPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA +  + +++ EW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  349  IHGASIVATIFKDRDMYTEWTIELKAMADRIISMRQQLFDALRARGTPG-DWSHIVKQIG  407

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q  +M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  408  MFTFTGLNTEQVASMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  453



>gb|AAA79370.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYTKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  +   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  352  MFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_010920378.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Elaeis guineensis]
Length=464

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L+AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  292  VRMFVADGGECLMAQSYAKNMGLYGERVGALSIVCRSADVAVRVESQLKLVIRPMYSNPP  351

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LF+EW  E++ MA RI S+RQ L+D+L  +   G DW+ I+KQIG
Sbjct  352  IHGASIVAAILKDRALFHEWTVELKAMADRIISMRQMLFDALRARGTPG-DWSHIIKQIG  410

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  411  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  456



>gb|KFK25414.1| aspartate aminotransferase [Arabis alpina]
Length=449

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQSY+KN+GLY ER+GA+++VC SAD A +V+SQLK + RPMYS+PP
Sbjct  277  IRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGKVESQLKLVIRPMYSSPP  336

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LF+EW  E++ MA RI S+R++L+++L  +   G DWT I+KQIG
Sbjct  337  IHGASIVAVILRDKNLFHEWTLELKAMADRIISMRKQLFEALRARGTPG-DWTHIIKQIG  395

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  396  MFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_010493028.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+A+SY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAKSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  +   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNNWTVELKEMADRIKSMRQQLFDAIQARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  352  MFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_009595013.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=448

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E+LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  276  VRMFVADGGEVLVAQSYAKNMGLYGERVGALSIVCRNADVASRVESQLKLVIRPMYSNPP  335

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +++EW  E++ MA RI  +RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  336  IHGASIVATILKDRNMYHEWTLELKAMADRIIRMRQQLFDALRARGTPG-DWSHIIKQIG  394

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  395  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  440



>ref|XP_011078312.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=406

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +R+F + G E L AQSY+KN+GLY ER+GA+++VC +AD A RV+SQLK + RPM+SNPP
Sbjct  234  IRLFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVATRVESQLKLVIRPMFSNPP  293

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++ EW  E++ MA RI S+RQ+LYD+L  +   G DW+ I+KQIG
Sbjct  294  IHGASIVATILKDGDMYTEWSVELKAMADRIISMRQQLYDALCARGTPG-DWSHIIKQIG  352

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  353  MFTFTGLNTNQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  398



>ref|XP_006366212.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Solanum 
tuberosum]
Length=453

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E+LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYS+PP
Sbjct  281  VRMFVADGGEVLVAQSYAKNMGLYGERVGALSIVCRNADVASRVESQLKLVIRPMYSSPP  340

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  L++EW  E++ MA RI  +RQ+L+D+L  K   G DW+ I+KQIG
Sbjct  341  IHGASIVATILKDRNLYHEWTLELKAMADRIIRMRQQLFDALRAKGTPG-DWSHIIKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  400  MFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSRTIPHLTDAI  445



>ref|NP_197456.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46645.2|AAT2_ARATH RecName: Full=Aspartate aminotransferase, cytoplasmic isozyme 
1; AltName: Full=Transaminase A [Arabidopsis thaliana]
 gb|ABG25061.1| At5g19550 [Arabidopsis thaliana]
 gb|AED92724.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  +   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  352  MFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>gb|AEX09183.1| putative aspartate aminotransferase 2 [Gossypium hirsutum]
Length=452

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E  VAQSY+KN+GLY ER+GA++VVC +AD A++V+SQLK + RPM+SNPP
Sbjct  280  IRMFVADGGECFVAQSYAKNMGLYGERVGALSVVCRAADVASKVESQLKLVIRPMFSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IV  ++ +  +FNEW  E++ MA RI S+R++L+D+L  +   G DW+ I+KQIG
Sbjct  340  IHGASIVVTILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARGTPG-DWSHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  399  MFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_006451184.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 ref|XP_006475645.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Citrus 
sinensis]
 gb|ESR64424.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 gb|KDO48875.1| hypothetical protein CISIN_1g015435mg [Citrus sinensis]
Length=407

