BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046L16

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004165700.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    274   6e-85   
gb|ACP43317.1|  NADPH cytochrome P450 reductase                         263   2e-84   Citrus maxima [buntan]
ref|XP_004146317.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    274   7e-83   Cucumis sativus [cucumbers]
ref|XP_008453604.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      270   2e-81   Cucumis melo [Oriental melon]
gb|AEA86315.1|  NADPH-cytochrome P450 reductase                         252   3e-81   Solanum nigrum
gb|KDO43876.1|  hypothetical protein CISIN_1g005072mg                   264   4e-81   Citrus sinensis [apfelsine]
ref|XP_003610110.1|  NADPH cytochrome P450 reductase                    263   6e-81   
gb|ACN54324.1|  NADPH:cytochrome P450 reductase                         267   2e-80   Gossypium hirsutum [American cotton]
gb|KHG09184.1|  NADPH--cytochrome P450 reductase                        267   2e-80   Gossypium arboreum [tree cotton]
ref|XP_007227446.1|  hypothetical protein PRUPE_ppa002142mg             267   2e-80   Prunus persica
gb|KDO43875.1|  hypothetical protein CISIN_1g005072mg                   263   3e-80   Citrus sinensis [apfelsine]
gb|KDO43874.1|  hypothetical protein CISIN_1g005072mg                   263   3e-80   Citrus sinensis [apfelsine]
gb|ABK92896.1|  unknown                                                 251   4e-80   Populus trichocarpa [western balsam poplar]
ref|XP_007014268.1|  P450 reductase 2                                   266   4e-80   
ref|XP_004148333.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    266   5e-80   Cucumis sativus [cucumbers]
dbj|BAG68945.1|  cytochrome P450 reductase                              266   7e-80   Lotus japonicus
ref|XP_004168364.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    265   9e-80   
ref|XP_008223694.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      265   9e-80   Prunus mume [ume]
gb|AHA50098.1|  CYP450 reductase                                        265   1e-79   Panax ginseng [Asiatic ginseng]
gb|KJB53797.1|  hypothetical protein B456_009G005600                    265   1e-79   Gossypium raimondii
gb|KJB53794.1|  hypothetical protein B456_009G005600                    265   1e-79   Gossypium raimondii
ref|XP_010093854.1|  NADPH--cytochrome P450 reductase                   265   2e-79   Morus notabilis
gb|KDO43870.1|  hypothetical protein CISIN_1g005072mg                   264   2e-79   Citrus sinensis [apfelsine]
emb|CBI17838.3|  unnamed protein product                                263   2e-79   Vitis vinifera
gb|KJB22140.1|  hypothetical protein B456_004G0316002                   256   2e-79   Gossypium raimondii
ref|XP_002270732.2|  PREDICTED: NADPH--cytochrome P450 reductase        264   3e-79   Vitis vinifera
ref|XP_004296434.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      264   3e-79   Fragaria vesca subsp. vesca
gb|KDO43869.1|  hypothetical protein CISIN_1g005072mg                   264   3e-79   Citrus sinensis [apfelsine]
gb|AIG15452.1|  NADPH-cytochrome P450 reductase 2                       264   3e-79   Azadirachta indica [Indian-lilac]
gb|KDO43868.1|  hypothetical protein CISIN_1g005072mg                   264   4e-79   Citrus sinensis [apfelsine]
gb|KDO43871.1|  hypothetical protein CISIN_1g005072mg                   264   4e-79   Citrus sinensis [apfelsine]
gb|ACF35280.1|  cytochrome P450 reductase-like protein                  264   4e-79   Nothapodytes nimmoniana
gb|AAC09468.2|  putative NADPH-cytochrome P450 reductase                263   5e-79   Pisum sativum [garden pea]
emb|CAN77401.1|  hypothetical protein VITISV_027794                     264   6e-79   Vitis vinifera
ref|XP_003610109.1|  NADPH cytochrome P450 reductase                    263   6e-79   Medicago truncatula
ref|XP_011069915.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    262   1e-78   Sesamum indicum [beniseed]
ref|XP_006474186.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    262   1e-78   Citrus sinensis [apfelsine]
ref|XP_006474185.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    262   2e-78   Citrus sinensis [apfelsine]
ref|XP_004507858.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    262   2e-78   Cicer arietinum [garbanzo]
ref|XP_010048643.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    262   2e-78   Eucalyptus grandis [rose gum]
ref|XP_006453369.1|  hypothetical protein CICLE_v10007535mg             263   2e-78   
ref|XP_006453370.1|  hypothetical protein CICLE_v10007535mg             263   3e-78   
gb|AIC73829.1|  cytochrome P450 reductase                               260   5e-78   Panax ginseng [Asiatic ginseng]
gb|AEW43314.1|  NADPH cytochrome P450 reductase                         261   5e-78   Picrorhiza kurrooa
dbj|BAJ97446.1|  predicted protein                                      248   6e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP02981.1|  unnamed protein product                                259   8e-78   Coffea canephora [robusta coffee]
ref|XP_010914150.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    259   1e-77   Elaeis guineensis
ref|XP_006372089.1|  hypothetical protein POPTR_0018s09980g             254   1e-77   
ref|XP_010447753.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    251   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_011079296.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    259   3e-77   Sesamum indicum [beniseed]
ref|XP_008383105.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    259   3e-77   Malus domestica [apple tree]
ref|XP_008383106.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    259   3e-77   Malus domestica [apple tree]
ref|XP_009385909.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    258   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAZ39649.1|  cytochrome P450 NADPH-reductase                         258   4e-77   Petunia x hybrida [garden petunia]
ref|XP_009607226.1|  PREDICTED: NADPH--cytochrome P450 reductase        258   7e-77   Nicotiana tomentosiformis
ref|XP_010265447.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    258   8e-77   Nelumbo nucifera [Indian lotus]
gb|AAK56276.1|AF367288_1  AT4g30210/F9N11_60                            248   8e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AGX85599.1|  NADPH:cytochrome P450 reductase                         257   1e-76   Scoparia dulcis [escobilla]
ref|XP_003541616.1|  PREDICTED: NADPH--cytochrome P450 reductase        257   1e-76   Glycine max [soybeans]
ref|XP_004242931.1|  PREDICTED: NADPH--cytochrome P450 reductase        257   2e-76   Solanum lycopersicum
gb|AGL46979.1|  cytochrome P450 reductase                               256   2e-76   Salvia miltiorrhiza [Chinese salvia]
ref|XP_003549436.1|  PREDICTED: NADPH--cytochrome P450 reductase        256   2e-76   Glycine max [soybeans]
gb|ADC94831.1|  cytochrome P450 reductase                               256   3e-76   Perilla frutescens [beefsteak-mint]
ref|NP_001131393.1|  uncharacterized protein LOC100192720               243   3e-76   
ref|XP_009795589.1|  PREDICTED: NADPH--cytochrome P450 reductase        256   3e-76   Nicotiana sylvestris
ref|XP_011043963.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    256   4e-76   Populus euphratica
ref|XP_010046982.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    255   4e-76   Eucalyptus grandis [rose gum]
gb|KHN17598.1|  NADPH--cytochrome P450 reductase                        256   4e-76   Glycine soja [wild soybean]
gb|KHN22700.1|  NADPH--cytochrome P450 reductase                        256   4e-76   Glycine soja [wild soybean]
gb|ABL09938.1|  cytochrome P450 reductase                               255   5e-76   Artemisia annua [sweet Annie]
ref|XP_010548619.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    256   5e-76   Tarenaya hassleriana [spider flower]
gb|AAK15261.1|AF302498_1  NADPH-cytochrome P450 oxydoreductase is...    255   6e-76   Populus trichocarpa x Populus deltoides
gb|ABM88789.1|  cytochrome P450 reductase                               255   6e-76   Artemisia annua [sweet Annie]
gb|KDP36395.1|  hypothetical protein JCGZ_08664                         255   6e-76   Jatropha curcas
gb|ABI98819.1|  cytochrome P450 reductase                               255   7e-76   Artemisia annua [sweet Annie]
gb|KHG21257.1|  NADPH--cytochrome P450 reductase                        255   7e-76   Gossypium arboreum [tree cotton]
ref|XP_010928663.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    255   7e-76   Elaeis guineensis
ref|NP_001136741.1|  uncharacterized protein LOC100216882               242   8e-76   
gb|ABC47946.1|  cytochrome P450 reductase                               255   8e-76   Artemisia annua [sweet Annie]
gb|ABB88839.2|  NADPH cytochrome P450 reductase                         255   9e-76   Stevia rebaudiana
ref|XP_008391625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    254   1e-75   Malus domestica [apple tree]
emb|CAA81210.1|  NADPH-ferrihemoprotein reductase                       250   1e-75   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_002444097.1|  hypothetical protein SORBIDRAFT_07g007640          254   1e-75   Sorghum bicolor [broomcorn]
emb|CBX24555.1|  NADPH:cytochrome P450 reductase                        254   1e-75   Salvia miltiorrhiza [Chinese salvia]
emb|CCO62220.1|  putative cytochrome P450 reductase                     254   2e-75   Actaea racemosa
ref|XP_009382841.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    254   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGC92176.1|  cytochrome P450 oxidoreductase                          254   2e-75   Ocimum basilicum [basil]
gb|ACN54323.1|  NADPH:cytochrome P450 reductase                         253   2e-75   Gossypium hirsutum [American cotton]
gb|KDP41487.1|  hypothetical protein JCGZ_15894                         253   2e-75   Jatropha curcas
gb|AFO64618.1|  cytochrome P450 reductase                               253   2e-75   Artemisia annua [sweet Annie]
ref|XP_002324469.1|  putative NADPH-cytochrome P450 reductase fam...    253   5e-75   Populus trichocarpa [western balsam poplar]
ref|XP_010913661.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    253   5e-75   Elaeis guineensis
sp|Q05001.1|NCPR_CATRO  RecName: Full=NADPH--cytochrome P450 redu...    253   7e-75   Catharanthus roseus [chatas]
gb|ADG29353.1|  cytochrome P450 reductase                               252   8e-75   Withania somnifera [ashwagandha]
ref|XP_006386427.1|  hypothetical protein POPTR_0002s10680g             248   9e-75   
ref|XP_006381796.1|  putative NADPH-cytochrome P450 reductase fam...    252   9e-75   Populus trichocarpa [western balsam poplar]
gb|KJB58865.1|  hypothetical protein B456_009G229300                    252   9e-75   Gossypium raimondii
ref|XP_011010331.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    252   9e-75   Populus euphratica
ref|XP_004957625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    252   1e-74   Setaria italica
gb|EYU42400.1|  hypothetical protein MIMGU_mgv1a002170mg                252   1e-74   Erythranthe guttata [common monkey flower]
gb|KJB58863.1|  hypothetical protein B456_009G229300                    251   1e-74   Gossypium raimondii
ref|NP_001063914.1|  Os09g0558900                                       251   2e-74   
ref|XP_010929254.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    251   2e-74   Elaeis guineensis
gb|AGO03799.1|  cytochrome P450-like protein                            251   2e-74   Tanacetum cinerariifolium [pyrethrum]
gb|AAB97737.1|  NADPH cytochrome P450 reductase                         251   2e-74   Petroselinum crispum
gb|EPS66345.1|  hypothetical protein M569_08425                         250   2e-74   Genlisea aurea
ref|XP_010438203.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      251   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010447751.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    251   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008781895.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    250   4e-74   Phoenix dactylifera
ref|XP_010254555.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    250   4e-74   Nelumbo nucifera [Indian lotus]
emb|CAC83301.1|  cytochrome P450 reductase                              250   4e-74   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002307336.1|  NADPH-cytochrome P450 oxydoreductase isoform...    250   4e-74   
gb|KHG05124.1|  NADPH--cytochrome P450 reductase                        250   4e-74   Gossypium arboreum [tree cotton]
emb|CAA81209.1|  NADPH-ferrihemoprotein reductase                       248   5e-74   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase        249   8e-74   Fragaria vesca subsp. vesca
gb|AHB33950.1|  cytochrome P450 reductase                               249   8e-74   Santalum album
ref|XP_008789667.1|  PREDICTED: NADPH--cytochrome P450 reductase        249   8e-74   Phoenix dactylifera
gb|EAZ10065.1|  hypothetical protein OsI_32371                          249   9e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                   249   1e-73   Morus notabilis
gb|EYU20907.1|  hypothetical protein MIMGU_mgv1a002097mg                249   1e-73   Erythranthe guttata [common monkey flower]
gb|EMS66177.1|  NADPH--cytochrome P450 reductase                        248   1e-73   Triticum urartu
ref|XP_010433014.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    249   2e-73   Camelina sativa [gold-of-pleasure]
gb|EMT14573.1|  NADPH--cytochrome P450 reductase                        248   2e-73   
gb|AHM95445.1|  cytochrome P450 reductase                               248   2e-73   Matricaria chamomilla var. recutita [German chamomile]
gb|AFW59699.1|  hypothetical protein ZEAMMB73_961001                    244   2e-73   
ref|XP_010277516.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    247   2e-73   
emb|CDY51656.1|  BnaAnng10960D                                          248   2e-73   Brassica napus [oilseed rape]
ref|XP_002462826.1|  hypothetical protein SORBIDRAFT_02g032640          248   2e-73   Sorghum bicolor [broomcorn]
ref|XP_007154761.1|  hypothetical protein PHAVU_003G145400g             248   2e-73   Phaseolus vulgaris [French bean]
gb|AAB97736.1|  NADPH cytochrome P450 reductase                         248   3e-73   Petroselinum crispum
emb|CDX72222.1|  BnaC07g42440D                                          248   3e-73   
gb|KJB14707.1|  hypothetical protein B456_002G138900                    248   3e-73   Gossypium raimondii
gb|AAC05022.1|  NADPH:ferrihemoprotein oxidoreductase                   248   3e-73   Eschscholzia californica
emb|CDY28169.1|  BnaA01g06800D                                          248   4e-73   Brassica napus [oilseed rape]
ref|XP_009130253.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    247   4e-73   Brassica rapa
emb|CAQ37789.1|  NADPH:cytochrome P450 reductase                        248   4e-73   Plectranthus scutellarioides
ref|XP_006661531.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    246   6e-73   
gb|EPS73891.1|  hypothetical protein M569_00858                         247   6e-73   Genlisea aurea
ref|XP_010277515.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    247   7e-73   Nelumbo nucifera [Indian lotus]
gb|AAS90127.1|  NADPH cytochrome P450 reductase                         246   7e-73   Ammi majus [ameo mayor]
ref|XP_006283224.1|  hypothetical protein CARUB_v10004254mg             247   9e-73   Capsella rubella
ref|XP_002514049.1|  cytochrome P450, putative                          246   1e-72   Ricinus communis
gb|AIO11759.1|  cytochrome p450 reductase                               246   1e-72   Croton stellatopilosus
ref|NP_849472.2|  NADPH--cytochrome P450 reductase 2                    246   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194750.1|  NADPH--cytochrome P450 reductase 2                    246   1e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CAA46815.1|  NADPH-ferrihemoprotein reductase                       246   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg             246   1e-72   Prunus persica
ref|XP_006653834.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    244   2e-72   Oryza brachyantha
dbj|BAJ41269.1|  NADPH-P450 reductase 2                                 246   2e-72   Zingiber officinale [ginger]
ref|XP_010259920.1|  PREDICTED: NADPH--cytochrome P450 reductase        246   2e-72   Nelumbo nucifera [Indian lotus]
gb|EEE61817.1|  hypothetical protein OsJ_16444                          244   2e-72   Oryza sativa Japonica Group [Japonica rice]
emb|CDX68634.1|  BnaC01g08190D                                          246   2e-72   
ref|XP_009414761.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    245   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY14183.1|  BnaA08g13140D                                          245   3e-72   Brassica napus [oilseed rape]
ref|XP_009108997.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      245   4e-72   Brassica rapa
ref|XP_009384791.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    244   5e-72   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAE01547.2|  OSJNBb0022F16.2                                        244   5e-72   Oryza sativa Japonica Group [Japonica rice]
gb|AHB33949.1|  cytochrome P450 reductase                               244   5e-72   Santalum album
gb|EEE70211.1|  hypothetical protein OsJ_30318                          246   6e-72   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001159331.1|  uncharacterized protein LOC100304425               244   6e-72   Zea mays [maize]
ref|XP_002869386.1|  hypothetical protein ARALYDRAFT_913457             244   6e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    244   7e-72   Prunus mume [ume]
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase        244   8e-72   Malus domestica [apple tree]
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                        244   9e-72   Glycine soja [wild soybean]
ref|NP_001236742.1|  NADPH:P450 reductase                               244   1e-71   
ref|XP_011015338.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    244   1e-71   Populus euphratica
ref|XP_008667834.1|  PREDICTED: uncharacterized protein LOC100279...    244   1e-71   
ref|XP_008667833.1|  PREDICTED: uncharacterized protein LOC100279...    244   1e-71   Zea mays [maize]
ref|XP_008653023.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    244   1e-71   Zea mays [maize]
dbj|BAD05443.1|  putative cytochrome P450 reductase                     241   1e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447240.1|  hypothetical protein SORBIDRAFT_06g031110          243   1e-71   Sorghum bicolor [broomcorn]
emb|CDY03543.1|  BnaC03g68020D                                          243   2e-71   
dbj|BAJ33878.1|  unnamed protein product                                243   2e-71   Eutrema halophilum
ref|XP_006412733.1|  hypothetical protein EUTSA_v10024546mg             243   2e-71   Eutrema salsugineum [saltwater cress]
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    244   2e-71   
ref|XP_006845640.1|  hypothetical protein AMTR_s00019p00222550          243   2e-71   
ref|XP_008661364.1|  PREDICTED: uncharacterized protein LOC100192...    243   2e-71   
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase        242   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_010525727.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      243   3e-71   Tarenaya hassleriana [spider flower]
ref|NP_001061346.1|  Os08g0243500                                       241   4e-71   
ref|XP_010234513.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    242   4e-71   Brachypodium distachyon [annual false brome]
gb|AAS00459.1|  NADPH:cytochrome P450-reductase                         242   5e-71   Hypericum androsaemum
ref|XP_003578634.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    242   6e-71   Brachypodium distachyon [annual false brome]
emb|CAC27143.1|  NADPH-cytochrome P450 reductase                        228   7e-71   Picea abies
ref|XP_004973052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    241   8e-71   Setaria italica
ref|XP_008676669.1|  PREDICTED: uncharacterized protein LOC100216...    241   9e-71   
ref|XP_003579401.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    241   1e-70   Brachypodium distachyon [annual false brome]
ref|XP_004960247.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    241   1e-70   Setaria italica
gb|EEE68301.1|  hypothetical protein OsJ_26563                          241   1e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010688489.1|  PREDICTED: NADPH--cytochrome P450 reductase        241   1e-70   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                       240   2e-70   Vicia sativa [spring vetch]
ref|XP_006659239.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    237   3e-70   
ref|XP_007141274.1|  hypothetical protein PHAVU_008G182200g             240   3e-70   Phaseolus vulgaris [French bean]
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg             240   3e-70   Citrus clementina [clementine]
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    239   3e-70   Cicer arietinum [garbanzo]
gb|KDO81195.1|  hypothetical protein CISIN_1g005496mg                   233   5e-70   Citrus sinensis [apfelsine]
emb|CDP11509.1|  unnamed protein product                                239   5e-70   Coffea canephora [robusta coffee]
dbj|BAJ99370.1|  predicted protein                                      238   5e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                    239   6e-70   Medicago truncatula
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase        239   6e-70   Vitis vinifera
dbj|BAJ41268.1|  NADPH-P450 reductase 1                                 239   6e-70   Zingiber officinale [ginger]
gb|AAG17471.1|AF123610_10  NADPH-cytochrome P450 reductase              238   7e-70   Triticum aestivum [Canadian hard winter wheat]
gb|ACG27711.1|  NADPH--cytochrome P450 reductase                        239   8e-70   Zea mays [maize]
ref|XP_007018235.1|  P450 reductase 1 isoform 2                         234   8e-70   
ref|XP_008451695.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    239   1e-69   
ref|XP_007018234.1|  P450 reductase 1 isoform 1                         238   1e-69   
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase        237   3e-69   Nicotiana tomentosiformis
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3         238   3e-69   
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    237   4e-69   Solanum tuberosum [potatoes]
ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase        236   4e-69   Nicotiana sylvestris
gb|ACF17649.1|  putative cytochrome reductase                           236   5e-69   Capsicum annuum
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                       236   7e-69   Ophiorrhiza pumila
gb|EPS67504.1|  hypothetical protein M569_07270                         236   7e-69   Genlisea aurea
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...    236   1e-68   Vigna radiata var. radiata [golden gram]
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...    236   1e-68
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                         236   1e-68   Petunia x hybrida [garden petunia]
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase        235   1e-68   Solanum lycopersicum
gb|KFK29577.1|  nadph-ferrihemoprotein reductase                        235   2e-68   Arabis alpina [alpine rockcress]
gb|KDO81194.1|  hypothetical protein CISIN_1g005496mg                   232   2e-68   Citrus sinensis [apfelsine]
ref|XP_009408053.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    235   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase        234   3e-68   Glycine max [soybeans]
emb|CDX92639.1|  BnaC07g38970D                                          234   5e-68   
ref|XP_009137451.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    231   7e-68   Brassica rapa
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    233   9e-68   Citrus sinensis [apfelsine]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                   233   9e-68   Citrus sinensis [apfelsine]
gb|AIL29328.1|  cytochrome P450 reductase                               233   1e-67   Pinus contorta
gb|AAC05021.1|  NADPH:ferrihemoprotein oxidoreductase                   232   2e-67   Papaver somniferum
emb|CDY11017.1|  BnaA03g46760D                                          232   2e-67   Brassica napus [oilseed rape]
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g             232   3e-67   Phaseolus vulgaris [French bean]
emb|CDY03447.1|  BnaC01g16350D                                          232   3e-67   
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    231   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_009137450.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    231   6e-67   Brassica rapa
ref|XP_010526342.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    231   7e-67   Tarenaya hassleriana [spider flower]
gb|AAS92623.1|  NADPH:cytochrome P450-reductase                         231   7e-67   Centaurium erythraea
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    231   8e-67   Populus euphratica
emb|CDY34287.1|  BnaA01g13900D                                          230   1e-66   Brassica napus [oilseed rape]
gb|AAX59902.1|  cytochrome P450 reductase                               230   1e-66   Taxus wallichiana var. chinensis [Chinese yew]
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    230   1e-66   Glycine max [soybeans]
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg                230   1e-66   Erythranthe guttata [common monkey flower]
ref|XP_010692385.1|  PREDICTED: NADPH--cytochrome P450 reductase        229   3e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|AAT76449.1|  NADPH:cytochrome P450 reductase                         229   4e-66   Taxus cuspidata [ichii]
ref|XP_002867662.1|  hypothetical protein ARALYDRAFT_492391             228   5e-66   
gb|ACF35281.1|  cytochrome P450 reductase-like protein                  228   7e-66   Nothapodytes nimmoniana
gb|ADI49691.1|  cytochrome P450 reductase                               228   1e-65   Withania somnifera [ashwagandha]
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                       227   1e-65   Azadirachta indica [Indian-lilac]
ref|XP_006413419.1|  hypothetical protein EUTSA_v10024568mg             227   1e-65   Eutrema salsugineum [saltwater cress]
ref|XP_009138145.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    226   3e-65   Brassica rapa
emb|CDY34288.1|  BnaA01g13910D                                          226   3e-65   Brassica napus [oilseed rape]
emb|CAA46814.1|  NADPH-ferrihemoprotein reductase                       226   6e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190823.1|  NADPH--cytochrome P450 reductase 1                 225   6e-65   Arabidopsis thaliana [mouse-ear cress]
gb|EMS53484.1|  NADPH--cytochrome P450 reductase                        224   7e-65   Triticum urartu
ref|NP_194183.1|  NADPH--cytochrome P450 reductase 1                    225   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138137.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    225   8e-65   Brassica rapa
gb|EMT19472.1|  NADPH--cytochrome P450 reductase                        223   1e-64   
ref|XP_010439016.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    224   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010523339.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    216   1e-64   
ref|XP_006285937.1|  hypothetical protein CARUB_v10007449mg             224   1e-64   Capsella rubella
emb|CAA89837.3|  NADPH-cytochrome P450 reductase                        225   2e-64   Pseudotsuga menziesii
ref|XP_010448554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    224   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    223   3e-64   Nicotiana sylvestris
ref|XP_010433757.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    223   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010523336.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    216   5e-64   
ref|XP_010523337.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    216   5e-64   
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    223   7e-64   Tarenaya hassleriana [spider flower]
ref|XP_010523335.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    215   4e-63   
ref|XP_010523334.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    216   1e-62   
ref|XP_008808352.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    204   8e-62   
gb|KJB22141.1|  hypothetical protein B456_004G0316002                   210   1e-61   Gossypium raimondii
ref|XP_002984697.1|  hypothetical protein SELMODRAFT_234596             213   1e-60   
ref|XP_002978784.1|  hypothetical protein SELMODRAFT_152770             213   2e-60   
ref|XP_002534464.1|  cytochrome P450, putative                          213   2e-60   
ref|XP_004507857.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    210   4e-59   
gb|KCW80968.1|  hypothetical protein EUGRSUZ_C02330                     209   9e-59   Eucalyptus grandis [rose gum]
ref|XP_008680517.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    192   3e-57   
gb|KJB14708.1|  hypothetical protein B456_002G138900                    204   5e-57   Gossypium raimondii
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    202   2e-56   
ref|XP_001770150.1|  predicted protein                                  201   4e-56   
gb|AFW62956.1|  hypothetical protein ZEAMMB73_744602                    193   2e-54   
ref|XP_002986144.1|  hypothetical protein SELMODRAFT_157822             196   2e-54   
gb|ACF35282.1|  cytochrome P450 reductase-like protein                  197   2e-54   
ref|XP_004960246.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    196   4e-54   
ref|XP_001779575.1|  predicted protein                                  195   6e-54   
ref|XP_001785882.1|  predicted protein                                  195   1e-53   
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                   194   2e-53   
ref|XP_002984958.1|  hypothetical protein SELMODRAFT_181373             192   6e-53   
ref|XP_001758838.1|  predicted protein                                  192   8e-53   
ref|XP_002960044.1|  hypothetical protein SELMODRAFT_401997             172   5e-46   
ref|XP_005846436.1|  hypothetical protein CHLNCDRAFT_36035              167   8e-44   
gb|KIY99765.1|  hypothetical protein MNEG_8195                          165   4e-43   
gb|ACG28940.1|  NADPH--cytochrome P450 reductase                        163   1e-42   
ref|XP_001690130.1|  NADPH-cytochrome P450 reductase                    161   6e-42   
ref|XP_009051974.1|  hypothetical protein LOTGIDRAFT_187717             161   6e-42   
ref|XP_011427038.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    159   3e-41   
gb|KHN78699.1|  NADPH--cytochrome P450 reductase                        150   9e-41   
emb|CEP08857.1|  hypothetical protein                                   157   2e-40   
ref|XP_002953937.1|  hypothetical protein VOLCADRAFT_76078              155   7e-40   
gb|EKC21191.1|  NADPH--cytochrome P450 reductase                        155   5e-39   
ref|XP_001631497.1|  predicted protein                                  153   7e-39   
gb|KHN73846.1|  NADPH--cytochrome P450 reductase                        149   8e-38   
gb|EPY26135.1|  NADPH-ferrihemoprotein reductase                        149   1e-37   
gb|EPY30731.1|  NADPH-ferrihemoprotein reductase                        149   1e-37   
ref|XP_003378184.1|  NADPH--cytochrome P450 reductase                   151   2e-37   
gb|EIE89541.1|  hypothetical protein RO3G_14252                         149   3e-37   
dbj|BAN82201.1|  hypothetical protein                                   148   4e-37   
ref|XP_004988260.1|  cytochrome P450 reductase                          148   4e-37   
gb|EPB87224.1|  hypothetical protein HMPREF1544_05946                   148   6e-37   
emb|CDS03498.1|  hypothetical protein LRAMOSA00900                      147   8e-37   
dbj|GAN10969.1|  NADPh-cytochrome p450 reductase protein                147   1e-36   
prf||1103184A  reductase,NADPH cytochrome P450                          138   2e-36
emb|CEG74525.1|  Putative NADPH--cytochrome P450 reductase              147   2e-36   
emb|CEI90083.1|  Putative NADPH--cytochrome P450 reductase              146   2e-36   
emb|CDH48577.1|  nadph-cytochrome p450 reductase                        146   3e-36   
gb|ELU16857.1|  hypothetical protein CAPTEDRAFT_153661                  143   5e-36   
emb|CEJ03087.1|  Putative NADPH--cytochrome P450 reductase              145   6e-36   
ref|XP_002612108.1|  hypothetical protein BRAFLDRAFT_288748             144   7e-36   
ref|XP_003074517.1|  NADPH-cytochrome P-450 reductase (ISS)             144   8e-36   
gb|KJB22142.1|  hypothetical protein B456_004G0316002                   141   9e-36   
emb|CEF96794.1|  Flavoprotein pyridine nucleotide cytochrome redu...    144   1e-35   
ref|XP_008186078.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    141   1e-35   
gb|EIE77771.1|  hypothetical protein RO3G_02475                         144   2e-35   
ref|XP_007639858.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   2e-35   
emb|CEF67768.1|  NADPH--cytochrome P450 reductase                       143   3e-35   
emb|CDS11152.1|  hypothetical protein LRAMOSA03415                      143   3e-35   
gb|KJB53795.1|  hypothetical protein B456_009G005600                    142   5e-35   
gb|ELT87080.1|  hypothetical protein CAPTEDRAFT_173459                  142   5e-35   
ref|NP_001030467.1|  NADPH--cytochrome P450 reductase                   142   5e-35   
ref|XP_007186623.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    142   5e-35   
ref|XP_010852620.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    142   5e-35   
sp|Q3SYT8.3|NCPR_BOVIN  RecName: Full=NADPH--cytochrome P450 redu...    142   6e-35   
ref|XP_001945312.1|  PREDICTED: NADPH--cytochrome P450 reductase        142   6e-35   
ref|WP_007922873.1|  NADPH--cytochrome P450 reductase                   144   6e-35   
ref|XP_006201451.1|  PREDICTED: NADPH--cytochrome P450 reductase        142   8e-35   
emb|CCD15772.1|  unnamed protein product                                135   8e-35   
ref|XP_002108516.1|  hypothetical protein TRIADDRAFT_63169              142   8e-35   
emb|CDW58665.1|  NAD binding 1 domain containing protein                134   8e-35   
emb|CDJ97504.1|  Oxidoreductase FAD NAD(P)-binding domain contain...    134   9e-35   
ref|XP_005645698.1|  NADPH-cytochrome P450 reductase                    141   9e-35   
ref|XP_001415936.1|  predicted protein                                  140   9e-35   
ref|WP_043986383.1|  FAD-binding protein                                140   1e-34   
ref|WP_043391935.1|  FAD-binding protein                                140   1e-34   
ref|XP_007433824.1|  PREDICTED: NADPH--cytochrome P450 reductase        141   1e-34   
dbj|BAG56734.1|  unnamed protein product                                139   1e-34   
ref|XP_004620908.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    140   2e-34   
gb|EHH52076.1|  hypothetical protein EGM_12446                          140   2e-34   
pdb|3QFT|A  Chain A, Crystal Structure Of Nadph-Cytochrome P450 R...    139   2e-34   
pdb|3QFS|A  Chain A, Crystal Structure Of Nadph-Cytochrome P450 R...    139   2e-34   
ref|XP_007104040.1|  PREDICTED: NADPH--cytochrome P450 reductase        140   2e-34   
gb|ETE65154.1|  NADPH-cytochrome reductase                              140   2e-34   
gb|EFA83496.1|  NADPH-cytochrome-P450 oxidoreductase                    140   2e-34   
gb|EQB57087.1|  hypothetical protein CGLO_02825                         140   3e-34   
ref|XP_004620907.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    140   3e-34   
gb|EJW84802.1|  hypothetical protein WUBG_04289                         133   3e-34   
ref|XP_006033298.1|  PREDICTED: NADPH--cytochrome P450 reductase        140   3e-34   
ref|XP_808628.1|  P450 reductase                                        133   5e-34   
gb|ENH85424.1|  nadph-cytochrome p450 reductase                         139   5e-34   
pdb|3QE2|A  Chain A, Crystal Structure Of Human Nadph-Cytochrome ...    139   6e-34   
pdb|3QFR|A  Chain A, Crystal Structure Of Human Nadph-Cytochrome ...    139   6e-34   
ref|XP_007518012.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    139   6e-34   
pdb|3QFC|A  Chain A, Crystal Structure Of Human Nadph-Cytochrome ...    139   6e-34   
gb|ACF83106.1|  unknown                                                 128   6e-34   
ref|XP_008947241.1|  PREDICTED: NADPH--cytochrome P450 reductase        138   7e-34   
ref|XP_009240959.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    137   7e-34   
pdb|3FJO|A  Chain A, Structure Of Chimeric Yh Cpr                       139   7e-34   
emb|CEF99664.1|  Flavoprotein pyridine nucleotide cytochrome redu...    140   7e-34   
gb|KFQ23534.1|  NADPH--cytochrome P450 reductase                        137   7e-34   
ref|XP_006274812.1|  PREDICTED: NADPH--cytochrome P450 reductase        139   8e-34   
ref|XP_008139684.1|  PREDICTED: NADPH--cytochrome P450 reductase        139   8e-34   
ref|XP_005879217.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   8e-34   
ref|XP_006088353.1|  PREDICTED: NADPH--cytochrome P450 reductase        139   8e-34   
ref|XP_005879216.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   8e-34   
ref|XP_004268859.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   8e-34   
gb|AAB21814.1|  cytochrome P450 reductase                               139   8e-34   
gb|AAX36181.1|  P450 cytochrome oxidoreductase                          139   9e-34   
ref|XP_003082028.1|  NADPH-ferrihemoprotein reductase (ISS)             140   9e-34   
sp|P16435.2|NCPR_HUMAN  RecName: Full=NADPH--cytochrome P450 redu...    139   9e-34   
dbj|BAB18572.1|  NADPH-cytochrome P-450 reductase                       139   9e-34   
gb|AAH34277.1|  P450 (cytochrome) oxidoreductase                        139   1e-33   
dbj|BAD93111.1|  Hypothetical protein DKFZp686G04235 variant            139   1e-33   
ref|XP_006773443.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   1e-33   
dbj|BAF83218.1|  unnamed protein product                                139   1e-33   
ref|XP_006773444.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   1e-33   
dbj|BAG59240.1|  unnamed protein product                                137   1e-33   
emb|CAH56151.1|  hypothetical protein                                   139   1e-33   
ref|NP_000932.3|  NADPH--cytochrome P450 reductase                      139   1e-33   
sp|P04175.2|NCPR_PIG  RecName: Full=NADPH--cytochrome P450 reduct...    139   1e-33   
dbj|BAG35442.1|  unnamed protein product                                139   1e-33   
ref|XP_005109645.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    139   1e-33   
emb|CCF32060.1|  NADPH-cytochrome P450 reductase                        139   1e-33   
ref|NP_001123431.1|  NADPH--cytochrome P450 reductase                   139   1e-33   
gb|EPQ15742.1|  NADPH--cytochrome P450 reductase                        139   1e-33   
emb|CEG78819.1|  Putative NADPH--cytochrome P450 reductase              137   1e-33   
ref|XP_007278117.1|  cytochrome p450 oxidoreductase                     139   1e-33   
ref|XP_010891864.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   1e-33   
gb|KDN70201.1|  putative FAD binding domain-containing protein          138   2e-33   
gb|EAW71780.1|  P450 (cytochrome) oxidoreductase, isoform CRA_d         138   2e-33   
ref|XP_005620963.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   2e-33   
gb|ABR25415.1|  NADPH-cytochrome p450 reductase                         127   2e-33   
ref|XP_004326617.1|  PREDICTED: NADPH--cytochrome P450 reductase        138   2e-33   
gb|EPY24868.1|  NADPH-ferrihemoprotein reductase                        135   2e-33   
ref|NP_001171276.1|  NADPH--cytochrome P450 reductase                   138   2e-33   
ref|XP_004587043.1|  PREDICTED: NADPH--cytochrome P450 reductase        138   2e-33   
ref|XP_008016568.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   2e-33   
gb|KCW78707.1|  hypothetical protein EUGRSUZ_C00154                     137   2e-33   
ref|XP_004761691.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   2e-33   
ref|XP_009022160.1|  hypothetical protein HELRODRAFT_113572             137   2e-33   
ref|XP_006918626.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   2e-33   
gb|ELK06871.1|  NADPH--cytochrome P450 reductase                        137   3e-33   
ref|XP_008016563.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   3e-33   
ref|XP_003895904.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   3e-33   
ref|XP_007680859.1|  hypothetical protein BAUCODRAFT_28100              137   3e-33   
emb|CEG78818.1|  Putative NADPH--cytochrome P450 reductase              138   3e-33   
ref|WP_036260452.1|  sulfite reductase                                  136   3e-33   
ref|XP_005620957.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    138   3e-33   
ref|XP_010385741.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   3e-33   
ref|XP_009201080.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   3e-33   
ref|NP_001248085.1|  NADPH--cytochrome P450 reductase                   137   3e-33   
gb|EHH17234.1|  hypothetical protein EGK_13584                          137   3e-33   
ref|XP_005620956.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   3e-33   
ref|XP_008016562.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   3e-33   
ref|XP_010891863.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   3e-33   
gb|KJE97834.1|  NADPH-cytochrome P450 reductase, variant                137   3e-33   
ref|XP_008493329.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   3e-33   
ref|XP_007590680.1|  NADPH-cytochrome P450 reductase                    137   3e-33   
ref|XP_009684173.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   3e-33   
ref|WP_015249791.1|  NADPH--cytochrome P450 reductase                   139   4e-33   
ref|XP_005620955.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   4e-33   
gb|ADM18969.1|  NADPH-cytochrome P450 oxidoreductase                    137   4e-33   
ref|XP_009451644.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   4e-33   
ref|XP_003276705.2|  PREDICTED: NADPH--cytochrome P450 reductase        137   4e-33   
ref|XP_001155755.2|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   4e-33   
ref|XP_008016559.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   4e-33   
ref|NP_001182725.1|  NADPH--cytochrome P450 reductase                   137   4e-33   
ref|XP_009883428.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   4e-33   
gb|ACH57407.1|  cytochrome P450 reductase isoform 2                     137   4e-33   
ref|XP_004045657.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   4e-33   
ref|WP_016842902.1|  hypothetical protein                               134   4e-33   
gb|KFV86865.1|  NADPH--cytochrome P450 reductase                        137   4e-33   
gb|KGL93369.1|  NADPH--cytochrome P450 reductase                        137   5e-33   
ref|XP_011369842.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   5e-33   
ref|XP_005056571.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   5e-33   
ref|XP_009684172.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   5e-33   
ref|XP_011288662.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   5e-33   
dbj|BAE72975.1|  hypothetical protein                                   136   6e-33   
emb|CDK26973.1|  unnamed protein product                                137   6e-33   
gb|AAF89958.1|AF195659_1  NADPH-dependent cytochrome P450 oxidore...    137   6e-33   
ref|XP_010720070.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    136   6e-33   
gb|AAD56649.1|AF178973_4  OR                                            136   6e-33   
ref|XP_005495092.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   7e-33   
ref|XP_004343008.1|  NADPH-cytochrome P450 reductase                    136   7e-33   
gb|EPS33038.1|  hypothetical protein PDE_07999                          136   8e-33   
ref|XP_010720066.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    136   8e-33   
emb|CCD14870.1|  unnamed protein product                                135   9e-33   
ref|XP_009658187.1|  NADPH-cytochrome P450 reductase                    136   9e-33   
emb|CEI91782.1|  Putative NADPH--cytochrome P450 reductase              136   1e-32   
gb|AAF89959.1|AF195660_1  NADPH-dependent cytochrome P450 oxidore...    135   1e-32   
emb|CEG63207.1|  Putative NADPH--cytochrome P450 reductase              136   1e-32   
ref|XP_002507692.1|  predicted protein                                  136   1e-32   
ref|XP_004688336.1|  PREDICTED: NADPH--cytochrome P450 reductase        136   1e-32   
gb|EWC45357.1|  NADPH--cytochrome P450 reductase                        136   1e-32   
ref|XP_799192.3|  PREDICTED: NADPH--cytochrome P450 reductase-like      135   1e-32   
ref|XP_005425451.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   1e-32   
ref|XP_007938439.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   1e-32   
gb|ABD83817.1|  P450 hydroxylase                                        137   1e-32   
emb|CCX05125.1|  Similar to NADPH--cytochrome P450 reductase; acc...    135   2e-32   
gb|EFB20390.1|  hypothetical protein PANDA_012660                       135   2e-32   
gb|KFW86392.1|  NADPH--cytochrome P450 reductase                        135   2e-32   
ref|XP_008928644.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   2e-32   
ref|XP_008280827.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   2e-32   
gb|AFD50507.1|  NADPH-cytochrome P450 reductase                         135   2e-32   
ref|XP_011228458.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   2e-32   
ref|XP_011228457.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   2e-32   
gb|ACH57406.1|  cytochrome P450 reductase isoform 1                     135   2e-32   
ref|WP_044538695.1|  NADPH--cytochrome P450 reductase                   137   2e-32   
ref|XP_009092939.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   2e-32   
gb|AHM93009.1|  NADPH-cytochrome P450 reductase                         135   2e-32   
gb|KFO75627.1|  NADPH--cytochrome P450 reductase                        135   2e-32   
ref|XP_011228455.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   2e-32   
gb|EPY33847.1|  NADPH-ferrihemoprotein reductase                        135   2e-32   
gb|EXX70271.1|  Ncp1p                                                   134   2e-32   
ref|XP_009558457.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   2e-32   
ref|WP_040518010.1|  reductase                                          137   2e-32   
gb|EGD55572.1|  molybdopterin oxidoreductase                            137   2e-32   
ref|XP_008586608.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   2e-32   
pdb|3ES9|A  Chain A, Nadph-Cytochrome P450 Reductase In An Open C...    134   2e-32   
pdb|1AMO|A  Chain A, Three-Dimensional Structure Of Nadph-Cytochr...    134   2e-32   
gb|KGL82100.1|  NADPH--cytochrome P450 reductase                        133   2e-32   
gb|EUA71951.1|  oxidoreductase NAD-binding domain protein               127   2e-32   
pdb|3WKT|A  Chain A, Complex Structure Of An Open Form Of Nadph-c...    134   2e-32   
emb|CEI85592.1|  Putative NADPH--cytochrome P450 reductase              135   2e-32   
emb|CCD52117.1|  hypothetical protein BofuT4_P082760.1                  127   2e-32   
ref|XP_007468859.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   2e-32   
gb|ETN78071.1|  FAD binding domain protein                              135   2e-32   
ref|NP_032924.1|  NADPH--cytochrome P450 reductase                      135   2e-32   
ref|XP_002923514.2|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   2e-32   
gb|KFQ51301.1|  NADPH--cytochrome P450 reductase                        135   3e-32   
ref|XP_005598713.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   3e-32   
ref|XP_010219945.1|  PREDICTED: NADPH--cytochrome P450 reductase        133   3e-32   
ref|NP_001116127.1|  NADPH--cytochrome P450 reductase                   135   3e-32   
ref|XP_828912.1|  NADPH--cytochrome P450 reductase                      134   3e-32   
ref|XP_008280826.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   3e-32   