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E LVAQSY+KN+GLY ER+GA+++VC + D A+RV+SQLK + RPMYS+PP
Sbjct  235  VRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPP  294

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  ++ EW  E++ MA RI S+RQ+L+D+LS +   G DW+ I+KQIG
Sbjct  295  IHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPG-DWSHIIKQIG  353

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  354  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI  399



>ref|XP_006399658.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
 dbj|BAJ33906.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41111.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
Length=453

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYS+PP
Sbjct  281  IRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVESQLKLVIRPMYSSPP  340

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DW+ I+KQIG
Sbjct  341  IHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWSHIIKQIG  399

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LAD+I
Sbjct  400  MFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADSI  445



>ref|XP_010250350.1| PREDICTED: aspartate aminotransferase, cytoplasmic, partial [Nelumbo 
nucifera]
Length=458

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G E L AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  286  VRIFVADGGECLAAQSYAKNMGLYGERVGALSIVCRTADVASRVESQLKLVIRPMYSNPP  345

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++NEW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  346  IHGASIVATILKDRDMYNEWTIELKAMADRIISMRQQLFDALRDRGTPG-DWSHIIKQIG  404

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  405  MFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  450



>emb|CAA45023.1| aspartate aminotransferase [Panicum miliaceum]
 dbj|BAA04992.1| aspartate aminotransferase [Panicum miliaceum]
Length=409

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G ELL+AQSY+KN+G+Y ER+GA+++VC SAD AARV+SQLK + RPMYS+PP
Sbjct  237  VRMFIADGGELLMAQSYAKNMGMYGERVGALSIVCGSADVAARVESQLKLVIRPMYSSPP  296

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HG  +VA ++ + E+F+EW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  297  LHGPSVVATILKDSEMFHEWTVELKAMADRIISMRQQLFDALKSRGTPG-DWSHIIKQIG  355

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGL+     +LADAI
Sbjct  356  MFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLNMKNVPHLADAI  401



>gb|KJB64944.1| hypothetical protein B456_010G072900 [Gossypium raimondii]
Length=405

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  233  VRTFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVESQLKLVIRPMYSNPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K   G +W+ I+KQIG
Sbjct  293  IHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKGTPG-NWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  352  MFTFTGLNSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_009410920.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E L AQSY+KN+GLY ER+GA+++VC SAD A RV+SQLK + RPMYSNPP
Sbjct  287  IRMFVADGGECLTAQSYAKNMGLYGERVGALSIVCKSADVAVRVESQLKLVIRPMYSNPP  346

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + E+++EW  E++ MA RI  +RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  347  IHGASIVATILKDREMYHEWTIELKAMADRIIRMRQQLFDALRTRGTPG-DWSHIVKQIG  405

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN+ Q  +M+ ++HIYMT DGRIS+AGLS+    +LA AI
Sbjct  406  MFTFTGLNREQVTSMTKEYHIYMTSDGRISMAGLSSKTVPHLAGAI  451



>gb|AAL09704.1|AF419301_1 aspartate aminotransferase [Securigera parviflora]
Length=341

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G ELL+AQSY+KN+GLY ER+GA+++VC SAD A+  +SQLK + RPMYSNPP
Sbjct  169  VRSFVADGGELLMAQSYAKNMGLYGERVGALSIVCKSADVASLAESQLKLVIRPMYSNPP  228

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ +  L+NEW  E++ MA RI S+RQ+L+D+L  K   G DW+ I+KQIG
Sbjct  229  LHGASIVATILKDRNLYNEWTIELKAMADRIISMRQQLFDALRAKGTPG-DWSHIIKQIG  287

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  288  MFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAGLSSKTVSHLADAI  333



>ref|XP_010688229.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Beta 
vulgaris subsp. vulgaris]
Length=405

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  233  VRMFVADGGECFIAQSYAKNMGLYGERVGALSIVCKTADVASRVESQLKLVVRPMYSNPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA+++ +  L++EW  E++ MA RI S+RQ+L+D+L+ +   G DW+ I+KQIG
Sbjct  293  LHGASIVASILKDKSLYDEWTIELKEMADRIISMRQQLFDALNARGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  352  MFTFTGLNADQVTFMRAEYHIYMTSDGRISMAGLSSRTVPHLADAI  397



>ref|XP_009782665.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=450

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E+LVAQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  278  VRMFVADGGEVLVAQSYAKNMGLYGERVGALSIVCRNADVASRVESQLKLVIRPMYSNPP  337

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  ++ EW  E++ MA RI  +RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  338  IHGASIVATILKDRNMYREWTLELKAMADRIIRMRQQLFDALRARGTPG-DWSHIIKQIG  396

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  397  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  442



>ref|XP_006476087.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=455

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 127/171 (74%), Gaps = 5/171 (3%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E  +AQSY+KNLGLY ER+GA+++VC +AD A RV+SQ+K + RPMYSNPP
Sbjct  277  VRMFVADGGECFIAQSYAKNLGLYGERVGALSIVCKTADVAGRVESQVKLVIRPMYSNPP  336

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD-----KSGKDWTFI  378
            IHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  ++      +  DW+ I
Sbjct  337  IHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRAREIWYIAGTPGDWSHI  396

Query  377  LKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
             KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  397  FKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPHLADAI  447



>ref|XP_010491885.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=451

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQSY+KN+GLY ER+GA+++VC S+D A +V+SQLK + RPMYS+PP
Sbjct  279  IRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSSDVAGKVESQLKLVIRPMYSSPP  338

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DW+ I+KQIG
Sbjct  339  IHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWSHIIKQIG  397

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  398  MFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  443



>ref|XP_010419724.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=454

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQSY+KN+GLY ER+GA+++VC S+D A +V+SQLK + RPMYS+PP
Sbjct  282  IRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSSDVAGKVESQLKLVIRPMYSSPP  341

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DW+ I+KQIG
Sbjct  342  IHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWSHIIKQIG  400

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  401  MFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  446



>ref|XP_010453196.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Camelina 
sativa]
Length=455

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQSY+KN+GLY ER+GA+++VC S+D A +V+SQLK + RPMYS+PP
Sbjct  283  IRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSSDVAGKVESQLKLVIRPMYSSPP  342

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   G DW+ I+KQIG
Sbjct  343  IHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWSHIIKQIG  401

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  402  MFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  447



>gb|KCW81535.1| hypothetical protein EUGRSUZ_C02894 [Eucalyptus grandis]
Length=452

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +R F + G E LVAQSY+KN+GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  280  IRSFVADGGECLVAQSYAKNMGLYGERVGALSIVCRTADVAGRVESQLKLVIRPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + E++NEW  E++ MA RI S+R +L+D+L  +   G DW+ I+KQIG
Sbjct  340  IHGASIVAAILRDREMYNEWTIELKAMADRIISMRHQLFDALRARGTPG-DWSHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  399  MFTFTGLNSQQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_008378104.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=421

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+SQLK + RPMYSNPP
Sbjct  249  VRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVESQLKLVIRPMYSNPP  308

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   G DW+ I+KQIG
Sbjct  309  IHGASIVATILKDRDLFNEWTIELKEMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIG  367

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  368  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  413



>ref|XP_010532471.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Tarenaya 
hassleriana]
Length=451

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF + G E LVAQS++KN+GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  279  IRMFVADGGECLVAQSFAKNMGLYGERVGALSIVCKAADVAGRVESQLKLVIRPMYSNPP  338

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  +   G DW+ I+KQIG
Sbjct  339  IHGASIVAAILRDRNMFNEWTLELKAMADRIISMRKQLFDALRARGTPG-DWSHIVKQIG  397