>ref|XP_004165700.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Cucumis 
sativus]
Length=503

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELGP++LFFGCRNR MDYIYEDELNNFVETGALSEL+IAFSREG
Sbjct  367  FRGFLQERLALKESGVELGPSILFFGCRNRAMDYIYEDELNNFVETGALSELVIAFSREG  426

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+DIWNLISQGAYLYVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  427  PTKEYVQHKMTEKASDIWNLISQGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  486

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQ SGRYLRDVW
Sbjct  487  SMVKNLQTSGRYLRDVW  503



>gb|ACP43317.1| NADPH cytochrome P450 reductase [Citrus maxima]
Length=209

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE GAELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  73   FRGFLQERFALKEAGAELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  132

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +K++DIWN+ S+GAYLYVCGDAK MARDVHRTLHTI QEQGSLDSSKAE
Sbjct  133  PTKEYVQHKMMEKSSDIWNMFSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAE  192

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  193  SMVKNLQMTGRYLRDVW  209



>ref|XP_004146317.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Cucumis sativus]
 gb|AIT72028.1| cytochrome P450 reductase [Cucumis sativus]
 gb|KGN65457.1| hypothetical protein Csa_1G423150 [Cucumis sativus]
Length=708

 Score =   274 bits (700),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELGP++LFFGCRNR MDYIYEDELNNFVETGALSEL+IAFSREG
Sbjct  572  FRGFLQERLALKESGVELGPSILFFGCRNRAMDYIYEDELNNFVETGALSELVIAFSREG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+DIWNLISQGAYLYVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  632  PTKEYVQHKMTEKASDIWNLISQGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  691

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQ SGRYLRDVW
Sbjct  692  SMVKNLQTSGRYLRDVW  708



>ref|XP_008453604.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Cucumis melo]
Length=708

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELGP++LFFGCRNR MDYIYEDELNNFVE GALSEL+IAFSREG
Sbjct  572  FRGFLQERLALKESGVELGPSILFFGCRNRAMDYIYEDELNNFVEAGALSELVIAFSREG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+DIWNLISQGAYLYVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  632  PTKEYVQHKMTEKASDIWNLISQGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  691

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK+LQ SGRYLRDVW
Sbjct  692  SMVKSLQTSGRYLRDVW  708



>gb|AEA86315.1| NADPH-cytochrome P450 reductase [Solanum nigrum]
Length=141

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK+EGAELGPA+LFFGCRNR+MDYIY+DEL+NF+E GALSEL++AFSREG
Sbjct  5    FRGFLQERMALKKEGAELGPAVLFFGCRNRQMDYIYQDELDNFLEAGALSELVVAFSREG  64

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM++KAADIWN+ISQG Y+YVCGDAKG+ARDVHRTLHTI Q+QGSLD+SK E
Sbjct  65   PNKEYVQHKMTEKAADIWNMISQGGYVYVCGDAKGVARDVHRTLHTIAQDQGSLDNSKTE  124

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQ +GRYLRDVW
Sbjct  125  SFVKNLQTTGRYLRDVW  141



>gb|KDO43876.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=509

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E GAELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  373  FRGFLQERFALQEAGAELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  432

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +K++DIWN++S+GAYLYVCGDAK MARDVHRTLHTI QEQGSLDSSKAE
Sbjct  433  PTKEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAE  492

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  493  SMVKNLQMTGRYLRDVW  509



>ref|XP_003610110.1| NADPH cytochrome P450 reductase [Medicago truncatula]
Length=490

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKEEGAELGP++LFFGCRNR++DYIYEDELN+FV  GALSELI+AFSREG
Sbjct  354  FRGFLQERLALKEEGAELGPSVLFFGCRNRQVDYIYEDELNHFVHGGALSELIVAFSREG  413

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+ISQGAY+YVCGDAKGMA+DVHRTLHTI QEQGSLD+SK E
Sbjct  414  PTKEYVQHKMIEKASDIWNMISQGAYIYVCGDAKGMAKDVHRTLHTILQEQGSLDNSKTE  473

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  474  SMVKNLQMTGRYLRDVW  490



>gb|ACN54324.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=710

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGP++LFFGCRNRKMD+IYEDELNNFV +GALSEL++AFSREG
Sbjct  574  FRGFLQERLALKEAGAELGPSVLFFGCRNRKMDFIYEDELNNFVNSGALSELVVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA DIW++ISQG YLYVCGDAKGMARDVHR LHTIFQEQGSLDSSKAE
Sbjct  634  PTKEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMARDVHRALHTIFQEQGSLDSSKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  694  SMVKNLQMSGRYLRDVW  710



>gb|KHG09184.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=710

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGP++LFFGCRNRKMD+IYEDELNNFV +GALSEL++AFSREG
Sbjct  574  FRGFLQERLALKEAGAELGPSVLFFGCRNRKMDFIYEDELNNFVNSGALSELVVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA DIW++ISQG YLYVCGDAKGMARDVHR LHTIFQEQGSLDSSKAE
Sbjct  634  PTKEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMARDVHRALHTIFQEQGSLDSSKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  694  SMVKNLQMSGRYLRDVW  710



>ref|XP_007227446.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
 gb|EMJ28645.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
Length=710

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E GAELGP+ LFFGCRN K DYIYEDELNNF+ETGALSEL++AFSR+G
Sbjct  574  FRGFLQERLALIEAGAELGPSTLFFGCRNSKTDYIYEDELNNFLETGALSELVVAFSRQG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA+DIWN++SQGAY+YVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  634  PTKEYVQHKMTQKASDIWNMLSQGAYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  694  SMVKNLQMSGRYLRDVW  710



>gb|KDO43875.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=554

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E GAELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  418  FRGFLQERFALQEAGAELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  477

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +K++DIWN++S+GAYLYVCGDAK MARDVHRTLHTI QEQGSLDSSKAE
Sbjct  478  PTKEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAE  537

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  538  SMVKNLQMTGRYLRDVW  554



>gb|KDO43874.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=555

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E GAELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  419  FRGFLQERFALQEAGAELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  478

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +K++DIWN++S+GAYLYVCGDAK MARDVHRTLHTI QEQGSLDSSKAE
Sbjct  479  PTKEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAE  538

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  539  SMVKNLQMTGRYLRDVW  555



>gb|ABK92896.1| unknown [Populus trichocarpa]
Length=183

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELG ++LFFGCRNR+MD+IYEDELNNFVE+GALSEL +AFSREG
Sbjct  47   FRGFLQERLAQKEAGAELGSSVLFFGCRNRQMDFIYEDELNNFVESGALSELSVAFSREG  106

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG YLYVCGDAKGMA+DVHRTLHTI QEQGSLD+SK E
Sbjct  107  PTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTE  166

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK LQM+GRYLRDVW
Sbjct  167  SFVKGLQMNGRYLRDVW  183



>ref|XP_007014268.1| P450 reductase 2 [Theobroma cacao]
 gb|EOY31887.1| P450 reductase 2 [Theobroma cacao]
Length=710

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGP++LFFGCRNRKMDYIYEDELNNFV  GALSE+++AFSREG
Sbjct  574  FRGFLQERLALKEAGAELGPSVLFFGCRNRKMDYIYEDELNNFVNGGALSEIVVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG YLYVCGDAKGMA+DVHRTLHTI QEQG LDSSKAE
Sbjct  634  PTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHTILQEQGCLDSSKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  694  SMVKNLQMTGRYLRDVW  710



>ref|XP_004148333.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
 gb|KGN61141.1| hypothetical protein Csa_2G059720 [Cucumis sativus]
Length=708

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG ++LFFGCRNRKMDYIYEDELNNFVETGALSELI+AFSREG
Sbjct  572  FRGFLQERLALKESGVELGHSILFFGCRNRKMDYIYEDELNNFVETGALSELILAFSREG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P+KEYVQHKM +KA+DIWNL+SQGAY+YVCGDAKGMARDVHRTLH I QEQGSLDSSKAE
Sbjct  632  PSKEYVQHKMVEKASDIWNLLSQGAYIYVCGDAKGMARDVHRTLHNIVQEQGSLDSSKAE  691

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  692  SMVKNLQMSGRYLRDVW  708



>dbj|BAG68945.1| cytochrome P450 reductase [Lotus japonicus]
Length=706

 Score =   266 bits (679),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+GAELGP++LFFGCRNR+MDYIYEDELN+FV +GALSELI+AFSREG
Sbjct  570  FRGFLQERLALKEDGAELGPSVLFFGCRNRQMDYIYEDELNHFVNSGALSELIVAFSREG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+ISQGAY+YVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  630  PTKEYVQHKMMEKASDIWNMISQGAYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAE  689

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKNLQ++GRYLRDVW
Sbjct  690  GMVKNLQLNGRYLRDVW  706



>ref|XP_004168364.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
Length=708

 Score =   265 bits (678),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA+KE G ELG ++LFFGCRNRKMDYIYEDELNNFVETGALSELI+AFSREG
Sbjct  572  FRGFLQERLAMKESGVELGHSILFFGCRNRKMDYIYEDELNNFVETGALSELILAFSREG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P+KEYVQHKM +KA+DIWNL+SQGAY+YVCGDAKGMARDVHRTLH I QEQGSLDSSKAE
Sbjct  632  PSKEYVQHKMVEKASDIWNLLSQGAYIYVCGDAKGMARDVHRTLHNIVQEQGSLDSSKAE  691

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  692  SMVKNLQMSGRYLRDVW  708



>ref|XP_008223694.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Prunus mume]
Length=710

 Score =   265 bits (678),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL + GAELGP+ LFFGCRN K DYIYEDELNNF+ETGALSEL++AFSR+G
Sbjct  574  FRGFLQERLALIKAGAELGPSTLFFGCRNSKTDYIYEDELNNFLETGALSELVVAFSRQG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA+DIWN++SQGAY+YVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  634  PTKEYVQHKMTQKASDIWNMLSQGAYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  694  SMVKNLQMSGRYLRDVW  710



>gb|AHA50098.1| CYP450 reductase [Panax ginseng]
Length=709

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+L+FGCRNRK+D+IYEDELNNFVE+GA+SE+++AFSREG
Sbjct  573  FRGFLQERLALKEAGAELGPAVLYFGCRNRKLDFIYEDELNNFVESGAISEMVVAFSREG  632

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKMSQKA++IWN+IS+GAY+YVCGDAKGMARDVHRTLHTI QEQG+LDSSKAE
Sbjct  633  PTKEYVQHKMSQKASEIWNMISEGAYIYVCGDAKGMARDVHRTLHTIAQEQGALDSSKAE  692

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNLQM+GRYLRDVW
Sbjct  693  SLVKNLQMTGRYLRDVW  709



>gb|KJB53797.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=711

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGP++LFFGCRNRKMD+IYEDELNNFV +GALSEL++AFSREG
Sbjct  575  FRGFLQERLALKEAGAELGPSVLFFGCRNRKMDFIYEDELNNFVNSGALSELVVAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA DIW++ISQG YLYVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  635  PTKEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMARDVHRALHTILQEQGSLDSSKAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  695  SMVKNLQMSGRYLRDVW  711



>gb|KJB53794.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=710

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGP++LFFGCRNRKMD+IYEDELNNFV +GALSEL++AFSREG
Sbjct  574  FRGFLQERLALKEAGAELGPSVLFFGCRNRKMDFIYEDELNNFVNSGALSELVVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA DIW++ISQG YLYVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  634  PTKEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMARDVHRALHTILQEQGSLDSSKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  694  SMVKNLQMSGRYLRDVW  710



>ref|XP_010093854.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB54742.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=715

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G +LGP++LFFGCRNR+MDYIYE+EL NFVETGALSEL++AFSREG
Sbjct  579  FRGFLQERLALKESGTDLGPSILFFGCRNRRMDYIYEEELANFVETGALSELVVAFSREG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKAADIW++ISQGAY+YVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  639  PTKEYVQHKMMQKAADIWDMISQGAYIYVCGDAKGMAKDVHRTLHTIAQEQGSLDSSKAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  699  SMVKNLQMNGRYLRDVW  715



>gb|KDO43870.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=687

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E GAELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  551  FRGFLQERFALQEAGAELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  610

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +K++DIWN++S+GAYLYVCGDAK MARDVHRTLHTI QEQGSLDSSKAE
Sbjct  611  PTKEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAE  670

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  671  SMVKNLQMTGRYLRDVW  687



>emb|CBI17838.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE GAELG ++LFFGCRNRKMDYIYEDELN FVE+GALSELI+AFSREG
Sbjct  524  FRGFLQERFALKEAGAELGSSILFFGCRNRKMDYIYEDELNGFVESGALSELIVAFSREG  583

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  584  PTKEYVQHKMMEKASDIWNVISQGGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAE  643

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  644  SMVKNLQMTGRYLRDVW  660



>gb|KJB22140.1| hypothetical protein B456_004G0316002, partial [Gossypium raimondii]
Length=398

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GA+LGP++LFFGCRNRKMDYIYEDELNNFV +GALSEL++AFSREG
Sbjct  262  FRGFLQERLALKEAGADLGPSVLFFGCRNRKMDYIYEDELNNFVNSGALSELVVAFSREG  321

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+IS+G YLYVCGDAKGMARDVHRTL TI  EQG LDSSKAE
Sbjct  322  PTKEYVQHKMMEKASDIWNMISEGGYLYVCGDAKGMARDVHRTLLTILHEQGCLDSSKAE  381

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNL  +GRYLRDVW
Sbjct  382  SMVKNLHTTGRYLRDVW  398



>ref|XP_002270732.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
Length=705

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE GAELG ++LFFGCRNRKMDYIYEDELN FVE+GALSELI+AFSREG
Sbjct  569  FRGFLQERFALKEAGAELGSSILFFGCRNRKMDYIYEDELNGFVESGALSELIVAFSREG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  629  PTKEYVQHKMMEKASDIWNVISQGGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAE  688

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  689  SMVKNLQMTGRYLRDVW  705



>ref|XP_004296434.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+GAELGP++LFFGCRN +MDYIYEDELNNFVE GALSEL++AFSR+G
Sbjct  573  FRGFLQERLALKEDGAELGPSILFFGCRNSQMDYIYEDELNNFVEKGALSELVVAFSRQG  632

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG Y+YVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  633  PTKEYVQHKMMQKASDIWNMISQGGYIYVCGDAKGMAKDVHRTLHTILQEQGSLDSSKAE  692

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQ +GRYLRDVW
Sbjct  693  SMVKNLQTNGRYLRDVW  709



>gb|KDO43869.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=710

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E GAELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  574  FRGFLQERFALQEAGAELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +K++DIWN++S+GAYLYVCGDAK MARDVHRTLHTI QEQGSLDSSKAE
Sbjct  634  PTKEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  694  SMVKNLQMTGRYLRDVW  710



>gb|AIG15452.1| NADPH-cytochrome P450 reductase 2 [Azadirachta indica]
Length=715

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE GAELGP++LFFGCRNR+MDYIYEDELNNFV++GALSEL++AFSR+G
Sbjct  579  FRGFLQERFALKEAGAELGPSVLFFGCRNRQMDYIYEDELNNFVQSGALSELVVAFSRQG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+ISQG YLYVCGDAKGMARDVHRTLHTI QEQGS+DSSKAE
Sbjct  639  PTKEYVQHKMMEKASDIWNMISQGGYLYVCGDAKGMARDVHRTLHTIVQEQGSVDSSKAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNLQM+GRYLRDVW
Sbjct  699  SIVKNLQMTGRYLRDVW  715



>gb|KDO43868.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=715

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E GAELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  579  FRGFLQERFALQEAGAELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +K++DIWN++S+GAYLYVCGDAK MARDVHRTLHTI QEQGSLDSSKAE
Sbjct  639  PTKEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  699  SMVKNLQMTGRYLRDVW  715



>gb|KDO43871.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=714

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E GAELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  578  FRGFLQERFALQEAGAELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  637

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +K++DIWN++S+GAYLYVCGDAK MARDVHRTLHTI QEQGSLDSSKAE
Sbjct  638  PTKEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAE  697

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  698  SMVKNLQMTGRYLRDVW  714



>gb|ACF35280.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=709

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNRKMDYIYEDELNNFV TGALSELI+AFSREG
Sbjct  573  FRGFLQERLALKEAGVELGHAILFFGCRNRKMDYIYEDELNNFVNTGALSELIVAFSREG  632

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+D W++ISQGAY+YVCGDAKGMARDVHRTLHTI QEQG LDSSKAE
Sbjct  633  PTKEYVQHKMAEKASDFWSMISQGAYIYVCGDAKGMARDVHRTLHTIVQEQGCLDSSKAE  692

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  693  SMVKNLQMTGRYLRDVW  709



>gb|AAC09468.2| putative NADPH-cytochrome P450 reductase [Pisum sativum]
Length=704

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+GAELGP++LFFGCRNR++DYIYEDELN+FV  GALSELI+AFSR+G
Sbjct  568  FRGFLQERLALKEDGAELGPSVLFFGCRNRQVDYIYEDELNHFVNGGALSELIVAFSRDG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+ISQGAY+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  628  PTKEYVQHKMMEKASDIWNMISQGAYVYVCGDAKGMARDVHRTLHTILQEQGSLDSSKTE  687

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  688  SMVKNLQMTGRYLRDVW  704



>emb|CAN77401.1| hypothetical protein VITISV_027794 [Vitis vinifera]
Length=745

 Score =   264 bits (675),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE GAELG ++LFFGCRNRKMDYIYEDELN FVE+GALSELI+AFSREG
Sbjct  609  FRGFLQERFALKEAGAELGSSILFFGCRNRKMDYIYEDELNGFVESGALSELIVAFSREG  668

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  669  PTKEYVQHKMMEKASDIWNVISQGGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAE  728

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  729  SMVKNLQMTGRYLRDVW  745



>ref|XP_003610109.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES92306.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=701

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKEEGAELGP++LFFGCRNR++DYIYEDELN+FV  GALSELI+AFSREG
Sbjct  565  FRGFLQERLALKEEGAELGPSVLFFGCRNRQVDYIYEDELNHFVHGGALSELIVAFSREG  624

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN+ISQGAY+YVCGDAKGMA+DVHRTLHTI QEQGSLD+SK E
Sbjct  625  PTKEYVQHKMIEKASDIWNMISQGAYIYVCGDAKGMAKDVHRTLHTILQEQGSLDNSKTE  684

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  685  SMVKNLQMTGRYLRDVW  701



>ref|XP_011069915.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=712

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFGCRN KMD+IY+DELNNFV+ G +SEL++AFSREG
Sbjct  576  FRGFLQERLALKESGAELGPAILFFGCRNSKMDFIYQDELNNFVKAGVISELVLAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA+++WN+IS+G Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  636  PTKEYVQHKMAQKASEVWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  695

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  696  SMVKNLQMSGRYLRDVW  712



>ref|XP_006474186.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Citrus 
sinensis]
Length=714

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE G ELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  578  FRGFLQERFALKEAGTELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  637

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +K+ DIWN++S+GAYLYVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  638  PIKEYVQHKMMEKSWDIWNMLSEGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  697

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  698  SMVKNLQMTGRYLRDVW  714



>ref|XP_006474185.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Citrus 
sinensis]
Length=715

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE G ELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  579  FRGFLQERFALKEAGTELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +K+ DIWN++S+GAYLYVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  639  PIKEYVQHKMMEKSWDIWNMLSEGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  699  SMVKNLQMTGRYLRDVW  715



>ref|XP_004507858.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=705

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 1/138 (1%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKEEGAELGP++LFFGCRNR++DYIYEDELN FV  GALSELI+AFSREG
Sbjct  568  FRGFLQERLALKEEGAELGPSVLFFGCRNRQVDYIYEDELNQFVNGGALSELIVAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQ-GAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKA  370
            PTKEYVQHKM +KA+DIWN+ISQ GAY+YVCGDAKGMARDVHRTLHTI QEQGSLDSSKA
Sbjct  628  PTKEYVQHKMMEKASDIWNMISQEGAYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKA  687

Query  369  ESMVKNLQMSGRYLRDVW  316
            ESMVKNLQM+GRYLRDVW
Sbjct  688  ESMVKNLQMNGRYLRDVW  705



>ref|XP_010048643.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Eucalyptus 
grandis]
 gb|KCW80967.1| hypothetical protein EUGRSUZ_C02330 [Eucalyptus grandis]
Length=711