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  398  MFTFTGLNTAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLTEAI  443



>ref|XP_008220042.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Prunus mume]
Length=463

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+SQLK + RPMYSNPP
Sbjct  291  VRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKTADVASKVESQLKLVIRPMYSNPP  350

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   G DW+ I+KQIG
Sbjct  351  IHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIG  409

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  410  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  455



>sp|P28734.1|AATC_DAUCA RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Daucus carota]
 gb|AAA33134.1| aspartate aminotransferase [Daucus carota]
 prf||1909339A Asp aminotransferase
Length=405

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G E L AQSY+KN+GLY ER+GA+++VC +AD A++V+SQLK + RPMYS+PP
Sbjct  233  VRIFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASKVESQLKLVIRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+++L  K   G DW+ I+KQIG
Sbjct  293  LHGASIVAAILKDGDLYNEWTLELKAMADRIISMRQELFNALQAKGTPG-DWSHIVKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+N++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  352  MFTFTGLNSEQVTFMTNEYHIYLTSDGRISMAGLSSRTVPHLADAI  397



>ref|XP_008361035.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=461

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+SQLK + RPMYSNPP
Sbjct  289  VRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVESQLKLVIRPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   G DW+ I+KQIG
Sbjct  349  IHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIG  407

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  408  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  453



>ref|XP_008352022.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=461

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+SQLK + RPMYSNPP
Sbjct  289  VRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVESQLKLVIRPMYSNPP  348

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   G DW+ I+KQIG
Sbjct  349  IHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIG  407

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  408  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  453



>gb|KFK26196.1| hypothetical protein AALP_AA8G215200 [Arabis alpina]
Length=405

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRMFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N+W  E++ MA RI S+R++L+++L  +   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNDWTIELKAMADRIISMRKQLFEALQTRGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  216
            MF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI D+
Sbjct  352  MFTFTGLNTEQVAFMTKEHHIYMTSDGRISMAGLSSKTVPHLADAIHDA  400



>ref|XP_009120876.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Brassica rapa]
Length=405

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  352  MFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>emb|CDX92520.1| BnaA10g15590D [Brassica napus]
Length=405

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  352  MFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>emb|CDY65959.1| BnaC09g54080D [Brassica napus]
Length=405

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  352  MFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>ref|XP_010048107.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Eucalyptus 
grandis]
 gb|KCW80239.1| hypothetical protein EUGRSUZ_C01585 [Eucalyptus grandis]
Length=406

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E LVAQSY+KN+GLY ER+GA+++VC ++D A +V+SQLK + RPMYSNPP
Sbjct  234  VRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTSDVAGKVESQLKLVIRPMYSNPP  293

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ + +++NEW  E++ MA RI S+R +L+++L  +   G DW+ I+KQIG
Sbjct  294  LHGASIVATILRDKDMYNEWTIELKAMADRIISMRHQLFEALKTRGTPG-DWSHIIKQIG  352

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  353  MFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  398



>ref|XP_007222958.1| hypothetical protein PRUPE_ppa005315mg [Prunus persica]
 gb|AGF95095.1| aspartate aminotransferase [Prunus persica]
 gb|EMJ24157.1| hypothetical protein PRUPE_ppa005315mg [Prunus persica]
Length=467

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+SQ+K + RPMYSNPP
Sbjct  295  VRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKTADVASKVESQVKLVIRPMYSNPP  354

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   G DW+ I+KQIG
Sbjct  355  IHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIG  413

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  414  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  459



>gb|AAA50160.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELL+AQSY+KN+GLY ER+GA+++V  SAD A+RV+SQ+K + RPMYSNPP
Sbjct  248  VRLFVADGGELLLAQSYAKNMGLYGERVGALSIVSKSADVASRVESQVKLVVRPMYSNPP  307