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+G ELG ++LFFGCRNR+MDYIYE+ELNNFVE+GALSEL++AFSREG
Sbjct  575  FRGFLQERFALKEDGTELGTSILFFGCRNRRMDYIYEEELNNFVESGALSELVVAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWN++SQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  635  PTKEYVQHKMMEKASDIWNMLSQGAYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  695  SMVKNLQMSGRYLRDVW  711



>ref|XP_006453369.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66609.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=763

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE G ELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  627  FRGFLQERFALKEAGTELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  686

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +K+ DIWN++S+GAYLYVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  687  PIKEYVQHKMMEKSWDIWNMLSEGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  746

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  747  SMVKNLQMTGRYLRDVW  763



>ref|XP_006453370.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66610.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=764

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE G ELGP+LLFFGCRNRKMDYIYEDELNNFV++GALS+LI+AFSREG
Sbjct  628  FRGFLQERFALKEAGTELGPSLLFFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREG  687

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +K+ DIWN++S+GAYLYVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  688  PIKEYVQHKMMEKSWDIWNMLSEGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAE  747

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  748  SMVKNLQMTGRYLRDVW  764



>gb|AIC73829.1| cytochrome P450 reductase [Panax ginseng]
Length=678

 Score =   260 bits (664),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+L+FGCRNRK+D+IYE+ELNNFV++GA+SEL++AFSREG
Sbjct  542  FRGFLQERLALKETGAELGPAVLYFGCRNRKLDFIYEEELNNFVDSGAISELVVAFSREG  601

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKMSQKA+++WN+IS+GAY+YVCGDAKGMARDVHR LHTI QEQG+LDSSKAE
Sbjct  602  PTKEYVQHKMSQKASEVWNMISEGAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAE  661

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNLQM+GRYLRDVW
Sbjct  662  SLVKNLQMTGRYLRDVW  678



>gb|AEW43314.1| NADPH cytochrome P450 reductase [Picrorhiza kurrooa]
Length=710

 Score =   261 bits (666),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFGCRNR+MD+IYEDELNNFV+ G +SEL++AFSR+G
Sbjct  574  FRGFLQERLALKESGAELGPAVLFFGCRNRQMDFIYEDELNNFVKAGVISELVLAFSRQG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA+DIWN+IS+G Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  634  PTKEYVQHKMAQKASDIWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VKNLQM+GRYLRDVW
Sbjct  694  ALVKNLQMTGRYLRDVW  710



>dbj|BAJ97446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   248 bits (632),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNR+MD+IYEDELNNF E+GALSEL++AFSREG
Sbjct  119  FRGFLQERLALKETGVELGRAILFFGCRNRQMDFIYEDELNNFTESGALSELVVAFSREG  178

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KAAD+W+++SQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  179  PTKEYVQHKMAEKAADLWSIVSQGGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTE  238

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQ  GRYLRDVW
Sbjct  239  GYVKNLQTEGRYLRDVW  255



>emb|CDP02981.1| unnamed protein product [Coffea canephora]
Length=662

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKEEG ELGPA+ FFGCRNR+MDYIYEDELN+F ++GALSELI+AFSREG
Sbjct  526  FRGFLQERLALKEEGTELGPAVFFFGCRNRQMDYIYEDELNHFAKSGALSELIVAFSREG  585

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTK+YVQHKM++KA+DIW+++S+GAY+YVCGDAKGMARDVHRTLHTI QEQGS+DSSKAE
Sbjct  586  PTKQYVQHKMAEKASDIWSMLSEGAYVYVCGDAKGMARDVHRTLHTIVQEQGSMDSSKAE  645

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  646  SFVKNLQMSGRYLRDVW  662



>ref|XP_010914150.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=701

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+ FFGCRNRKMD+IYEDELNNFV+ GALSELI+AFSREG
Sbjct  565  FRGFLQERLALKESGAELGPAIFFFGCRNRKMDFIYEDELNNFVKAGALSELIVAFSREG  624

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM++KA DIW++IS+G Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  625  PAKEYVQHKMAEKAVDIWDIISKGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  684

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM GRYLRDVW
Sbjct  685  SMVKNLQMEGRYLRDVW  701



>ref|XP_006372089.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
 gb|ERP49886.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
Length=471

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G+ELG ++LFFGCRNRKMD+IYEDELNNFVE+GALSEL++AFSREG
Sbjct  335  FRGFLQERLALKEAGSELGSSVLFFGCRNRKMDFIYEDELNNFVESGALSELVVAFSREG  394

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG YLYVCGDAKGMA+DVHR LHTI QEQGS D+S+ E
Sbjct  395  PTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRALHTIVQEQGSFDNSRTE  454

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM+GRYLRDVW
Sbjct  455  SFVKSLQMNGRYLRDVW  471



>ref|XP_010447753.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=414

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+ELI+AFSREG
Sbjct  278  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELIVAFSREG  337

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  338  PTKEYVQHKMMDKASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  397

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQMSGRYLRDVW
Sbjct  398  GFVKNLQMSGRYLRDVW  414



>ref|XP_011079296.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=705

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  569  FRGFLQERLALKESGAELGPAILFFGCRNRQMDFIYEDELNNFVKAGVISELIVAFSREG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA+DIWN+IS+G Y+YVCGDAKGMARDVHRTLHTI QEQGS  SS+AE
Sbjct  629  PTKEYVQHKMTQKASDIWNIISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSRSSSEAE  688

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKNLQM+GRYLRDVW
Sbjct  689  GMVKNLQMTGRYLRDVW  705



>ref|XP_008383105.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Malus 
domestica]
Length=709

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+GAELGP+ LFFGCRN KMDYIYEDELNNF+ET ALSEL++AFSR+G
Sbjct  573  FRGFLQERLALKEDGAELGPSTLFFGCRNSKMDYIYEDELNNFLETSALSELVVAFSRQG  632

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+D+WN+ISQG Y+YVCGDAKGMARDVHRTLHTI QEQG + SSKAE
Sbjct  633  PTKEYVQHKMIQKASDVWNMISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGCMGSSKAE  692

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNLQM+GRYLRDVW
Sbjct  693  SLVKNLQMNGRYLRDVW  709



>ref|XP_008383106.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Malus 
domestica]
Length=708

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+GAELGP+ LFFGCRN KMDYIYEDELNNF+ET ALSEL++AFSR+G
Sbjct  572  FRGFLQERLALKEDGAELGPSTLFFGCRNSKMDYIYEDELNNFLETSALSELVVAFSRQG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+D+WN+ISQG Y+YVCGDAKGMARDVHRTLHTI QEQG + SSKAE
Sbjct  632  PTKEYVQHKMIQKASDVWNMISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGCMGSSKAE  691

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNLQM+GRYLRDVW
Sbjct  692  SLVKNLQMNGRYLRDVW  708



>ref|XP_009385909.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNRKMD+IYEDELNNFVETGALSELI+AFSREG
Sbjct  567  FRGFLQERLALKEAGVELGHAILFFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREG  626

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+D+WN+ISQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  627  PTKEYVQHKMTEKASDVWNIISQGGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTE  686

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  687  SFVKSLQMEGRYLRDVW  703



>gb|AAZ39649.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=715

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+EGAELGPA+LFFGCRN KMDYIY++ELNNF+E GALSEL++AFSREG
Sbjct  579  FRGFLQERLALKQEGAELGPAVLFFGCRNSKMDYIYQEELNNFLEAGALSELVVAFSREG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P K+YVQHKM++KAADIWN+ISQG Y+YVCGDAKGMARDVHRTLHTI Q+QGSLDS+KAE
Sbjct  639  PNKQYVQHKMTEKAADIWNMISQGGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSTKAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKNLQ +GRYLRDVW
Sbjct  699  GMVKNLQTTGRYLRDVW  715



>ref|XP_009607226.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=713

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+EGAELGPA+LFFGCRNR+MDYIY++EL+NF+E GALSEL++AFSREG
Sbjct  577  FRGFLQERLALKKEGAELGPAVLFFGCRNRQMDYIYQEELDNFLEAGALSELVVAFSREG  636

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKMS+KAADIWN+ISQG Y+YVCGDAKGMARDVHRTLHTI Q+QGSLDSSKAE
Sbjct  637  PNKEYVQHKMSEKAADIWNMISQGGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSSKAE  696

Query  366  SMVKNLQMSGRYLRDVW  316
             +VKNLQ +GRYLRDVW
Sbjct  697  GLVKNLQTTGRYLRDVW  713



>ref|XP_010265447.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=704

 Score =   258 bits (658),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE GAELGPA+LFFGCRNRKMDYIYE+ELN FV +GA+SEL+IAFSREG
Sbjct  568  FRGFLQERAALKEAGAELGPAVLFFGCRNRKMDYIYEEELNGFVASGAMSELVIAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+D+WN+IS G Y+YVCGDAKGMARDVHRTLHTI Q+QGSLDSSKAE
Sbjct  628  PTKEYVQHKMMEKASDVWNMISNGGYIYVCGDAKGMARDVHRTLHTIVQQQGSLDSSKAE  687

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM GRYLRDVW
Sbjct  688  SMVKNLQMEGRYLRDVW  704



>gb|AAK56276.1|AF367288_1 AT4g30210/F9N11_60 [Arabidopsis thaliana]
 gb|AAL15387.1| AT4g30210/F9N11_60 [Arabidopsis thaliana]
Length=340

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+EL +AFSREG
Sbjct  204  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREG  263

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAYLYVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  264  PTKEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  323

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQ SGRYLRDVW
Sbjct  324  GFVKNLQTSGRYLRDVW  340



>gb|AGX85599.1| NADPH:cytochrome P450 reductase [Scoparia dulcis]
Length=713

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGF+QERLALKE GAELGPA+LFFGCRN++MDYIYEDELN FVE G +SEL++AFSR+G
Sbjct  577  FRGFMQERLALKESGAELGPAVLFFGCRNKEMDYIYEDELNGFVEAGVISELVLAFSRQG  636

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+D+WN+IS+G Y+YVCGDAKGMARDVHRTLHTI QEQGSLD+SKAE
Sbjct  637  PTKEYVQHKMAEKASDLWNMISEGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSKAE  696

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKNLQMSGRYLRDVW
Sbjct  697  LMVKNLQMSGRYLRDVW  713



>ref|XP_003541616.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK  GAELGP++LFFGCRNR+MDYIYEDELN+FV TGALSELI+AFSREG
Sbjct  571  FRGFLQERLALKGGGAELGPSVLFFGCRNRQMDYIYEDELNHFVNTGALSELILAFSREG  630

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  631  PTKEYVQHKMMEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAE  690

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQ +GRYLRDVW
Sbjct  691  SMVKNLQTTGRYLRDVW  707



>ref|XP_004242931.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=715

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKEEGA+LGPA+LFFGCRNR+MDYIY+DEL+NF+E GALS L++AFSREG
Sbjct  579  FRGFLQERMALKEEGADLGPAVLFFGCRNRQMDYIYQDELDNFLEAGALSNLVVAFSREG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM+QKA DIWN+ISQG Y+YVCGDAKGMARDVHRTLHTI Q+QGSLDSSKAE
Sbjct  639  PNKEYVQHKMTQKADDIWNMISQGGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSSKAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQ +GRYLRDVW
Sbjct  699  SFVKNLQTTGRYLRDVW  715



>gb|AGL46979.1| cytochrome P450 reductase [Salvia miltiorrhiza]
Length=712

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFGCRNRKMD+IYE+ELNNFV+ G +SEL++AFSR+G
Sbjct  576  FRGFLQERLALKESGAELGPAVLFFGCRNRKMDFIYEEELNNFVKDGVVSELVLAFSRDG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA+++WN+IS+G Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  636  PTKEYVQHKMAQKASELWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTE  695

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM+GRYLRDVW
Sbjct  696  SFVKNLQMTGRYLRDVW  712



>ref|XP_003549436.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGP++LFFGCRNR+MDYIYEDEL++FV TGAL ELI+AFSREG
Sbjct  571  FRGFLQERLALKEGGAELGPSVLFFGCRNRQMDYIYEDELSHFVNTGALDELILAFSREG  630

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  631  PTKEYVQHKMMEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAE  690

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQ +GRYLRDVW
Sbjct  691  SMVKNLQTTGRYLRDVW  707



>gb|ADC94831.1| cytochrome P450 reductase [Perilla frutescens]
Length=709

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFGCRN KMD+IYEDELN+FV+ G +SEL++AFSREG
Sbjct  573  FRGFLQERLALKESGAELGPAILFFGCRNSKMDFIYEDELNHFVKAGVVSELVLAFSREG  632

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA D+WN+IS+G Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  633  PTKEYVQHKMAQKALDLWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTE  692

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM+GRYLRDVW
Sbjct  693  SFVKNLQMNGRYLRDVW  709



>ref|NP_001131393.1| uncharacterized protein LOC100192720 [Zea mays]
 gb|ACF79787.1| unknown [Zea mays]
Length=248

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELG ++ FFGCRN  MD+IYEDEL+NF+E GAL EL++AFSR+G
Sbjct  112  FRGFLQERLARKESGAELGRSVFFFGCRNSNMDFIYEDELSNFLEQGALFELVLAFSRQG  171

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  172  PTKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  231

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM GRYLRDVW
Sbjct  232  SFVKNLQMEGRYLRDVW  248



>ref|XP_009795589.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=713

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA K+EGAELGPA+LFFGCRNR+MDYIY++EL+NF+E GALSEL++AFSREG
Sbjct  577  FRGFLQERLAFKKEGAELGPAVLFFGCRNRQMDYIYQEELDNFLEAGALSELVVAFSREG  636

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKMS+KAADIWN+ISQG Y+YVCGDAKGMARDVHR LHTI Q+QGSLDSSKAE
Sbjct  637  PNKEYVQHKMSEKAADIWNMISQGGYVYVCGDAKGMARDVHRALHTIAQDQGSLDSSKAE  696

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VKNLQ++GRYLRDVW
Sbjct  697  ALVKNLQITGRYLRDVW  713



>ref|XP_011043963.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G+ELG ++LFFGCRNRKMD+IYEDELNNFVE+GALSEL++AFSREG
Sbjct  576  FRGFLQERLALKESGSELGSSVLFFGCRNRKMDFIYEDELNNFVESGALSELVVAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG YLYVCGDAKGMA+DVHR LHTI QEQGSLD+SK E
Sbjct  636  PTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRALHTIVQEQGSLDNSKTE  695

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM+GRYLRDVW
Sbjct  696  SFVKSLQMNGRYLRDVW  712



>ref|XP_010046982.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Eucalyptus 
grandis]
 gb|KCW78706.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=683

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELGP++LFFGCRNR+MD+IYEDELNNFV  GALSEL++AFSREG
Sbjct  547  FRGFLQERLALKEAGVELGPSILFFGCRNRRMDFIYEDELNNFVNAGALSELLVAFSREG  606

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIW +IS+G Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  607  PTKEYVQHKMLEKASDIWKIISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTE  666

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNLQM+GRYLRDVW
Sbjct  667  SLVKNLQMNGRYLRDVW  683



>gb|KHN17598.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=715

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGP++LFFGCRNR+MDYIYEDEL++FV TGAL ELI+AFSREG
Sbjct  579  FRGFLQERLALKEGGAELGPSVLFFGCRNRQMDYIYEDELSHFVNTGALDELILAFSREG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  639  PTKEYVQHKMMEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQ +GRYLRDVW
Sbjct  699  SMVKNLQTTGRYLRDVW  715



>gb|KHN22700.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=707

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK  GAELGP++LFFGCRNR+MDYIYEDELN+FV TGALSELI+AFSREG
Sbjct  571  FRGFLQERLALKGGGAELGPSVLFFGCRNRQMDYIYEDELNHFVNTGALSELILAFSREG  630

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQG+LDSSKAE
Sbjct  631  PTKEYVQHKMMEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGALDSSKAE  690

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQ +GRYLRDVW
Sbjct  691  SMVKNLQTTGRYLRDVW  707



>gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE G ELG A+LFFGCRNRK+D+IYEDELNNFVETGALSEL+ AFSREG
Sbjct  568  FRGFLQERLAQKEAGTELGTAILFFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM+QKA+DIWNL+S+GAYLYVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  628  ATKEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAE  687

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM+GRYLRDVW
Sbjct  688  LYVKNLQMAGRYLRDVW  704



>ref|XP_010548619.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=714

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELGP++LFFGCRNR+MD+IYEDEL  FVE+GALSEL++AFSREG
Sbjct  578  FRGFLQERLALKESGVELGPSILFFGCRNRRMDFIYEDELQRFVESGALSELVVAFSREG  637

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAYLYVCGDAKGMARDVHR LHTI QEQGS+D SKAE
Sbjct  638  PTKEYVQHKMIDKASDIWNMISQGAYLYVCGDAKGMARDVHRALHTIVQEQGSMDGSKAE  697

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQ SGRYLRDVW
Sbjct  698  SFVKNLQTSGRYLRDVW  714



>gb|AAK15261.1|AF302498_1 NADPH-cytochrome P450 oxydoreductase isoform 3 [Populus trichocarpa 
x Populus deltoides]
Length=712

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G+ELG ++LFFGCRNRKMD+IYEDELNNFVE+GALSEL++AFSREG
Sbjct  576  FRGFLQERLALKEAGSELGSSVLFFGCRNRKMDFIYEDELNNFVESGALSELVVAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG YLYVCGDAKGMA+DVHR LHTI QEQGSLD+SK E
Sbjct  636  PTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRALHTIVQEQGSLDNSKTE  695

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM+GRYLRDVW
Sbjct  696  SFVKSLQMNGRYLRDVW  712



>gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE G ELG A+LFFGCRNRK+D+IYEDELNNFVETGALSEL+ AFSREG
Sbjct  568  FRGFLQERLAQKEAGTELGTAILFFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM+QKA+DIWNL+S+GAYLYVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  628  ATKEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAE  687

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM+GRYLRDVW
Sbjct  688  LYVKNLQMAGRYLRDVW  704



>gb|KDP36395.1| hypothetical protein JCGZ_08664 [Jatropha curcas]
Length=711

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELG ++LFFGCRN KMDYIY+DEL+NFV +GALSEL++AFSREG
Sbjct  575  FRGFLQERLALKESGAELGSSILFFGCRNSKMDYIYQDELSNFVGSGALSELVVAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+DIWNLISQGAY+YVCGDAKGMARDVHRTLHTI QEQGSL +S+AE
Sbjct  635  PTKEYVQHKMMEKASDIWNLISQGAYIYVCGDAKGMARDVHRTLHTIAQEQGSLSNSRAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQ SGRYLRDVW
Sbjct  695  SMVKNLQTSGRYLRDVW  711



>gb|ABI98819.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   255 bits (651),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE G ELG A+LFFGCRNRK+D+IYEDELNNFVETGALSEL+ AFSREG
Sbjct  568  FRGFLQERLAQKEAGTELGTAILFFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM+QKA+DIWNL+S+GAYLYVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  628  ATKEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAE  687

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM+GRYLRDVW
Sbjct  688  LYVKNLQMAGRYLRDVW  704



>gb|KHG21257.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=711

 Score =   255 bits (652),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GA+LGP++LFFGCRNRKMDYIYEDELNNFV +GALSEL++AFSREG
Sbjct  575  FRGFLQERLALKEAGADLGPSVLFFGCRNRKMDYIYEDELNNFVNSGALSELVVAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA DIWN+IS+G YLYVCGDAKGMA+DVHRTL TI QEQG LDSSKAE
Sbjct  635  PTKEYVQHKMMEKALDIWNMISEGGYLYVCGDAKGMAKDVHRTLLTILQEQGCLDSSKAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNL  +GRYLRDVW
Sbjct  695  SMVKNLHTTGRYLRDVW  711



>ref|XP_010928663.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=706

 Score =   255 bits (651),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G +LG ++LFFGCRNRK+D+IYEDEL NFVETGALSELI+AFSREG
Sbjct  570  FRGFLQERLALKEAGTQLGRSILFFGCRNRKLDFIYEDELKNFVETGALSELIVAFSREG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+DIW++ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  630  PTKEYVQHKMAEKASDIWSVISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTE  689

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK+LQM GRYLRDVW
Sbjct  690  SMVKSLQMEGRYLRDVW  706



>ref|NP_001136741.1| uncharacterized protein LOC100216882 [Zea mays]
 gb|ACF82516.1| unknown [Zea mays]
 gb|ACR38551.1| unknown [Zea mays]
Length=247

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELG ++ FFGCRN KMD+IYE ELNNFVE GALSEL++AFSR+G
Sbjct  111  FRGFLQERLAQKESGAELGRSVFFFGCRNSKMDFIYEGELNNFVEQGALSELVLAFSRQG  170

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM+QKA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  171  LAKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  230

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM GRYLRDVW
Sbjct  231  SFVKNLQMEGRYLRDVW  247



>gb|ABC47946.1| cytochrome P450 reductase [Artemisia annua]
 gb|AEQ63685.1| cytochrome P450 reductase [synthetic construct]
Length=704

 Score =   255 bits (651),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE G ELG A+LFFGCRNRK+D+IYEDELNNFVETGALSEL+ AFSREG
Sbjct  568  FRGFLQERLAQKEAGTELGTAILFFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM+QKA+DIWNL+S+GAYLYVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  628  ATKEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAE  687