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+NEW  E++ MA RI  +RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  308  IHGASIVAAILRDRDLYNEWTIELKAMADRIIKMRQQLFDALQSRGTPG-DWSHIIKQIG  366

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  367  MFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  412



>ref|XP_009367911.1| PREDICTED: aspartate aminotransferase, cytoplasmic isoform X2 
[Pyrus x bretschneideri]
Length=452

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+SQLK + RPMYSNPP
Sbjct  280  VRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVESQLKLVIRPMYSNPP  339

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LF+EW  E++ MA RI S+R +L++SL  K   G DW+ I+KQIG
Sbjct  340  IHGASIVATILKDRDLFSEWTVELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIG  398

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  399  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  444



>gb|AAA33408.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELL+AQSY+KN+GLY ER+GA+++V  SAD A+RV+SQ+K + RPMYSNPP
Sbjct  248  VRLFVADGGELLLAQSYAKNMGLYGERVGALSIVSKSADVASRVESQVKLVVRPMYSNPP  307

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+NEW  E++ MA RI  +RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  308  IHGASIVAAILRDRDLYNEWHIELKAMADRIIKMRQQLFDALQSRGTPG-DWSHIIKQIG  366

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  367  MFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  412



>ref|XP_006400515.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
 gb|ESQ41968.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
Length=405

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC SAD A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + E++N+W  E++ MA RI S+R++L+++L  K   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSEMYNDWTIELKGMADRIISMRKQLFEALQAKGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  352  MFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVDAI  397



>emb|CDY44925.1| BnaA02g04300D [Brassica napus]
Length=405

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC S+D A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSSDVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N+W  E++ MAGRI S+RQ L+++L  K   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNDWTIELKGMAGRIISMRQHLFEALQAKGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  352  MFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>ref|XP_006352160.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Solanum 
tuberosum]
Length=406

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC  ++ A++V+SQLK + RPMYSNPP
Sbjct  234  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKDSNVASKVESQLKMVIRPMYSNPP  293

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + ++++EW  E++ MA RI S+RQ+LYD++  +   G DW+ I+KQIG
Sbjct  294  IHGASIVATILKDRQMYDEWTVELKAMADRIISMRQQLYDAMQARGTPG-DWSHIIKQIG  352

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  353  MFTFTGLNVEQVSFMTREYHIYMTSDGRISMAGLSSRTVPHLADAM  398



>ref|XP_004291203.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Fragaria 
vesca subsp. vesca]
Length=459

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+ G ELLVAQSY+KN+GLY ER+GA+++V  ++  AA+V+SQLK + RPMYSNPP
Sbjct  287  VRRFAADGGELLVAQSYAKNMGLYGERVGALSIVLKTSGVAAKVESQLKLVIRPMYSNPP  346

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LFNEW  E++ MA RI S+R +L+DSL  K   G DW+ I+KQIG
Sbjct  347  IHGASIVATILKDKDLFNEWTIELKAMADRIISMRHQLFDSLRAKGTPG-DWSHIIKQIG  405

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  406  MFTFTGLNPEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  451



>ref|XP_009367910.1| PREDICTED: aspartate aminotransferase, cytoplasmic isoform X1 
[Pyrus x bretschneideri]
Length=460

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR FA+ G E L+AQSY+KN+GLY ER+GA+++VC +AD A++V+SQLK + RPMYSNPP
Sbjct  288  VRRFAADGGECLIAQSYAKNMGLYGERVGALSIVCKNADVASKVESQLKLVIRPMYSNPP  347

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +LF+EW  E++ MA RI S+R +L++SL  K   G DW+ I+KQIG
Sbjct  348  IHGASIVATILKDRDLFSEWTVELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIG  406

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  407  MFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  452



>ref|XP_004243159.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=406

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L AQSY+KN+GLY ER+GA+++VC  +D A++V+SQLK + RPMYSNPP
Sbjct  234  VRMFVADGGECLAAQSYAKNMGLYGERVGALSIVCKDSDVASKVESQLKMVIRPMYSNPP  293