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM+GRYLRDVW
Sbjct  688  LYVKNLQMAGRYLRDVW  704



>gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana]
Length=710

 Score =   255 bits (651),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG ++ FFGCRNRK+D+IYEDELNNFVETGALSELI+AFSREG
Sbjct  574  FRGFLQERLALKESGTELGSSIFFFGCRNRKVDFIYEDELNNFVETGALSELIVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKMSQKA+DIW L+S+GAYLYVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  634  TAKEYVQHKMSQKASDIWKLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQMSGRYLRDVW
Sbjct  694  LYVKNLQMSGRYLRDVW  710



>ref|XP_008391625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Malus domestica]
Length=712

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+GAELG + LFFGCRN +MDYIYEDELNNF+ TGALSEL++AFSR+G
Sbjct  576  FRGFLQERLALKEDGAELGSSTLFFGCRNSQMDYIYEDELNNFLATGALSELVVAFSRQG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+D+WN+ISQG Y+YVCGDAKGMARDVHRTLHTI QEQG +DSSKAE
Sbjct  636  PTKEYVQHKMMQKASDVWNMISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGCMDSSKAE  695

Query  366  SMVKNLQMSGRYLRDVW  316
             +VKNLQM+GRYLRDVW
Sbjct  696  GLVKNLQMNGRYLRDVW  712



>emb|CAA81210.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus]
Length=506

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGF QERLALKE G ELG ++LFFGCRNRK+D+IYEDELNNFVETGALSELI+AFSREG
Sbjct  370  FRGFHQERLALKEAGTELGSSILFFGCRNRKVDFIYEDELNNFVETGALSELIVAFSREG  429

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+D+W L+S+GAYLYVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  430  PTKEYVQHKMNEKASDLWKLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAE  489

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQ  GRYLRDVW
Sbjct  490  LFVKNLQCRGRYLRDVW  506



>ref|XP_002444097.1| hypothetical protein SORBIDRAFT_07g007640 [Sorghum bicolor]
 gb|EES13592.1| hypothetical protein SORBIDRAFT_07g007640 [Sorghum bicolor]
Length=706

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELGP++ FFGCRN KMD+IYEDELNNF+E GALSEL++AFSR+G
Sbjct  570  FRGFLQERLAQKESGAELGPSVFFFGCRNSKMDFIYEDELNNFLEQGALSELVLAFSRQG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  630  PTKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  689

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM GRYLRDVW
Sbjct  690  SFVKNLQMEGRYLRDVW  706



>emb|CBX24555.1| NADPH:cytochrome P450 reductase [Salvia miltiorrhiza]
Length=705

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFGCRNRKMD+IYEDELN+FV+ GA+SELI+AFSREG
Sbjct  569  FRGFLQERLALKESGAELGPAILFFGCRNRKMDFIYEDELNSFVKVGAISELIVAFSREG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKMSQ+A+DIW +IS G Y+YVCGDAKGMARDVHRTLHTI QEQGSL SS+AE
Sbjct  629  PAKEYVQHKMSQRASDIWKMISDGGYMYVCGDAKGMARDVHRTLHTIAQEQGSLSSSEAE  688

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKNLQ +GRYLRDVW
Sbjct  689  GMVKNLQTTGRYLRDVW  705



>emb|CCO62220.1| putative cytochrome P450 reductase [Actaea racemosa]
Length=699

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK  G ELGPA+LFFGCRNR MDYIYEDELN FVE GAL+EL++AFSREG
Sbjct  563  FRGFLQERLALKNAGTELGPAILFFGCRNRNMDYIYEDELNGFVEAGALTELVVAFSREG  622

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P K+YVQHKM+++A+DIWN+ISQG YLYVCGDAKGMA+DVHRTLHTI QEQGSLD+SK E
Sbjct  623  PNKQYVQHKMTERASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTE  682

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKN+QM GRYLRDVW
Sbjct  683  MMVKNMQMDGRYLRDVW  699



>ref|XP_009382841.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G +LG A+LFFGCRNRKMD+IYEDEL NFVETGALSELI+AFSREG
Sbjct  558  FRGFLQERLALKEAGTQLGHAILFFGCRNRKMDFIYEDELKNFVETGALSELILAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA DIWN+I QG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  618  PTKEYVQHKMAEKALDIWNIIEQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK+LQM GRYLRDVW
Sbjct  678  SMVKSLQMDGRYLRDVW  694



>gb|AGC92176.1| cytochrome P450 oxidoreductase [Ocimum basilicum]
Length=707

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFGCRNRKMD+IY DELNNFVE G +SELI+AFSREG
Sbjct  571  FRGFLQERLALKESGAELGPAILFFGCRNRKMDFIYGDELNNFVEAGVISELIVAFSREG  630

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+Q+A+D+W +IS G Y+YVCGDAKGMARDVHRTLHTI QEQGSL SS+AE
Sbjct  631  PTKEYVQHKMTQRASDVWKIISDGGYVYVCGDAKGMARDVHRTLHTIAQEQGSLSSSEAE  690

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKNLQ +GRYLRDVW
Sbjct  691  GMVKNLQTTGRYLRDVW  707



>gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=693

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL LKE+GAELG +LLFFGCRNR+MD+IYEDELNNFVE GALSEL++AFSREG
Sbjct  557  FRGFLQERLVLKEDGAELGSSLLFFGCRNRRMDFIYEDELNNFVEQGALSELVVAFSREG  616

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAADIWNLIS+G YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  617  PQKEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAE  676

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  677  SMVKKLQMDGRYLRDVW  693



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK+EGA+LGPALLFFGCRNR+MD+IYEDELNNFVE G +SELI+AFSREG
Sbjct  553  FRGFLQERMALKQEGAQLGPALLFFGCRNRRMDFIYEDELNNFVEQGVISELIVAFSREG  612

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM QKAA IW +ISQG YLYVCGDAKGMARDVHRTLH I QEQG+LD+SK E
Sbjct  613  PQKEYVQHKMVQKAAQIWAIISQGGYLYVCGDAKGMARDVHRTLHNIVQEQGNLDASKTE  672

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  673  SMVKKLQMDGRYLRDVW  689



>gb|AFO64618.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE G ELG A+LFFGCRNRK+D+IYEDELNNFVETGALSEL+ AFSREG
Sbjct  568  FRGFLQERLAQKEAGTELGTAILFFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM+QK +DIWNL+S+GAYLYVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  628  ATKEYVQHKMTQKTSDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAE  687

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM+GRYLRDVW
Sbjct  688  LYVKNLQMAGRYLRDVW  704



>ref|XP_002324469.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|EEF03034.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   253 bits (646),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G+ELG ++LFFGCRNRKMD+IYEDELNNFVE+GALSEL++AFSREG
Sbjct  576  FRGFLQERLALKEAGSELGSSVLFFGCRNRKMDFIYEDELNNFVESGALSELVVAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG YLYVCGDAKGMA+DVHR LHTI QEQGS D+S+ E
Sbjct  636  PTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRALHTIVQEQGSFDNSRTE  695

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM+GRYLRDVW
Sbjct  696  SFVKSLQMNGRYLRDVW  712



>ref|XP_010913661.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Elaeis guineensis]
Length=706

 Score =   253 bits (646),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+G++LG A+LFFGCRNRKMD+IYEDEL NFVE GALSELI+AFSREG
Sbjct  570  FRGFLQERLALKEDGSQLGHAILFFGCRNRKMDFIYEDELKNFVERGALSELIVAFSREG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+DIWN+ISQG Y+YVCGDAKGMARDVHR LHTI QEQGSLD S+ E
Sbjct  630  PTKEYVQHKMAEKASDIWNVISQGGYIYVCGDAKGMARDVHRALHTIVQEQGSLDGSRTE  689

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK+LQM GRYLRDVW
Sbjct  690  SMVKSLQMEGRYLRDVW  706



>sp|Q05001.1|NCPR_CATRO RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Catharanthus roseus]
 emb|CAA49446.1| NADPH--ferrihemoprotein reductase [Catharanthus roseus]
Length=714

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKEEGAELG A+ FFGCRNRKMDYIYEDELN+F+E GALSEL++AFSREG
Sbjct  578  FRGFLQERLALKEEGAELGTAVFFFGCRNRKMDYIYEDELNHFLEIGALSELLVAFSREG  637

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTK+YVQHKM++KA+DIW +IS GAY+YVCGDAKGMARDVHRTLHTI QEQGS+DS++AE
Sbjct  638  PTKQYVQHKMAEKASDIWRMISDGAYVYVCGDAKGMARDVHRTLHTIAQEQGSMDSTQAE  697

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM+GRYLRDVW
Sbjct  698  GFVKNLQMTGRYLRDVW  714



>gb|ADG29353.1| cytochrome P450 reductase [Withania somnifera]
Length=713

 Score =   252 bits (644),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+EGA LGPA+LFFGCRNR+MDYIY+DELN F+E GALSEL++AFSREG
Sbjct  577  FRGFLQERLALKKEGAGLGPAVLFFGCRNRQMDYIYQDELNTFLEAGALSELVVAFSREG  636

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P K+YVQHKM+QKAADIWN+ISQG ++YVCGDAKGMARDVHRTLHTI Q+QGSLDSS AE
Sbjct  637  PNKQYVQHKMTQKAADIWNMISQGGHVYVCGDAKGMARDVHRTLHTIAQDQGSLDSSNAE  696

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNLQ +GRYLRDVW
Sbjct  697  SLVKNLQTTGRYLRDVW  713



>ref|XP_006386427.1| hypothetical protein POPTR_0002s10680g [Populus trichocarpa]
 gb|ERP64224.1| hypothetical protein POPTR_0002s10680g [Populus trichocarpa]
Length=521

 Score =   248 bits (633),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G +LGPALLFFGCRNR+MD+IYEDELNNFV  G +SEL++AFSREG
Sbjct  385  FRGFLQERMALKEDGTQLGPALLFFGCRNRQMDFIYEDELNNFVAQGVISELLVAFSREG  444

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA+IW++ISQG YLYVCGDAKGMARDVHRTLHTI QEQG LDSSK E
Sbjct  445  PQKEYVQHKMVDKAAEIWSIISQGGYLYVCGDAKGMARDVHRTLHTIVQEQGGLDSSKTE  504

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  505  SMVKKLQMEGRYLRDVW  521



>ref|XP_006381796.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|AAK15260.1|AF302497_1 NADPH-cytochrome P450 oxydoreductase isoform 2 [Populus trichocarpa 
x Populus deltoides]
 gb|ERP59593.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELG ++LFFGCRNR+MD+IYEDELNNFVE+GALSEL +AFSREG
Sbjct  576  FRGFLQERLAQKEAGAELGSSVLFFGCRNRQMDFIYEDELNNFVESGALSELSVAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG YLYVCGDAKGMA+DVHRTLHTI QEQGSLD+SK E
Sbjct  636  PTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTE  695

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK LQM+GRYLRDVW
Sbjct  696  SFVKGLQMNGRYLRDVW  712



>gb|KJB58865.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=694

 Score =   252 bits (643),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL LKE+GAELG +LLFFGCRNR+MD+IYEDELNNFVE GALS+L++AFSREG
Sbjct  558  FRGFLQERLVLKEDGAELGSSLLFFGCRNRRMDFIYEDELNNFVEQGALSDLLVAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAADIWNLIS+G YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  618  PQKEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  678  SMVKKLQMDGRYLRDVW  694



>ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELG A+LFFGCRNR+MD+IYEDELNNFVE+GALSEL +AFSREG
Sbjct  576  FRGFLQERLAQKEAGAELGSAVLFFGCRNRQMDFIYEDELNNFVESGALSELFVAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA+DIWN+ISQG YLYVCGDAKGMA+DVHRTLH I QEQGSLD+SK E
Sbjct  636  PTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHAIVQEQGSLDNSKTE  695

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK LQM+GRYLRDVW
Sbjct  696  SFVKGLQMNGRYLRDVW  712



>ref|XP_004957625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=705

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELGPA+LFFGCRNRKMD+IYEDEL+NFV+TGALSELI+AFSREG
Sbjct  569  FRGFLQERLALKEAGVELGPAILFFGCRNRKMDFIYEDELSNFVDTGALSELIVAFSREG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA  +W++ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLD+SK E
Sbjct  629  PTKEYVQHKMAQKAGVLWSIISQGGYIYVCGDAKGMARDVHRTLHTIIQEQGSLDNSKTE  688

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQ  GRYLRDVW
Sbjct  689  SYVKSLQTEGRYLRDVW  705



>gb|EYU42400.1| hypothetical protein MIMGU_mgv1a002170mg [Erythranthe guttata]
Length=705

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA+KE GAELGPA+LFFGCRN KMD+IY+DEL+NFVE G +SEL +AFSR+G
Sbjct  569  FRGFLQERLAIKESGAELGPAILFFGCRNSKMDFIYQDELSNFVEAGVISELDLAFSRDG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKAAD+WN+IS+G Y+YVCGDAKGMARDVHRTLH I QEQGSLD+SK E
Sbjct  629  PTKEYVQHKMAQKAADVWNMISEGGYVYVCGDAKGMARDVHRTLHAIVQEQGSLDNSKTE  688

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM+GRYLRDVW
Sbjct  689  SFVKNLQMNGRYLRDVW  705



>gb|KJB58863.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=693

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL LKE+GAELG +LLFFGCRNR+MD+IYEDELNNFVE GALS+L++AFSREG
Sbjct  557  FRGFLQERLVLKEDGAELGSSLLFFGCRNRRMDFIYEDELNNFVEQGALSDLLVAFSREG  616

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAADIWNLIS+G YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  617  PQKEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAE  676

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  677  SMVKKLQMDGRYLRDVW  693



>ref|NP_001063914.1| Os09g0558900 [Oryza sativa Japonica Group]
 dbj|BAD45947.1| putative NADPH-cytochrome P450 oxydoreductase isoform 3 [Oryza 
sativa Japonica Group]
 dbj|BAF25828.1| Os09g0558900 [Oryza sativa Japonica Group]
Length=714

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNRKMD+IYEDELNNFVETGALSELI+AFSREG
Sbjct  578  FRGFLQERLALKETGVELGHAVLFFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREG  637

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P+KEYVQHKM++KA +IW++ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLD+S  E
Sbjct  638  PSKEYVQHKMAEKAPEIWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTE  697

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  698  SYVKSLQMEGRYLRDVW  714



>ref|XP_010929254.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=704

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFG RNRKMD+IYEDEL+NFV TGALSELI+AFSREG
Sbjct  568  FRGFLQERLALKESGAELGPAILFFGSRNRKMDFIYEDELSNFVNTGALSELIVAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM++KA  IW++IS+G ++YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  628  PAKEYVQHKMAEKAVVIWDIISKGGHIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  687

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM GRYLRDVW
Sbjct  688  SMVKNLQMEGRYLRDVW  704



>gb|AGO03799.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=709

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE G ELG ++LFFGCRNRK+D+IYEDELNNFVETGALSELI AFSRE 
Sbjct  573  FRGFLQERLAQKEAGTELGSSILFFGCRNRKVDFIYEDELNNFVETGALSELITAFSRES  632

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKMSQKA++IWNL+S+GAYLYVCGDAKGMA+DVHRTLHTI QEQGSLDSSKAE
Sbjct  633  ATKEYVQHKMSQKASEIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAE  692

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM+GRYLRDVW
Sbjct  693  LYVKNLQMAGRYLRDVW  709



>gb|AAB97737.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=699

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGF+QERLALKE GAELG A+L+FGCRNRK+D+IYEDELN+FVETGA+SE+++AFSREG
Sbjct  563  FRGFMQERLALKESGAELGSAVLYFGCRNRKLDFIYEDELNHFVETGAISEMVVAFSREG  622

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKMSQKA++IW++IS GAY+YVCGDAKGMARDVHR LHTI QEQG+LDSS AE
Sbjct  623  PAKEYVQHKMSQKASEIWDMISHGAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSHAE  682

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNL MSGRYLRDVW
Sbjct  683  SLVKNLHMSGRYLRDVW  699



>gb|EPS66345.1| hypothetical protein M569_08425 [Genlisea aurea]
Length=683

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL LKE GAELGPA+ FFGCRN KMDYIYEDEL  FV+ GA+SELI+AFSREG
Sbjct  547  FRGFLQERLVLKESGAELGPAVFFFGCRNSKMDYIYEDELQTFVKDGAISELIVAFSREG  606

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P+KEYVQHKM++ AAD+W LIS+GAY+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  607  PSKEYVQHKMAEGAADLWKLISEGAYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTE  666

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM+GRYLRDVW
Sbjct  667  SFVKNLQMTGRYLRDVW  683



>ref|XP_010438203.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Camelina sativa]
Length=709

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+ELI+AFSREG
Sbjct  573  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELIVAFSREG  632

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  633  PTKEYVQHKMMDKASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  692

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQMSGRYLRDVW
Sbjct  693  GFVKNLQMSGRYLRDVW  709



>ref|XP_010447751.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=710

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+ELI+AFSREG
Sbjct  574  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELIVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  634  PTKEYVQHKMMDKASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQMSGRYLRDVW
Sbjct  694  GFVKNLQMSGRYLRDVW  710



>ref|XP_008781895.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Phoenix dactylifera]
Length=706

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ G +LG A+LFFGCRNRKMD+IYEDEL  FVE GALSELI+AFSREG
Sbjct  570  FRGFLQERLALKDAGTQLGHAILFFGCRNRKMDFIYEDELKIFVERGALSELIVAFSREG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+DIWN+ISQG Y+YVCGDAKGMARDVHRTLH I QEQGSLDSSK E
Sbjct  630  PTKEYVQHKMTEKASDIWNIISQGGYIYVCGDAKGMARDVHRTLHAIVQEQGSLDSSKTE  689

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK+LQM GRYLRDVW
Sbjct  690  SMVKSLQMDGRYLRDVW  706



>ref|XP_010254555.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=692

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G +LGPALLFFGCRNR+MD+IYEDELN+FVE G LSELI+AFSREG
Sbjct  556  FRGFLQERLALKENGVQLGPALLFFGCRNRRMDFIYEDELNSFVEQGVLSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P K+YVQHKM  KAADIWN+IS+  YLYVCGDAKGMARDVHRTLHTI QEQGS+DSSKAE
Sbjct  616  PNKQYVQHKMMDKAADIWNIISKNGYLYVCGDAKGMARDVHRTLHTIVQEQGSMDSSKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  676  ATVKKLQMDGRYLRDVW  692



>emb|CAC83301.1| cytochrome P450 reductase [Triticum aestivum]
Length=703

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNR+MD+IYEDELNNF E+GALSEL++AFSREG
Sbjct  567  FRGFLQERLALKETGVELGRAILFFGCRNRQMDFIYEDELNNFAESGALSELVVAFSREG  626

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KAA++W+++SQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  627  PTKEYVQHKMAEKAAELWSIVSQGGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKAE  686

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM GRYLRDVW
Sbjct  687  GYVKNLQMEGRYLRDVW  703



>ref|XP_002307336.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
 gb|AAK15259.1|AF302496_1 NADPH-cytochrome P450 oxydoreductase isoform 1 [Populus trichocarpa 
x Populus deltoides]
 gb|EEE94332.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
Length=692

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G +LGPALLFFGCRNR+MD+IYEDELNNFVE G +SELI+AFSREG
Sbjct  556  FRGFLQERIALKEDGVKLGPALLFFGCRNRRMDFIYEDELNNFVEQGVISELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  +AA+IW +ISQG Y YVCGDAKGMARDVHRTLHTI QEQG LDSSK E
Sbjct  616  PQKEYVQHKMVDRAAEIWTIISQGGYFYVCGDAKGMARDVHRTLHTIVQEQGGLDSSKTE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  676  SMVKKLQMEGRYLRDVW  692



>gb|KHG05124.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=693

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL LKE+GAELG +LLFFGCRNR+MD+IYEDELNNFVE GALS L++AFSREG
Sbjct  557  FRGFLQERLVLKEDGAELGSSLLFFGCRNRRMDFIYEDELNNFVEQGALSVLVLAFSREG  616

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAADIWNLIS+G YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  617  PQKEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAE  676

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  677  SMVKKLQMDGRYLRDVW  693



>emb|CAA81209.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus]
Length=588

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG ++LFFGCRNRK+D+IYE+ELNNFVE GALSEL +AFSREG
Sbjct  452  FRGFLQERLALKESGTELGQSILFFGCRNRKVDFIYENELNNFVENGALSELDMAFSREG  511

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             +KEYVQHKMSQKA+DIWN++S+GAYLYVCGDAKGMA+DVHRTLHTI QEQG+LDSSKAE
Sbjct  512  ASKEYVQHKMSQKASDIWNMLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGNLDSSKAE  571

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQMSGRYLRDVW
Sbjct  572  LYVKNLQMSGRYLRDVW  588



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKEEGA+LGPA+LFFGCRNR+MD+IYEDELNNFVE GALSELI+AFSREG
Sbjct  553  FRGFLQERLALKEEGAQLGPAVLFFGCRNRQMDFIYEDELNNFVEQGALSELIVAFSREG  612

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P+KEYVQHKM +KAA +WNLISQG Y YVCGDAKGMARDVHRTLHTI Q++  +DS+KAE
Sbjct  613  PSKEYVQHKMMEKAAYMWNLISQGGYFYVCGDAKGMARDVHRTLHTIVQQEDKVDSTKAE  672