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + ++++EW  E++ MA RI S+RQ+LY ++  +   G DW+ I+KQIG
Sbjct  294  IHGASIVATILKDRQMYDEWTVELKAMADRIISMRQQLYAAMQARGTPG-DWSHIIKQIG  352

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M++++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  353  MFTFTGLNAEQVSFMTSEYHIYMTSDGRISMAGLSSRTVPHLADAM  398



>gb|AFK40370.1| unknown [Medicago truncatula]
Length=418

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+SQLK + RPMYS+PP
Sbjct  246  VRLFVAEGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVESQLKLVIRPMYSSPP  305

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  306  IHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIG  364

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  365  MFTFTGLNSEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>emb|CDY71396.1| BnaCnng72730D [Brassica napus]
Length=240

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 124/166 (75%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E L+AQS++KN+GLY ERIGA+ +VC+S D A +VKSQL  + RPMY +PP
Sbjct  68   VRMFVADGGECLIAQSFAKNMGLYGERIGALTIVCTSEDVARKVKSQLLLVVRPMYLSPP  127

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IV  ++ N +++ +W  E++ MA RI S+RQ+LY+++  +   G DW+ I+KQIG
Sbjct  128  IHGASIVTTILKNSDMYKDWTIELKGMADRIISMRQQLYEAIQARGTPG-DWSHIIKQIG  186

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MFSFTGLN+ Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  187  MFSFTGLNEKQVRMMAKEYHIYMTYDGRISMAGLSSKTVPQLADAI  232



>ref|XP_002989786.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
 gb|EFJ09053.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
Length=413

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 124/166 (75%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E  +AQS++KNLGLY ER+GA+++V  S+  A RV+SQLK + RPMYSNPP
Sbjct  240  VRTFVADGGECFIAQSFAKNLGLYGERVGALSIVTKSSGVATRVESQLKLVIRPMYSNPP  299

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA V+G+ +LF+EW  E++ MA RI S+R KLYD+L  +   G DWT ILKQIG
Sbjct  300  IHGASIVALVLGDGDLFSEWTVELKGMADRIISMRHKLYDALRARGTPG-DWTHILKQIG  358

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MFSFTGLNK Q + M+ ++ IYMT DGRIS+AGLS      LADAI
Sbjct  359  MFSFTGLNKEQVQFMTREYRIYMTLDGRISMAGLSLKTVPLLADAI  404



>emb|CAA43779.1| aspartate aminotransferase [Medicago sativa]
Length=417

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+SQLK + RPMYS+PP
Sbjct  245  VRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVESQLKLVIRPMYSSPP  304

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  305  IHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIG  363

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  364  MFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  409



>gb|KEH36022.1| aspartate aminotransferase [Medicago truncatula]
Length=418

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+SQLK + RPMYS+PP
Sbjct  246  VRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVESQLKLVIRPMYSSPP  305

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  306  IHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIG  364

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  365  MFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>ref|XP_010049084.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Eucalyptus 
grandis]
Length=594

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +R F + G E LVAQSY+KN+GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  422  IRSFVADGGECLVAQSYAKNMGLYGERVGALSIVCRTADVAGRVESQLKLVIRPMYSNPP  481

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + E++NEW  E++ MA RI S+R +L+D+L  +   G DW+ I+KQIG
Sbjct  482  IHGASIVAAILRDREMYNEWTIELKAMADRIISMRHQLFDALRARGTPG-DWSHIIKQIG  540

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  541  MFTFTGLNSQQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  586



>gb|EYU29270.1| hypothetical protein MIMGU_mgv1a006139mg [Erythranthe guttata]
Length=455

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 125/166 (75%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF   G E +VAQS++KN+GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  283  VRMFVKDGGECIVAQSFAKNMGLYGERVGALSIVCRNADVAGRVESQLKLVIRPMYSNPP  342