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  673  AIVKKLQMDGRYLRDVW  689



>gb|AHB33950.1| cytochrome P450 reductase [Santalum album]
Length=704

 Score =   249 bits (637),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELGPA+LFFGCRNRKMDYIYEDEL +FVE GALSELI+AFSREG
Sbjct  568  FRGFLQERLALKEAGVELGPAILFFGCRNRKMDYIYEDELAHFVEAGALSELIVAFSREG  627

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P K+YVQHKM +KA++IWN+IS G Y+YVCGDAKGMA+DVHR LHTI  EQGSLD+SK E
Sbjct  628  PAKQYVQHKMMEKASEIWNMISDGGYVYVCGDAKGMAKDVHRALHTIVHEQGSLDNSKTE  687

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQM+GRYLRDVW
Sbjct  688  SMVKNLQMNGRYLRDVW  704



>ref|XP_008789667.1| PREDICTED: NADPH--cytochrome P450 reductase [Phoenix dactylifera]
Length=706

 Score =   249 bits (637),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GA+LG ++LFFGCRNRK+D+IYEDEL  FVETG LSELI+AFSREG
Sbjct  570  FRGFLQERLALKEAGAQLGRSILFFGCRNRKLDFIYEDELKFFVETGGLSELIVAFSREG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM++KA+DIWN+ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  630  TTKEYVQHKMAEKASDIWNIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTE  689

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK+LQM GRYLRDVW
Sbjct  690  SMVKSLQMEGRYLRDVW  706



>gb|EAZ10065.1| hypothetical protein OsI_32371 [Oryza sativa Indica Group]
Length=717

 Score =   249 bits (637),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNRKMD+IYEDELNNFVETGALSELI+AFSREG
Sbjct  581  FRGFLQERLALKETGVELGHAVLFFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREG  640

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P+KEYVQHKM++KA +IW++IS G Y+YVCGDAKGMARDVHRTLHTI QEQGSLD+S  E
Sbjct  641  PSKEYVQHKMAEKAPEIWSIISPGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTE  700

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  701  SYVKSLQMEGRYLRDVW  717



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKEEGA+LGPALLFFGCRNR+MD+IYEDELNNFVE GA+SELI+AFSREG
Sbjct  551  FRGFLQERMALKEEGAQLGPALLFFGCRNRRMDFIYEDELNNFVEQGAMSELIVAFSREG  610

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KA+ IW+LISQG Y YVCGDAKGMARDVHRTLHTI Q+Q ++DSSKAE
Sbjct  611  PEKEYVQHKMMDKASCIWSLISQGGYFYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAE  670

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK LQM GRYLRDVW
Sbjct  671  SIVKKLQMDGRYLRDVW  687



>gb|EYU20907.1| hypothetical protein MIMGU_mgv1a002097mg [Erythranthe guttata]
Length=715

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ GAELGPA+LFFGCRN +MD+IY+DELN FVE G +SEL++AFSREG
Sbjct  579  FRGFLQERLALKDSGAELGPAVLFFGCRNSQMDFIYQDELNKFVEAGVISELVLAFSREG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA+D+WN+IS G Y YVCGDAKGMARDVHRTLHTI QEQGSL SS+AE
Sbjct  639  PTKEYVQHKMAQKASDVWNMISDGGYAYVCGDAKGMARDVHRTLHTIVQEQGSLSSSEAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKNLQ +GRYLRDVW
Sbjct  699  GMVKNLQTTGRYLRDVW  715



>gb|EMS66177.1| NADPH--cytochrome P450 reductase [Triticum urartu]
Length=676

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNR+MD+IYEDELNNF E+GALSEL++AFSREG
Sbjct  510  FRGFLQERLALKESGVELGCAILFFGCRNRQMDFIYEDELNNFAESGALSELVVAFSREG  569

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KAA++W+++SQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  570  PTKEYVQHKMAEKAAELWSIVSQGGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTE  629

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQ  GRYLRDVW
Sbjct  630  SYVKNLQTEGRYLRDVW  646



>ref|XP_010433014.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=709

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+ELI+AFSREG
Sbjct  573  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELIVAFSREG  632

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+IS+GAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  633  PTKEYVQHKMMDKASDIWNMISRGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  692

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQMSGRYLRDVW
Sbjct  693  GFVKNLQMSGRYLRDVW  709



>gb|EMT14573.1| NADPH--cytochrome P450 reductase [Aegilops tauschii]
Length=696

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNR+MD+IYEDELNNF E+GALSEL++AFSREG
Sbjct  560  FRGFLQERLALKETGVELGRAILFFGCRNRQMDFIYEDELNNFAESGALSELVVAFSREG  619

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KAA++W+++SQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  620  PTKEYVQHKMAEKAAELWSIVSQGGYVYVCGDAKGMARDVHRMLHTIVQEQGSLDSSKTE  679

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM GRYLRDVW
Sbjct  680  GYVKNLQMEGRYLRDVW  696



>gb|AHM95445.1| cytochrome P450 reductase [Matricaria chamomilla var. recutita]
Length=701

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE G ELG ++LFFGCRNRK+D+IY DELNNFVETGALSELI AFSRE 
Sbjct  565  FRGFLQERLAQKEAGTELGTSILFFGCRNRKVDFIYADELNNFVETGALSELITAFSRES  624

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM+QKA++IWNL+S+GAYLYVCGDAKGMARDVHRTLHTI QEQGSLDSSKAE
Sbjct  625  ATKEYVQHKMNQKASEIWNLLSEGAYLYVCGDAKGMARDVHRTLHTIAQEQGSLDSSKAE  684

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM+GRYLRDVW
Sbjct  685  LFVKNLQMAGRYLRDVW  701



>gb|AFW59699.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=509

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ GAELG ++LFFGCRNR MDYIYEDEL  F+E GALSELI+AFSREG
Sbjct  373  FRGFLQERLALKQSGAELGTSILFFGCRNRNMDYIYEDELQTFLEEGALSELIVAFSREG  432

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA +IWN+IS G YLYVCGDAKGMARDVHR LHT+ QEQGSLDSSK E
Sbjct  433  PTKEYVQHKMVEKATEIWNIISHGGYLYVCGDAKGMARDVHRMLHTVVQEQGSLDSSKTE  492

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  493  SYVKSLQMEGRYLRDVW  509



>ref|XP_010277516.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Nelumbo 
nucifera]
Length=651

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+GA+LGPALLFFGCRNRKMD+IYEDELN+FVE G LSELI+AFSREG
Sbjct  515  FRGFLQERLALKEDGAQLGPALLFFGCRNRKMDFIYEDELNSFVEQGVLSELIVAFSREG  574

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KA ++WNLIS+  YLYVCGDAKGMARDVHRTLH+I QEQ S DSSKAE
Sbjct  575  PNKEYVQHKMMDKATEVWNLISRNGYLYVCGDAKGMARDVHRTLHSIVQEQESTDSSKAE  634

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  635  AIVKKLQMEGRYLRDVW  651



>emb|CDY51656.1| BnaAnng10960D [Brassica napus]
Length=706

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  570  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+IS+GAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  630  PTKEYVQHKMMDKASDIWNMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  689

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  690  SFVKNLQMSGRYLRDVW  706



>ref|XP_002462826.1| hypothetical protein SORBIDRAFT_02g032640 [Sorghum bicolor]
 gb|EER99347.1| hypothetical protein SORBIDRAFT_02g032640 [Sorghum bicolor]
Length=706

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL LKE G ELG A+LFFGCRNRKMD+IYEDELNNFV+ G LSELIIAFSREG
Sbjct  570  FRGFLQERLGLKEAGVELGHAILFFGCRNRKMDFIYEDELNNFVDGGVLSELIIAFSREG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKAA++W++ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGS+D+SK E
Sbjct  630  PTKEYVQHKMAQKAAELWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSMDNSKTE  689

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  690  SYVKSLQMEGRYLRDVW  706



>ref|XP_007154761.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
 gb|ESW26755.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
Length=707

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGP++LFFGCRN +MDYIYEDELN+F+ +GALSELI+AFSREG
Sbjct  571  FRGFLQERLALKEGGAELGPSVLFFGCRNSQMDYIYEDELNHFINSGALSELIVAFSREG  630

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTK+YVQH+M +KA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGS+DS+KAE
Sbjct  631  PTKKYVQHEMLEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGSMDSTKAE  690

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK+LQ +GRYLRDVW
Sbjct  691  SMVKSLQTNGRYLRDVW  707



>gb|AAB97736.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=681

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALK+ GAELG A+L+FGCRNR +D+IYEDELN FVE+G++SELI+AFSREG
Sbjct  545  FRGFLQERQALKDAGAELGTAVLYFGCRNRNLDFIYEDELNKFVESGSISELIVAFSREG  604

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA++IWNLIS+GAY+YVCGDAKGMARDVHR LHTI QEQG+LDSSKAE
Sbjct  605  PTKEYVQHKMLQKASEIWNLISEGAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAE  664

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM+GRYLRDVW
Sbjct  665  SWVKNLQMTGRYLRDVW  681



>emb|CDX72222.1| BnaC07g42440D [Brassica napus]
Length=708

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  572  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+IS+GAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  632  PTKEYVQHKMMDKASDIWNMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  691

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  692  SFVKNLQMSGRYLRDVW  708



>gb|KJB14707.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=693

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ L E+GAELGP+LLFFGCRNRKMD+IYEDELNN VE GALSELI+A SREG
Sbjct  557  FRGFLQERVVLNEDGAELGPSLLFFGCRNRKMDFIYEDELNNLVEQGALSELIVALSREG  616

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA IW+LIS+G YLYVCGDAKGMARDVHRTLHTI QEQG+++SSKAE
Sbjct  617  PQKEYVQHKMMDKAAHIWSLISKGGYLYVCGDAKGMARDVHRTLHTIVQEQGNMESSKAE  676

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  677  SMVKKLQMEGRYLRDVW  693



>gb|AAC05022.1| NADPH:ferrihemoprotein oxidoreductase [Eschscholzia californica]
Length=705

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGF+QERLALK  G ELGPA+LFFGCRNR+MDYIYE+ELNNFV+ GA+SE+++AFSREG
Sbjct  569  FRGFMQERLALKNSGVELGPAILFFGCRNRQMDYIYEEELNNFVKEGAISEVVVAFSREG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM++KA+ IW +ISQGAYLYVCGDAKGMARDVHRTLHTI QEQGSLD+SK E
Sbjct  629  ATKEYVQHKMAEKASYIWEMISQGAYLYVCGDAKGMARDVHRTLHTIAQEQGSLDNSKTE  688

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VKNLQM GRYLRDVW
Sbjct  689  SLVKNLQMDGRYLRDVW  705



>emb|CDY28169.1| BnaA01g06800D [Brassica napus]
Length=696

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  560  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREG  619

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIW++ISQGAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  620  PTKEYVQHKMMDKASDIWSMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  679

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  680  SFVKNLQMSGRYLRDVW  696



>ref|XP_009130253.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Brassica 
rapa]
Length=681

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  545  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREG  604

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIW++ISQGAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  605  PTKEYVQHKMMDKASDIWSMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  664

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRY+RDVW
Sbjct  665  SFVKNLQMSGRYIRDVW  681



>emb|CAQ37789.1| NADPH:cytochrome P450 reductase [Solenostemon scutellarioides]
Length=711

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPA+LFFGCRN KMD+IY+DEL+NFV+ G +SEL++AFSREG
Sbjct  575  FRGFLQERLALKESGAELGPAVLFFGCRNSKMDFIYQDELDNFVQAGVVSELVLAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM+QKA D+WN+IS+G Y+YVCGDAKGMARDVHRTLHTI QEQGSLDSSK E
Sbjct  635  PAKEYVQHKMAQKAWDVWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM+G  LRDVW
Sbjct  695  SFVKNLQMTGAVLRDVW  711



>ref|XP_006661531.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=642

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNRKMD+IYEDELNNFV+ GALS+L IAFSREG
Sbjct  506  FRGFLQERLALKETGVELGHAILFFGCRNRKMDFIYEDELNNFVDAGALSKLSIAFSREG  565

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA +IW++ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLD+S  E
Sbjct  566  PTKEYVQHKMTEKAPEIWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTE  625

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  626  SYVKSLQMEGRYLRDVW  642



>gb|EPS73891.1| hypothetical protein M569_00858 [Genlisea aurea]
Length=706

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ GAELGPA+LFFGCRN KMDYIYEDEL   V+ GA SEL++AFSREG
Sbjct  570  FRGFLQERLALKQSGAELGPAILFFGCRNSKMDYIYEDELQQLVKEGAASELVVAFSREG  629

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM ++AAD+W LIS G Y+YVCGDAKGMARDVHRTLHTI QEQGS+D+SK E
Sbjct  630  PTKEYVQHKMGERAADLWKLISDGGYVYVCGDAKGMARDVHRTLHTIVQEQGSMDNSKTE  689

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM+GRYLRDVW
Sbjct  690  SFVKNLQMTGRYLRDVW  706



>ref|XP_010277515.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Nelumbo 
nucifera]
Length=691

 Score =   247 bits (630),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+GA+LGPALLFFGCRNRKMD+IYEDELN+FVE G LSELI+AFSREG
Sbjct  555  FRGFLQERLALKEDGAQLGPALLFFGCRNRKMDFIYEDELNSFVEQGVLSELIVAFSREG  614

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KA ++WNLIS+  YLYVCGDAKGMARDVHRTLH+I QEQ S DSSKAE
Sbjct  615  PNKEYVQHKMMDKATEVWNLISRNGYLYVCGDAKGMARDVHRTLHSIVQEQESTDSSKAE  674

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  675  AIVKKLQMEGRYLRDVW  691



>gb|AAS90127.1| NADPH cytochrome P450 reductase [Ammi majus]
Length=681

 Score =   246 bits (629),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALK+ GAELG A+L+FGCRNR +D+IYEDELN FVE+G++SELI+AFSREG
Sbjct  545  FRGFLQERQALKDAGAELGTAVLYFGCRNRNLDFIYEDELNKFVESGSISELIVAFSREG  604

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA++IWNL+S+GAY+YVCGDAKGMARDVHR LHTI QEQG+LDSSKAE
Sbjct  605  PTKEYVQHKMLQKASEIWNLMSEGAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAE  664

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM+GRYLRDVW
Sbjct  665  SWVKNLQMTGRYLRDVW  681



>ref|XP_006283224.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
 gb|EOA16122.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
Length=710

 Score =   247 bits (630),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+EL +AFSREG
Sbjct  574  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  +A+DIWN+ISQGAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  634  PTKEYVQHKMMDRASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQMSGRYLRDVW
Sbjct  694  GFVKNLQMSGRYLRDVW  710



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+GA+LGPALLFFGCRNR+MD+IYEDELN FVE G +SELI+AFSREG
Sbjct  556  FRGFLQERMALKEDGAQLGPALLFFGCRNRRMDFIYEDELNYFVEQGVISELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA IW+LIS+  Y+YVCGDAKGMARDVHRTLHTI QEQG+LDSSK E
Sbjct  616  PQKEYVQHKMMDKAAQIWSLISERGYIYVCGDAKGMARDVHRTLHTIVQEQGNLDSSKTE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  676  SMVKKLQMDGRYLRDVW  692



>gb|AIO11759.1| cytochrome p450 reductase [Croton stellatopilosus]
 emb|CDM63949.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=711

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA  E GAELG ++LFFGCRN KMDYIYEDELN+F+++GALSEL++AFSREG
Sbjct  575  FRGFLQERLAQLESGAELGTSVLFFGCRNSKMDYIYEDELNHFIKSGALSELVVAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM QKA++IW LIS+GAY+YVCGDAKGMARDVH+ LHTI QEQGSL SS+AE
Sbjct  635  PTKEYVQHKMMQKASEIWKLISEGAYVYVCGDAKGMARDVHKALHTIAQEQGSLSSSQAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVKNLQMSGRYLRDVW
Sbjct  695  SMVKNLQMSGRYLRDVW  711



>ref|NP_849472.2| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 gb|AEE85737.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=712

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+EL +AFSREG
Sbjct  576  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAYLYVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  636  PTKEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  695

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQ SGRYLRDVW
Sbjct  696  GFVKNLQTSGRYLRDVW  712



>ref|NP_194750.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 sp|Q9SUM3.1|NCPR2_ARATH RecName: Full=NADPH--cytochrome P450 reductase 2 [Arabidopsis 
thaliana]
 gb|AAK17169.1|AF325101_1 NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB52465.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB81014.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 gb|AEE85738.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=711

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+EL +AFSREG
Sbjct  575  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAYLYVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  635  PTKEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQ SGRYLRDVW
Sbjct  695  GFVKNLQTSGRYLRDVW  711



>emb|CAA46815.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=712

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+EL +AFSREG
Sbjct  576  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAYLYVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  636  PTKEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  695

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQ SGRYLRDVW
Sbjct  696  GFVKNLQTSGRYLRDVW  712



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK+EGA+LGPALLFFGCRNR+MD+IYEDELNNFV+ G LSELI+AFSREG
Sbjct  556  FRGFLQERMALKKEGAQLGPALLFFGCRNRRMDFIYEDELNNFVDEGVLSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  +AA +W+LISQG Y YVCGDAKGMARDVHRTLHTI QEQ  +DS+KAE
Sbjct  616  PTKEYVQHKMMDRAAHMWDLISQGGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  676  AIVKQLQMDGRYLRDVW  692



>ref|XP_006653834.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Oryza 
brachyantha]
Length=628

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ G ELG ++LFFGCRNR MDYIYEDEL NF++ GALSELI+AFSREG
Sbjct  492  FRGFLQERLALKQSGVELGSSILFFGCRNRNMDYIYEDELENFLQEGALSELIVAFSREG  551

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA +IWN++SQG YLYVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  552  PTKEYVQHKMVDKATEIWNILSQGGYLYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTE  611

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  612  SYVKSLQMDGRYLRDVW  628



>dbj|BAJ41269.1| NADPH-P450 reductase 2 [Zingiber officinale]
Length=701

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK  G ELG ++L+FGCRNRKMD+IYEDELNNFVETGALSELI+AFSREG
Sbjct  565  FRGFLQERLALKNNGVELGHSILYFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREG  624

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTK+YVQHKM++KA ++WN+ISQG Y+YVCGDAKGMARDVHR LHTI QEQG +DSSK E
Sbjct  625  PTKQYVQHKMTEKATELWNIISQGGYVYVCGDAKGMARDVHRVLHTIAQEQGGMDSSKTE  684

Query  366  SMVKNLQMSGRYLRDVW  316
            S +K+LQM GRYLRDVW
Sbjct  685  SFIKSLQMEGRYLRDVW  701



>ref|XP_010259920.1| PREDICTED: NADPH--cytochrome P450 reductase [Nelumbo nucifera]
Length=705

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL E GAELG A+LFFGCRNRKMDYIYEDELN +V +G LSE ++AFSREG
Sbjct  569  FRGFLQERAALMEAGAELGTAILFFGCRNRKMDYIYEDELNGYVNSGVLSEFVVAFSREG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA+++WN+IS+G Y+YVCGDAKGMARDVHRTLH I QEQGSLDSS+AE
Sbjct  629  PTKEYVQHKMMEKASNVWNIISKGGYIYVCGDAKGMARDVHRTLHAIVQEQGSLDSSQAE  688

Query  366  SMVKNLQMSGRYLRDVW  316
            SM+KNLQM GRYLRDVW
Sbjct  689  SMIKNLQMEGRYLRDVW  705



>gb|EEE61817.1| hypothetical protein OsJ_16444 [Oryza sativa Japonica Group]
Length=646

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ G ELG ++LFFGCRNR MDYIYEDEL NF++ GALSELI+AFSREG
Sbjct  510  FRGFLQERLALKQSGVELGNSVLFFGCRNRNMDYIYEDELQNFIQEGALSELIVAFSREG  569

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM++KA +IWN++SQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  570  PAKEYVQHKMTEKATEIWNIVSQGGYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTE  629

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  630  SYVKSLQMDGRYLRDVW  646



>emb|CDX68634.1| BnaC01g08190D [Brassica napus]
Length=712

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL+L E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  576  FRGFLQERLSLVESGVELGPSVLFFGCRNRRMDFIYEEELQGFLESGALSELSVAFSREG  635

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA++IWN+IS+GAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  636  PTKEYVQHKMMDKASEIWNMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  695

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  696  SFVKNLQMSGRYLRDVW  712



>ref|XP_009414761.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE G ELG A+ FFGCRNRKMD+IYEDEL+NFV+ G LSELI+AFSREG
Sbjct  564  FRGFLQEREALKESGVELGHAIFFFGCRNRKMDFIYEDELHNFVDRGVLSELIVAFSREG  623

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+ +WN+ISQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  624  PTKEYVQHKMTEKASSVWNIISQGGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTE  683

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK+LQM GRYLRDVW
Sbjct  684  SLVKSLQMEGRYLRDVW  700



>emb|CDY14183.1| BnaA08g13140D [Brassica napus]
Length=696

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  560  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREG  619

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA DIW++ISQG Y+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  620  PTKEYVQHKMMDKACDIWSMISQGGYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  679

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  680  SFVKNLQMSGRYLRDVW  696



>ref|XP_009108997.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Brassica rapa]
Length=707

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  571  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREG  630

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA DIW++ISQG Y+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  631  PTKEYVQHKMMDKACDIWSMISQGGYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  690

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  691  SFVKNLQMSGRYLRDVW  707



>ref|XP_009384791.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G +LG A LFFGCRNRKMD+IYEDEL NFV TGALSELI+AFSREG
Sbjct  558  FRGFLQERLALMEAGMQLGHATLFFGCRNRKMDFIYEDELKNFVGTGALSELILAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM++KA+DIWN+ISQG Y+YVCGD+KGMA+DVHR LHTI Q QGSLDSSK E
Sbjct  618  PTKEYVQHKMAEKASDIWNIISQGGYIYVCGDSKGMAKDVHRALHTIIQGQGSLDSSKTE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  678  SMVKGLQMDGRYLRDVW  694



>emb|CAE01547.2| OSJNBb0022F16.2 [Oryza sativa Japonica Group]
 emb|CAE03554.2| OSJNBa0060D06.20 [Oryza sativa Japonica Group]
Length=695

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ G ELG ++LFFGCRNR MDYIYEDEL NF++ GALSELI+AFSREG
Sbjct  559  FRGFLQERLALKQSGVELGNSVLFFGCRNRNMDYIYEDELQNFIQEGALSELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM++KA +IWN++SQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  619  PAKEYVQHKMTEKATEIWNIVSQGGYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  679  SYVKSLQMDGRYLRDVW  695



>gb|AHB33949.1| cytochrome P450 reductase [Santalum album]
Length=692

 Score =   244 bits (624),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+AL E  A+LGPALLFFGCRNR+MD+IYEDELNNFVE G +SELI+AFSR+G
Sbjct  556  FRGFLQERMALLEGSAQLGPALLFFGCRNRRMDFIYEDELNNFVEQGVISELIVAFSRDG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KAA IW+LISQGAYLYVCGDAKGMARDVHRTLHT+ Q+Q S+DSSKAE
Sbjct  616  PTKEYVQHKMMDKAAYIWSLISQGAYLYVCGDAKGMARDVHRTLHTLVQQQESVDSSKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK LQM GRYLRDVW
Sbjct  676  SIVKKLQMDGRYLRDVW  692



>gb|EEE70211.1| hypothetical protein OsJ_30318 [Oryza sativa Japonica Group]
Length=795

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNRKMD+IYEDELNNFVETGALSELI+AFSREG
Sbjct  603  FRGFLQERLALKETGVELGHAVLFFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREG  662

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P+KEYVQHKM++KA +IW++ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGSLD+S  E
Sbjct  663  PSKEYVQHKMAEKAPEIWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTE  722

Query  366  SMVKNLQMSGRYLRD  322
            S VK+LQM GRYLRD
Sbjct  723  SYVKSLQMEGRYLRD  737



>ref|NP_001159331.1| uncharacterized protein LOC100304425 [Zea mays]
 gb|ACN25819.1| unknown [Zea mays]
 gb|ACN28051.1| unknown [Zea mays]
 gb|AFW59698.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=694

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ GAELG ++LFFGCRNR MDYIYEDEL  F+E GALSELI+AFSREG
Sbjct  558  FRGFLQERLALKQSGAELGTSILFFGCRNRNMDYIYEDELQTFLEEGALSELIVAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA +IWN+IS G YLYVCGDAKGMARDVHR LHT+ QEQGSLDSSK E
Sbjct  618  PTKEYVQHKMVEKATEIWNIISHGGYLYVCGDAKGMARDVHRMLHTVVQEQGSLDSSKTE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  678  SYVKSLQMEGRYLRDVW  694



>ref|XP_002869386.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45645.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
Length=711

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+EL +AFSREG
Sbjct  575  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIWN+ISQGAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  635  PTKEYVQHKMMDKASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQ +GRYLRDVW
Sbjct  695  GFVKNLQTTGRYLRDVW  711



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK+EGA+LGPALLFFGCRNR+MD+IYEDELN+FV+ G LSELI+AFSREG
Sbjct  556  FRGFLQERMALKKEGAQLGPALLFFGCRNRRMDFIYEDELNDFVDEGVLSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  +AA +W+LISQG Y YVCGDAKGMARDVHRTLHTI QEQ  +DS+KAE
Sbjct  616  PTKEYVQHKMMDRAAHMWDLISQGGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  676  AIVKQLQMDGRYLRDVW  692



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score =   244 bits (622),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK+EGA+LGPALLFFGCRNR+MD+IYEDELNNFVE G LSELI+AFSREG
Sbjct  556  FRGFLQERMALKKEGAQLGPALLFFGCRNRRMDFIYEDELNNFVEEGVLSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHK+  KAA +W+L+SQG Y YVCGDAKGMARDVHRTLHTI Q+Q  +DS+KAE
Sbjct  616  PTKEYVQHKLMDKAAYVWDLVSQGGYFYVCGDAKGMARDVHRTLHTIVQQQEKVDSTKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  676  ATVKRLQMDGRYLRDVW  692



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score =   244 bits (622),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+  +LGPALLFFGCRNR+MD+IYEDEL NF+E GALSELI+ FSREG
Sbjct  553  FRGFLQERLALKEDAVQLGPALLFFGCRNRQMDFIYEDELKNFMEQGALSELIVTFSREG  612

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA++WNLISQG YLYVCGDAKGMARDVHRTLHTI Q+Q ++DSSKAE
Sbjct  613  PEKEYVQHKMMDKAANLWNLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAE  672

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  673  AIVKKLQMDGRYLRDVW  689



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+  +LGPALLFFGCRNR+MD+IYEDEL NF+E GALSELI+ FSREG
Sbjct  553  FRGFLQERLALKEDAVQLGPALLFFGCRNRQMDFIYEDELKNFMEQGALSELIVTFSREG  612

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA++WNLISQG YLYVCGDAKGMARDVHRTLHTI Q+Q ++DSSKAE
Sbjct  613  PEKEYVQHKMMDKAANLWNLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAE  672

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  673  AIVKKLQMDGRYLRDVW  689



>ref|XP_011015338.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
 ref|XP_011015339.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=692

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G +LGPALLFFGCRNR+MD+IYEDELNNFVE   +SELI+AFSREG
Sbjct  556  FRGFLQERIALKEDGVQLGPALLFFGCRNRRMDFIYEDELNNFVEQVVISELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  +AA+IW +ISQG Y YVCGDAKGMARDVHRTLH I QEQG LD+SK E
Sbjct  616  PRKEYVQHKMVDRAAEIWTIISQGGYFYVCGDAKGMARDVHRTLHAIVQEQGGLDASKTE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  676  SMVKKLQMEGRYLRDVW  692



>ref|XP_008667834.1| PREDICTED: uncharacterized protein LOC100279923 isoform X2 [Zea 
mays]
 tpg|DAA35632.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=694

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ GAELG ++LFFGCRNR MDYIYEDEL  F+E GALSELI+AFSREG
Sbjct  558  FRGFLQERLALKQSGAELGTSILFFGCRNRNMDYIYEDELQTFLEEGALSELIVAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA DIWN+IS G YLYVCGDAKGMARDVH+ LHTI QEQGSLD+SK E
Sbjct  618  PTKEYVQHKMVEKATDIWNIISNGGYLYVCGDAKGMARDVHKMLHTIVQEQGSLDNSKTE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  678  SYVKSLQMEGRYLRDVW  694



>ref|XP_008667833.1| PREDICTED: uncharacterized protein LOC100279923 isoform X1 [Zea 
mays]
 tpg|DAA35631.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=695

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ GAELG ++LFFGCRNR MDYIYEDEL  F+E GALSELI+AFSREG
Sbjct  559  FRGFLQERLALKQSGAELGTSILFFGCRNRNMDYIYEDELQTFLEEGALSELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA DIWN+IS G YLYVCGDAKGMARDVH+ LHTI QEQGSLD+SK E
Sbjct  619  PTKEYVQHKMVEKATDIWNIISNGGYLYVCGDAKGMARDVHKMLHTIVQEQGSLDNSKTE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  679  SYVKSLQMEGRYLRDVW  695



>ref|XP_008653023.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Zea mays]
 tpg|DAA62574.1| TPA: hypothetical protein ZEAMMB73_030302 [Zea mays]
Length=709

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+   ELG A+LFFGCRNRKMD+IYEDELNNFV+ GALSELI+AFSREG
Sbjct  572  FRGFLQERLALKQAEVELGHAVLFFGCRNRKMDFIYEDELNNFVDAGALSELIVAFSREG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLD-SSKA  370
            PTKEYVQHKM+QKAA++W++ISQG Y+YVCGDAKGMARDVHRTLHTI QEQGS+D +SKA
Sbjct  632  PTKEYVQHKMAQKAAELWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSMDNNSKA  691

Query  369  ESMVKNLQMSGRYLRDVW  316
            ES VK+LQM GRYLRDVW
Sbjct  692  ESYVKSLQMEGRYLRDVW  709



>dbj|BAD05443.1| putative cytochrome P450 reductase [Oryza sativa Japonica Group]
 dbj|BAD05639.1| putative cytochrome P450 reductase [Oryza sativa Japonica Group]
Length=568

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL+ K+ GAELG ++ FFGCRN KMD+IYEDELN F+E GALSEL++AFSREG
Sbjct  432  FRGFLQERLSQKQSGAELGRSVFFFGCRNSKMDFIYEDELNTFLEEGALSELVLAFSREG  491

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKMSQKA++IW++ISQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  492  PTKEYVQHKMSQKASEIWDMISQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  551

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQ  GRYLRDVW
Sbjct  552  SFVKSLQTEGRYLRDVW  568



>ref|XP_002447240.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
 gb|EES11568.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
Length=694

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ G ELG ++LFFGCRNR MDYIYEDEL  F+E GALSELIIAFSREG
Sbjct  558  FRGFLQERLALKQSGTELGTSILFFGCRNRNMDYIYEDELQTFLEEGALSELIIAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA +IWN+IS G YLYVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  618  PTKEYVQHKMVEKATEIWNIISHGGYLYVCGDAKGMARDVHRMLHTIVQEQGSLDSSKTE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  678  SYVKSLQMEGRYLRDVW  694



>emb|CDY03543.1| BnaC03g68020D [Brassica napus]
Length=710

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  574  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA DIW++ISQG Y+YVCGDAKGMARDVHR LHTI QEQGS+DS+KAE
Sbjct  634  PTKEYVQHKMMDKACDIWSMISQGGYVYVCGDAKGMARDVHRYLHTIAQEQGSMDSTKAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  694  SFVKNLQMSGRYLRDVW  710



>dbj|BAJ33878.1| unnamed protein product [Thellungiella halophila]
Length=711

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  575  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSLAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIW++IS+GAY+YVCGDAKGMARDVHR+LHTI QEQG +DS+KAE
Sbjct  635  PTKEYVQHKMMDKASDIWSMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGPMDSTKAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  695  SFVKNLQMSGRYLRDVW  711



>ref|XP_006412733.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
 gb|ESQ54186.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
Length=711

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLAL E G ELGP++LFFGCRNR+MD+IYE+EL  F+E+GALSEL +AFSREG
Sbjct  575  FRGFLQERLALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFLESGALSELSLAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+DIW++IS+GAY+YVCGDAKGMARDVHR+LHTI QEQG +DS+KAE
Sbjct  635  PTKEYVQHKMMDKASDIWSMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGPMDSTKAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  695  SFVKNLQMSGRYLRDVW  711



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK+EGA+LGPALLFFGCRNR+MD+IYEDELN+FV+ G LSELI+AFSREG
Sbjct  592  FRGFLQERMALKKEGAQLGPALLFFGCRNRRMDFIYEDELNDFVDEGVLSELIVAFSREG  651

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  +AA +W+LISQG Y YVCGDAKGMARDVHRTLHTI QEQ  +DS+KAE
Sbjct  652  PTKEYVQHKMMDRAAHMWDLISQGGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAE  711

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  712  AIVKQLQMDGRYLRDVW  728



>ref|XP_006845640.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
 gb|ERN07315.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
Length=711

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELGPA+LFFGCRN +MD+IYEDELNNFVE G LSELIIAFSREG
Sbjct  572  FRGFLQERLALKEAGVELGPAILFFGCRNHRMDFIYEDELNNFVEQGVLSELIIAFSREG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+ +W +IS+G YLYVCGDAKGMARDVHRTLHTI QEQGS++SS AE
Sbjct  632  PTKEYVQHKMIDKASSLWEIISRGGYLYVCGDAKGMARDVHRTLHTIVQEQGSMESSPAE  691

Query  366  SMVKNLQMSGRYLRDV  319
            +MVKNLQ  GRYLRDV
Sbjct  692  AMVKNLQTEGRYLRDV  707



>ref|XP_008661364.1| PREDICTED: uncharacterized protein LOC100192720 isoform X1 [Zea 
mays]
 gb|AFW57103.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=699

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELG ++ FFGCRN  MD+IYEDEL+NF+E GAL EL++AFSR+G
Sbjct  563  FRGFLQERLARKESGAELGRSVFFFGCRNSNMDFIYEDELSNFLEQGALFELVLAFSRQG  622

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  623  PTKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  682

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM GRYLRDVW
Sbjct  683  SFVKNLQMEGRYLRDVW  699



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK EGA+LGPALLFFGCRNR+MD+IY+DELNNFVE G LSELI+AFSREG
Sbjct  556  FRGFLQERMALKREGAQLGPALLFFGCRNRRMDFIYQDELNNFVEEGVLSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHK+ +KAA  W+L+SQG Y YVCGDAKGMARDVHRTLHTI QEQ  +DS+KAE
Sbjct  616  PTKEYVQHKLMEKAAYTWDLVSQGGYFYVCGDAKGMARDVHRTLHTIVQEQERVDSTKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  676  ARVKQLQMDGRYLRDVW  692



>ref|XP_010525727.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Tarenaya hassleriana]
Length=713

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE G ELG +++FFGCRNR+MD+IYEDEL  FVE GALSEL++AFSREG
Sbjct  577  FRGFLQERHALKESGVELGSSIMFFGCRNRRMDFIYEDELQRFVERGALSELVVAFSREG  636

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA+++W  ISQG YLYVCGDAKGMARDVHR LHTI QEQGS+DSSKAE
Sbjct  637  PTKEYVQHKMMDKASEMWKTISQGGYLYVCGDAKGMARDVHRALHTIVQEQGSMDSSKAE  696

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQMSGRYLRDVW
Sbjct  697  SFVKNLQMSGRYLRDVW  713



>ref|NP_001061346.1| Os08g0243500, partial [Oryza sativa Japonica Group]
 dbj|BAF23260.1| Os08g0243500, partial [Oryza sativa Japonica Group]
Length=651

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL+ K+ GAELG ++ FFGCRN KMD+IYEDELN F+E GALSEL++AFSREG
Sbjct  515  FRGFLQERLSQKQSGAELGRSVFFFGCRNSKMDFIYEDELNTFLEEGALSELVLAFSREG  574

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKMSQKA++IW++ISQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  575  PTKEYVQHKMSQKASEIWDMISQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  634

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQ  GRYLRDVW
Sbjct  635  SFVKSLQTEGRYLRDVW  651



>ref|XP_010234513.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=700

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELG ++ FFGCRN KMD+IYEDELNNF+E GALSEL++AFSREG
Sbjct  564  FRGFLQERLAQKESGAELGRSVFFFGCRNSKMDFIYEDELNNFLEQGALSELVLAFSREG  623

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM+QKA+DIW++I QG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  624  STKEYVQHKMAQKASDIWDVIFQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  683

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQ  GRYLRDVW
Sbjct  684  SFVKNLQTEGRYLRDVW  700



>gb|AAS00459.1| NADPH:cytochrome P450-reductase [Hypericum androsaemum]
Length=685

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G +LGPALLFFGCRNR+MDYIYE+ELNNFVE GALSELI+AFSREG
Sbjct  549  FRGFLQERMALKEDGVQLGPALLFFGCRNRQMDYIYEEELNNFVEQGALSELIVAFSREG  608

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P K+YVQHKM  KAA IW ++SQGA++YVCGDAKGMARDVHRTLHTI QEQG+LDSSK E
Sbjct  609  PQKDYVQHKMMDKAAYIWEVLSQGAHIYVCGDAKGMARDVHRTLHTIVQEQGNLDSSKTE  668

Query  366  SMVKNLQMSGRYLRDVW  316
              VK LQM GRYLR+VW
Sbjct  669  LFVKKLQMDGRYLRNVW  685



>ref|XP_003578634.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=697

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG A+LFFGCRNRKMD+IYEDELNNF + GALSELI+AFSR+G
Sbjct  561  FRGFLQERLALKEIGVELGRAILFFGCRNRKMDFIYEDELNNFADAGALSELIVAFSRDG  620

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+ KA ++W++ISQG Y+YVCGDAKGMARDVHR LHTI Q QGSLD+SK E
Sbjct  621  PTKEYVQHKMAAKAPELWSIISQGGYIYVCGDAKGMARDVHRVLHTIVQGQGSLDNSKTE  680

Query  366  SMVKNLQMSGRYLRDVW  316
            S +KNLQM GRYLRDVW
Sbjct  681  SYMKNLQMEGRYLRDVW  697



>emb|CAC27143.1| NADPH-cytochrome P450 reductase [Picea abies]
Length=196

 Score =   228 bits (580),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E G +LGPA+LFFGCRNR+MDYIYEDEL N+V+ G LS+L++AFSREG
Sbjct  60   FRGFLQERDALQESGEKLGPAVLFFGCRNRQMDYIYEDELKNYVDNGVLSDLVLAFSREG  119

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHK+++KA+ IWNLISQG YLYVCGDAKGMARDVHRTLH I QEQ S+DS+ AE
Sbjct  120  TTKEYVQHKITEKASYIWNLISQGGYLYVCGDAKGMARDVHRTLHNIVQEQESVDSTSAE  179

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQ  GRYLRDVW
Sbjct  180  ATVKKLQTEGRYLRDVW  196



>ref|XP_004973052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=702

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE G ELG ++ FFGCRN KMD+IYEDELNNF+E GALSEL++AFSR+G
Sbjct  566  FRGFLQERLAQKESGVELGRSVFFFGCRNSKMDFIYEDELNNFLEQGALSELVLAFSRQG  625

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA++IW++ISQGAY+YVCGDAKGMA+DVH+ LHTI QEQGSLDSSKAE
Sbjct  626  PTKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMAKDVHKVLHTIVQEQGSLDSSKAE  685

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNL   GRYLRDVW
Sbjct  686  SFVKNLHTEGRYLRDVW  702



>ref|XP_008676669.1| PREDICTED: uncharacterized protein LOC100216882 isoform X1 [Zea 
mays]
 gb|AFW62053.1| hypothetical protein ZEAMMB73_790468 [Zea mays]
Length=702

 Score =   241 bits (616),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA KE GAELG ++ FFGCRN KMD+IYE ELNNFVE GALSEL++AFSR+G
Sbjct  566  FRGFLQERLAQKESGAELGRSVFFFGCRNSKMDFIYEGELNNFVEQGALSELVLAFSRQG  625

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM+QKA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  626  LAKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  685

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM GRYLRDVW
Sbjct  686  SFVKNLQMEGRYLRDVW  702



>ref|XP_003579401.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=692

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G  LG ++LFFGCRNR MDYIYEDEL NF++ GALSEL++A+SREG
Sbjct  556  FRGFLQERLALKESGVGLGTSILFFGCRNRNMDYIYEDELQNFLQEGALSELVVAYSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA +IWN+ISQG Y+YVCGDAKGMARDVHR LHTI QEQGSLD+SK E
Sbjct  616  PTKEYVQHKMVEKATEIWNIISQGGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDNSKTE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  676  SYVKSLQMEGRYLRDVW  692



>ref|XP_004960247.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Setaria 
italica]
Length=694

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK+ G ELG ++LFFGCRN  +DYIYEDEL NF++ GALSELI+AFSREG
Sbjct  558  FRGFLQERLALKQSGVELGTSILFFGCRNCNVDYIYEDELQNFLQEGALSELIVAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM +KA +IWN+ISQG YLYVCGDAKGMARDVHR LHTI QEQGSLDSSK E
Sbjct  618  PTKEYVQHKMVEKATEIWNIISQGGYLYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQM GRYLRDVW
Sbjct  678  SYVKSLQMEGRYLRDVW  694



>gb|EEE68301.1| hypothetical protein OsJ_26563 [Oryza sativa Japonica Group]
Length=711

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL+ K+ GAELG ++ FFGCRN KMD+IYEDELN F+E GALSEL++AFSREG
Sbjct  575  FRGFLQERLSQKQSGAELGRSVFFFGCRNSKMDFIYEDELNTFLEEGALSELVLAFSREG  634

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKMSQKA++IW++ISQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  635  PTKEYVQHKMSQKASEIWDMISQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  694

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQ  GRYLRDVW
Sbjct  695  SFVKSLQTEGRYLRDVW  711



>ref|XP_010688489.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=705

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+G +LG A+LFFGCRNRK+D+IYEDEL NFVETG LSEL++AFSREG
Sbjct  569  FRGFLQERSALKEDGVDLGQAILFFGCRNRKVDFIYEDELQNFVETGVLSELVVAFSREG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM ++A+D+WN+I+QG Y+YVCGDAKGMARDVHR LHTI QEQG + SS+AE
Sbjct  629  PTKEYVQHKMMERASDVWNVINQGGYVYVCGDAKGMARDVHRVLHTILQEQGGMGSSQAE  688