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA V+ +  +F EW  E++ MA RI ++R +L+D+L  +   G DW+ I+KQIG
Sbjct  343  IHGASIVATVLKDRNMFQEWTVELKAMADRIINMRTQLFDALRSRGTPG-DWSHIIKQIG  401

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  402  MFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  447



>gb|KJB07520.1| hypothetical protein B456_001G028000 [Gossypium raimondii]
Length=337

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 125/169 (74%), Gaps = 1/169 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF   G E  VAQSYSKN+GLY ERIG++++VC +AD A RV+SQLK + RP+YSNPP
Sbjct  159  IRMFGCDGGECFVAQSYSKNMGLYGERIGSLSIVCKTADVARRVESQLKLIIRPLYSNPP  218

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IV  ++ + +L+ +W  E++ M  R+  VR++LYDSL  K   G DW+ I+KQ+G
Sbjct  219  IHGAAIVTAILKDRDLYQKWTNELKAMRDRLVQVRRQLYDSLCNKGTPG-DWSHIIKQVG  277

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  216
            M+SFTGLNK Q + ++ ++HIYM+ DGRI++ GLS+    Y ADAI D+
Sbjct  278  MYSFTGLNKDQVDFLTREYHIYMSSDGRINIGGLSSKAVPYFADAIHDA  326



>ref|XP_002990136.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
 gb|EFJ08853.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
Length=414

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 124/166 (75%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E  +AQS++KN+GLY ER+GA+++V  S+  A RV+SQLK + RPMYSNPP
Sbjct  241  VRTFVADGGECFIAQSFAKNMGLYGERVGALSIVSKSSGVATRVESQLKLVIRPMYSNPP  300

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA V+G+ +LF+EW  E++ MA RI S+R KLYD+L  +   G DWT ILKQIG
Sbjct  301  IHGASIVALVLGDGDLFSEWTVELKGMADRIISMRHKLYDALRARGTPG-DWTHILKQIG  359

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MFSFTGLNK Q + M+ ++ IYMT DGRIS+AGLS      LADAI
Sbjct  360  MFSFTGLNKEQVQFMTREYRIYMTLDGRISMAGLSLKTVPLLADAI  405



>emb|CDY42276.1| BnaC02g08820D [Brassica napus]
Length=405

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E L+AQSY+KN+GLY ER+GA+++VC S+D A++V+SQ+K + RPMYS+PP
Sbjct  233  VRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSSDVASKVESQVKLVVRPMYSSPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   G DW+ I+KQIG
Sbjct  293  IHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  352  MFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>gb|KEH36020.1| aspartate aminotransferase [Medicago truncatula]
Length=458

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+SQLK + RPMYS+PP
Sbjct  286  VRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVESQLKLVIRPMYSSPP  345

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  346  IHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIG  404

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  405  MFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  450



>gb|KJB64945.1| hypothetical protein B456_010G072900 [Gossypium raimondii]
Length=404

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G E  +AQSY+KN+GLY ER+GA+++VC +AD A+RV+SQLK + RPMYSNPP
Sbjct  233  VRTFVADGGECFIAQSYAKNMGLYGERVGALSIVCKAADVASRVESQLKLVIRPMYSNPP  292

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K   G +W+ I+KQIG
Sbjct  293  IHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKGTPG-NWSHIIKQIG  351

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIYMT DG IS+AGLS+    +LADAI
Sbjct  352  MFTFTGLNSDQVAFMTKEYHIYMTSDG-ISMAGLSSKTVPHLADAI  396



>sp|P28011.2|AAT1_MEDSA RecName: Full=Aspartate aminotransferase 1; AltName: Full=Transaminase 
A [Medicago sativa]
 gb|AAB46610.1| aspartate aminotransferase [Medicago sativa]
Length=418

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR+F + G ELLVAQSY+KN+GLY ER+GA+++V  SAD ++RV+SQLK + RPMYS+PP
Sbjct  246  VRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVESQLKLVIRPMYSSPP  305

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIG
Sbjct  306  IHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIG  364

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LA AI
Sbjct  365  MFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLAHAI  410



>gb|KJB07518.1| hypothetical protein B456_001G028000 [Gossypium raimondii]
Length=426

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 125/169 (74%), Gaps = 1/169 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF   G E  VAQSYSKN+GLY ERIG++++VC +AD A RV+SQLK + RP+YSNPP
Sbjct  248  IRMFGCDGGECFVAQSYSKNMGLYGERIGSLSIVCKTADVARRVESQLKLIIRPLYSNPP  307

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IV  ++ + +L+ +W  E++ M  R+  VR++LYDSL  K   G DW+ I+KQ+G
Sbjct  308  IHGAAIVTAILKDRDLYQKWTNELKAMRDRLVQVRRQLYDSLCNKGTPG-DWSHIIKQVG  366

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  216
            M+SFTGLNK Q + ++ ++HIYM+ DGRI++ GLS+    Y ADAI D+
Sbjct  367  MYSFTGLNKDQVDFLTREYHIYMSSDGRINIGGLSSKAVPYFADAIHDA  415



>emb|CAA63894.1| aspartate aminotransferase [Lotus japonicus]
Length=418

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VR F + G ELL AQSY+KN+GLY ER+GA+++V  SAD A+ V+SQLK + RPMYSNPP
Sbjct  246  VRSFVADGGELLAAQSYAKNMGLYGERVGALSIVSKSADVASLVESQLKLVIRPMYSNPP  305

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            +HGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+D+L  +   G DW+ I+K IG
Sbjct  306  LHGASIVATILKDRDLYNEWTIELKGMADRIISMRQQLFDALRSRGTPG-DWSHIIKSIG  364

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            MF+FTGLN  Q   M+ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  365  MFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>gb|KHG23915.1| Aspartate aminotransferase, cytoplasmic [Gossypium arboreum]
Length=426

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            +RMF   G E LVAQSYSKN+GLY ERIG++++VC +AD A RV+SQLK + RP+YSNPP
Sbjct  248  IRMFGCDGGECLVAQSYSKNMGLYGERIGSLSIVCKTADVARRVESQLKLIIRPLYSNPP  307

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IV  ++ + +L+ +W  E++ M  R+  VR++LYDSL  K   G DW+ I+KQ+G
Sbjct  308  IHGAAIVTAILKDRDLYKKWTNELKAMRDRLVQVRRQLYDSLCNKGTPG-DWSHIIKQVG  366

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  216
            M+SFTGLNK + + ++ ++HIYM+ DGRI++ GLS+    Y ADAI D+
Sbjct  367  MYSFTGLNKDEVDFLTREYHIYMSSDGRINIGGLSSKAVPYFADAIHDA  415



>ref|XP_002308617.2| hypothetical protein POPTR_0006s25820g [Populus trichocarpa]
 gb|EEE92140.2| hypothetical protein POPTR_0006s25820g [Populus trichocarpa]
Length=479

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 124/166 (75%), Gaps = 1/166 (1%)
 Frame = -2

Query  722  VRMFASRGXELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPP  543
            VRMF + G E LVA SYSK +GLY ER+GA+++VC +AD A RV+SQLK + RPMYSNPP
Sbjct  306  VRMFVTDGGECLVAHSYSKIMGLYGERVGALSIVCKTADVAKRVESQLKLVIRPMYSNPP  365

Query  542  IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG  363
            IHGA IV  ++ + E+F+EW  E++ M  RI  +RQ+LYD+L  +   G DW+ I+KQ+G
Sbjct  366  IHGASIVTAILKDREMFDEWTVELKAMIDRIIHLRQQLYDALRDRGTPG-DWSHIMKQVG  424

Query  362  MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  225
            M++F+GLN  Q   M+ ++HIYM+ DGRI++AGLSA    YLADAI
Sbjct  425  MYTFSGLNAEQVAFMNKEYHIYMSSDGRINMAGLSAKTVPYLADAI  470



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570