Query  366  SMVKNLQMSGRYLRDVW  316
             MVKNLQ +GRYLRDVW
Sbjct  689  GMVKNLQTTGRYLRDVW  705



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+G +LGPALLFFGCRNR+MD+IYEDELNNFV+ GA+SELI+AFSREG
Sbjct  556  FRGFLQERLALKEDGVQLGPALLFFGCRNRQMDFIYEDELNNFVQQGAISELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KA  +W+LISQG YLYVCGDAKGMARDVHR+LHTI Q+Q + DSSKAE
Sbjct  616  PEKEYVQHKMMDKAEYLWSLISQGGYLYVCGDAKGMARDVHRSLHTIVQQQENADSSKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  676  ATVKKLQMDGRYLRDVW  692



>ref|XP_006659239.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=568

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL+ K+ GAELG ++ FFGCRN KMD+IYE+ELN F+E GALSEL++AFSREG
Sbjct  432  FRGFLQERLSQKQAGAELGRSVFFFGCRNSKMDFIYENELNTFLEEGALSELVLAFSREG  491

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM+QKA++IW++ISQG Y+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  492  PTKEYVQHKMAQKASEIWDVISQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  551

Query  366  SMVKNLQMSGRYLRDVW  316
            S VK+LQ  GRYLRDVW
Sbjct  552  SFVKSLQTEGRYLRDVW  568



>ref|XP_007141274.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
 gb|ESW13268.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
Length=685

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL LKE G +LG A+LFFGCRNR+MD+IYEDELN FVE GALSELI+AFSREG
Sbjct  549  FRGFLQERLDLKENGIQLGSAVLFFGCRNRQMDFIYEDELNKFVEQGALSELIVAFSREG  608

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA++WNLISQG YLYVCGDAKGMARDVHRTLHTI Q+Q  +DSSKAE
Sbjct  609  PEKEYVQHKMIDKAANLWNLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQEKVDSSKAE  668

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  669  AIVKKLQMDGRYLRDVW  685



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK++GA+LGPALLFFGCRNR+MD+IYEDELNNFVE G +SELI+AFSREG
Sbjct  558  FRGFLQERMALKQDGAQLGPALLFFGCRNRRMDFIYEDELNNFVEEGVISELILAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA +W+L+S+  YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  618  PQKEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK  QM GRYLRDVW
Sbjct  678  SIVKKFQMEGRYLRDVW  694



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+G +LGPALLFFGCRNR+MD+IYEDELNNFVE G+LSELI+AFSREG
Sbjct  556  FRGFLQERLALKEDGVQLGPALLFFGCRNRQMDFIYEDELNNFVEQGSLSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  KAA +W+LISQG YLYVCGDAKGMARDVHRTLHTI Q+Q + DS+KAE
Sbjct  616  SEKEYVQHKMMDKAAYLWSLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENADSTKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  676  ATVKKLQMDGRYLRDVW  692



>gb|KDO81195.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=429

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK++GA+LGPALLFFGCRNR+MD+IYEDELNNF E G +SELI+AFSREG
Sbjct  293  FRGFLQERMALKQDGAQLGPALLFFGCRNRRMDFIYEDELNNFEEEGVISELILAFSREG  352

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  KAA +W+L+S+  YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  353  SQKEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAE  412

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK  QM GRYLRDVW
Sbjct  413  SIVKKFQMEGRYLRDVW  429



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   239 bits (610),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERL LKEEGA+LGPALLFFGCRNR+MD+IYEDELNNFV+ G +S+LI+AFSREG
Sbjct  555  FRGFLQERLVLKEEGAQLGPALLFFGCRNRRMDFIYEDELNNFVDQGVISKLIVAFSREG  614

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P K+YVQHKM +KAA+ W+LISQ  +LYVCGDAKGMARDVHRTLHTI QEQ  +DS++AE
Sbjct  615  PQKDYVQHKMIEKAAEFWSLISQKGHLYVCGDAKGMARDVHRTLHTIVQEQEKVDSTEAE  674

Query  366  SMVKNLQMSGRYLRDVW  316
            +MVK LQM GRYLRDVW
Sbjct  675  AMVKKLQMDGRYLRDVW  691



>dbj|BAJ99370.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG ++LFFGCRNR MDYIYEDEL NF++ GALSELI+A+SREG
Sbjct  506  FRGFLQERLALKESGVELGSSVLFFGCRNRDMDYIYEDELQNFLQEGALSELIVAYSREG  565

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA +IWN+ISQG Y+YVCGDAKGMA+DVHR LHTI Q+QGSLD+SK E
Sbjct  566  PTKEYVQHKMIDKATEIWNVISQGGYIYVCGDAKGMAKDVHRVLHTIVQKQGSLDNSKTE  625

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM GRYLRDVW
Sbjct  626  LYVKNLQMEGRYLRDVW  642



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+G +LGPALLFFGCRNR+MD+IYE+ELNNFVE G+LSELI+AFSREG
Sbjct  556  FRGFLQERFALKEDGVQLGPALLFFGCRNRQMDFIYEEELNNFVEQGSLSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KA+  W+LISQG YLYVCGDAKGMARDVHRTLHTI Q+Q + DSSKAE
Sbjct  616  PEKEYVQHKMMDKASYFWSLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENADSSKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  676  ATVKKLQMDGRYLRDVW  692



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE+G +LGPALLFFGCRNR+MD+IYEDELNNFVE G LSELI+AFSREG
Sbjct  552  FRGFLQERLALKEDGVQLGPALLFFGCRNRRMDFIYEDELNNFVEQGILSELILAFSREG  611

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  +A+ IWN+ISQG YLYVCGDAKGMA+DVHRTLHTI QEQ +++SSKAE
Sbjct  612  PQKEYVQHKMMDRASYIWNIISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQENVESSKAE  671

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK L   GRYLRDVW
Sbjct  672  AIVKKLHTEGRYLRDVW  688



>dbj|BAJ41268.1| NADPH-P450 reductase 1 [Zingiber officinale]
Length=703

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FR FLQERLALKE GAELGPALLFFGCRNRKMDYIYEDEL+N+V+ GALSELI+AFSREG
Sbjct  567  FRAFLQERLALKEAGAELGPALLFFGCRNRKMDYIYEDELDNYVKQGALSELIVAFSREG  626

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQ+K+S+KA D+WN+ISQG Y+YVCGDAKGMA+DVH+ +HTI QEQGSL+ SK E
Sbjct  627  QRKEYVQNKLSEKAVDVWNIISQGGYVYVCGDAKGMAKDVHKVIHTIAQEQGSLEGSKVE  686

Query  366  SMVKNLQMSGRYLRDVW  316
            + VKNLQM GRYLRDVW
Sbjct  687  AYVKNLQMEGRYLRDVW  703



>gb|AAG17471.1|AF123610_10 NADPH-cytochrome P450 reductase [Triticum aestivum]
Length=656

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELG ++LFFGCRNR+MDYIYE+EL NF++ GALSELI+A+SREG
Sbjct  520  FRGFLQERLALKESGAELGSSVLFFGCRNREMDYIYEEELQNFLQEGALSELIVAYSREG  579

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTKEYVQHKM  KA +IWN+ISQG Y+YVCGDAKGMA+DVHR LHTI Q+QGSLD+SK E
Sbjct  580  PTKEYVQHKMVDKATEIWNVISQGGYIYVCGDAKGMAKDVHRVLHTIVQKQGSLDNSKTE  639

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQM GRYLRDVW
Sbjct  640  LYVKNLQMEGRYLRDVW  656



>gb|ACG27711.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=703

 Score =   239 bits (609),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            +RGFLQERLA KE GAELG ++ FFGCRN KMD+IYE ELNNF+E GALSEL++AFSR+G
Sbjct  567  YRGFLQERLAQKESGAELGRSVFFFGCRNSKMDFIYEGELNNFLEQGALSELVLAFSRQG  626

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM+QKA++IW++ISQGAY+YVCGDAKGMARDVHR LHTI QEQGSLDSSKAE
Sbjct  627  LAKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAE  686

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQM GRYLRDVW
Sbjct  687  SFVKNLQMEGRYLRDVW  703



>ref|XP_007018235.1| P450 reductase 1 isoform 2 [Theobroma cacao]
 gb|EOY15460.1| P450 reductase 1 isoform 2 [Theobroma cacao]
Length=495

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -3

Query  726  FRGFLQ-ERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSRE  550
            FRGFLQ ER+ L+E+GA+LGP+LLFFGCRNR+MD+IYEDELNNFV  GALSELI+AFSRE
Sbjct  358  FRGFLQQERMVLQEDGAQLGPSLLFFGCRNRRMDFIYEDELNNFVAQGALSELIVAFSRE  417

Query  549  GPTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKA  370
             P KEYVQHKM  KAA +W+L+S+G YLYVCGDAKGMARDVHRTLHTI  EQ S+DSSKA
Sbjct  418  RPQKEYVQHKMMDKAAYMWSLLSKGGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKA  477

Query  369  ESMVKNLQMSGRYLRDVW  316
            ESMVK LQM GRYLRDVW
Sbjct  478  ESMVKKLQMEGRYLRDVW  495



>ref|XP_008451695.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis melo]
Length=705

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE G ELG ++LFFGCRNRKMDYIYEDELNNFVETGALSELI+AFSREG
Sbjct  572  FRGFLQERLALKESGVELGHSILFFGCRNRKMDYIYEDELNNFVETGALSELIVAFSREG  631

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P+KEYVQHKM +KA+DIWNL+SQGAY+YVCGDAKGMARDVHRTLH I QEQGSLDSSKAE
Sbjct  632  PSKEYVQHKMVEKASDIWNLLSQGAYIYVCGDAKGMARDVHRTLHNIVQEQGSLDSSKAE  691

Query  366  SMVK  355
            SMVK
Sbjct  692  SMVK  695



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ L+E+GA+LGP+LLFFGCRNR+MD+IYEDELNNFV  GALSELI+AFSRE 
Sbjct  557  FRGFLQERMVLQEDGAQLGPSLLFFGCRNRRMDFIYEDELNNFVAQGALSELIVAFSRER  616

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA +W+L+S+G YLYVCGDAKGMARDVHRTLHTI  EQ S+DSSKAE
Sbjct  617  PQKEYVQHKMMDKAAYMWSLLSKGGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKAE  676

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  677  SMVKKLQMEGRYLRDVW  693



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+GA+LGPALLFFGCRNR+MD+IYE+EL +FV+ G +SELIIAFSREG
Sbjct  550  FRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREG  609

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +KA+ +W+LISQ  YLYVCGDAKGMARDVHRTLHTI QEQ  +DS+KAE
Sbjct  610  PQKEYVQHKMLEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIIQEQDKVDSTKAE  669

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  670  AIVKKLQMDGRYLRDVW  686



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ L+E+GA+LGP+LLFFGCRNR+MD+IYEDELNNFV  GALSELI+AFSRE 
Sbjct  600  FRGFLQERMVLQEDGAQLGPSLLFFGCRNRRMDFIYEDELNNFVAQGALSELIVAFSRER  659

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA +W+L+S+G YLYVCGDAKGMARDVHRTLHTI  EQ S+DSSKAE
Sbjct  660  PQKEYVQHKMMDKAAYMWSLLSKGGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKAE  719

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQM GRYLRDVW
Sbjct  720  SMVKKLQMEGRYLRDVW  736



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+GA+LGPALLFFGCRNR+MD+IYE+EL +FV+ G +SELIIAFSREG
Sbjct  550  FRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREG  609

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +KA+ +W+LISQ  YLYVCGDAKGMARDVHRTLHTI QEQ + DSSKAE
Sbjct  610  PQKEYVQHKMMEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQENADSSKAE  669

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  670  AVVKKLQMDGRYLRDVW  686



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+GA+LGPALLFFGCRNR+MD+IYE+EL +FV+ G +SELIIAFSREG
Sbjct  550  FRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREG  609

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +KA+ +W+LISQ  YLYVCGDAKGMARDVHRTLHTI QEQ  +DS+KAE
Sbjct  610  PQKEYVQHKMLEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQDKVDSTKAE  669

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  670  AIVKKLQMDGRYLRDVW  686



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score =   236 bits (603),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+GA+LGPALLFFGCRNR+MD+IYE+EL +FV+ G +SELIIAFSREG
Sbjct  550  FRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELKSFVDQGVISELIIAFSREG  609

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +KA+++W+LISQ  YLYVCGDAKGMARDVHRTLHTI QEQ + +SSKAE
Sbjct  610  PQKEYVQHKMMEKASEVWSLISQDGYLYVCGDAKGMARDVHRTLHTIVQEQENANSSKAE  669

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  670  AIVKKLQMDGRYLRDVW  686



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GA+LGPALLFFGCRNR+MD+IYEDEL+ FV  G +SELI+AFSREG
Sbjct  554  FRGFLQERLALKELGAQLGPALLFFGCRNRRMDFIYEDELSGFVNQGVISELIVAFSREG  613

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM++KAA  W+LISQ  YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  614  PQKEYVQHKMTEKAAQFWSLISQVGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAE  673

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  674  AIVKKLQTDGRYLRDVW  690



>gb|EPS67504.1| hypothetical protein M569_07270, partial [Genlisea aurea]
Length=710

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALKE GAELGPALLFFGCRN KMD+IYEDEL  FVE G +SEL++AFSREG
Sbjct  574  FRGFLQERLALKESGAELGPALLFFGCRNSKMDFIYEDELKVFVEAGVISELVVAFSREG  633

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKMS+KA +IW++I QG  +YVCGDAKGMARDVHRTLHTI QEQGS+ +++AE
Sbjct  634  SKKEYVQHKMSEKATEIWSMIEQGGSVYVCGDAKGMARDVHRTLHTIVQEQGSMSTTEAE  693

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VKNLQ SGRYLRDVW
Sbjct  694  ALVKNLQTSGRYLRDVW  710



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+G +LGPALLFFGCRNR+MD+IYEDEL +FVE G+LSELI+AFSREG
Sbjct  554  FRGFLQERYALKEDGVQLGPALLFFGCRNRQMDFIYEDELKSFVEQGSLSELIVAFSREG  613

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  KAA +W+LISQG YLYVCGDAKGMARDVHRTLH+I QEQ ++DS+KAE
Sbjct  614  AEKEYVQHKMMDKAAHLWSLISQGGYLYVCGDAKGMARDVHRTLHSIVQEQENVDSTKAE  673

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  674  AIVKKLQMDGRYLRDVW  690



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+G +LGPALLFFGCRNR+MD+IYEDEL +FVE G+LSELI+AFSREG
Sbjct  554  FRGFLQERYALKEDGVQLGPALLFFGCRNRQMDFIYEDELKSFVEQGSLSELIVAFSREG  613

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  KAA +W+LISQG YLYVCGDAKGMARDVHRTLH+I QEQ ++DS+KAE
Sbjct  614  AEKEYVQHKMMDKAAHLWSLISQGGYLYVCGDAKGMARDVHRTLHSIVQEQENVDSTKAE  673

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  674  AIVKKLQMDGRYLRDVW  690



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+GA+LGPALLFFGCRNR+MD+IYE+EL +FV+ G +SELIIAFSREG
Sbjct  551  FRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREG  610

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +KA+ +W+LISQ  YLYVCGDAKGMARDVHRTLHTI QEQ   DSSKAE
Sbjct  611  PQKEYVQHKMMEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKADSSKAE  670

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  671  ATVKKLQMDGRYLRDVW  687



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+GA+LGPALLFFGCRNR+MD+IYE+EL +FV+ G +SELIIAFSREG
Sbjct  550  FRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREG  609

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KA+D+W+LISQ  YLYVCGDAKGMARDVHRTLHTI QEQ + DSSKAE
Sbjct  610  SQKEYVQHKMMEKASDVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQENADSSKAE  669

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  670  AVVKKLQMDGRYLRDVW  686



>gb|KFK29577.1| nadph-ferrihemoprotein reductase [Arabis alpina]
Length=715

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL E G ELGP++LFFGCRNR+MD+IYE+EL  FVE+GAL+EL +AFSREG
Sbjct  579  FRGFLQERHALVESGVELGPSVLFFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREG  638

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            PTK+YVQHKM  KA++IW++IS+GAY+YVCGDAKGMARDVHR+LHTI QEQGS+DS+KAE
Sbjct  639  PTKQYVQHKMMDKASEIWSMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAE  698

Query  366  SMVKNLQMSGRYLRDVW  316
              VKNLQ +GRYLRDVW
Sbjct  699  GFVKNLQTTGRYLRDVW  715



>gb|KDO81194.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=558

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK++GA+LGPALLFFGCRNR+MD+IYEDELNNF E G +SELI+AFSREG
Sbjct  422  FRGFLQERMALKQDGAQLGPALLFFGCRNRRMDFIYEDELNNFEEEGVISELILAFSREG  481

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  KAA +W+L+S+  YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  482  SQKEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAE  541

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK  QM GRYLRDVW
Sbjct  542  SIVKKFQMEGRYLRDVW  558



>ref|XP_009408053.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=705

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER   KE G +LG A+LFFGCRN KMD+IY+DELNNFVETG LSELI+A SREG
Sbjct  569  FRGFLQERWGQKEAGMQLGRAILFFGCRNSKMDFIYKDELNNFVETGILSELIVALSREG  628

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM++KA+DIWN+ISQG Y+YVCGDAKGMARDVH+ LHTI QEQGSLD SK E
Sbjct  629  PIKEYVQHKMTEKASDIWNIISQGGYVYVCGDAKGMARDVHKVLHTICQEQGSLDGSKTE  688

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK+LQ  GRYLRDVW
Sbjct  689  SLVKSLQTEGRYLRDVW  705



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+G +LGPA+LFFGCRNR+MD+IYEDEL NFVE G+LSELI+AFSREG
Sbjct  555  FRGFLQERFALKEDGVQLGPAILFFGCRNRRMDFIYEDELKNFVEQGSLSELIVAFSREG  614

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  +AA +W+LISQG YLYVCGDAKGMARDVHR LHTI Q+Q ++DS+KAE
Sbjct  615  AEKEYVQHKMMDQAAHLWSLISQGGYLYVCGDAKGMARDVHRILHTIVQQQENVDSTKAE  674

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  675  AIVKKLQMDGRYLRDVW  691



>emb|CDX92639.1| BnaC07g38970D [Brassica napus]
Length=695

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+GAELGP+LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  559  FRGFLQERMALKEDGAELGPSLLFFGCRNRRMDFIYEDELNNFVDQGVISELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KAA +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  619  AQKEYVQHKMIEKAAQVWNLIKEKGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  679  AIVKKLQTEGRYLRDVW  695



>ref|XP_009137451.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Brassica 
rapa]
Length=556

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA+KE+G ELGP+LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  420  FRGFLQERLAIKEDGVELGPSLLFFGCRNRRMDFIYEDELNNFVDKGVISELIVAFSREG  479

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KA+ +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  480  AQKEYVQHKMIEKASQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  539

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  540  AIVKKLQTEGRYLRDVW  556



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score =   233 bits (595),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK++GA+LGPALLFFGCRNR+MD+IYEDELNNF E G +SELI+AFSREG
Sbjct  558  FRGFLQERMALKQDGAQLGPALLFFGCRNRRMDFIYEDELNNFEEEGVISELILAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  KAA +W+L+S+  YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  618  SQKEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK  QM GRYLRDVW
Sbjct  678  SIVKKFQMEGRYLRDVW  694



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score =   233 bits (595),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK++GA+LGPALLFFGCRNR+MD+IYEDELNNF E G +SELI+AFSREG
Sbjct  558  FRGFLQERMALKQDGAQLGPALLFFGCRNRRMDFIYEDELNNFEEEGVISELILAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  KAA +W+L+S+  YLYVCGDAKGMARDVHRTLHTI QEQ ++DSSKAE
Sbjct  618  SQKEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            S+VK  QM GRYLRDVW
Sbjct  678  SIVKKFQMEGRYLRDVW  694



>gb|AIL29328.1| cytochrome P450 reductase [Pinus contorta]
Length=718

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL+E GA+LGPA+LFFGCRNR+MDYIYEDEL N+V+TG L++L++AFSREG
Sbjct  582  FRGFLQERAALQESGAKLGPAVLFFGCRNRQMDYIYEDELKNYVDTGVLTDLVLAFSREG  641

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHK+++KA+ IWNLISQG YLYVCGDAKGMARDVHRTLH I QEQ S+DS+ AE
Sbjct  642  ATKEYVQHKIAEKASYIWNLISQGGYLYVCGDAKGMARDVHRTLHNIIQEQESVDSTSAE  701

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQ  GRYLRDVW
Sbjct  702  ATVKKLQTEGRYLRDVW  718



>gb|AAC05021.1| NADPH:ferrihemoprotein oxidoreductase [Papaver somniferum]
 gb|AHF27398.1| NADPH:ferrihemoprotein oxidoreductase [synthetic construct]
Length=683

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE GA+LGPA+LFFGCRNR MD+IYEDELNNFVE G +SEL+IAFSREG
Sbjct  547  FRGFLQERMALKENGAQLGPAVLFFGCRNRNMDFIYEDELNNFVERGVISELVIAFSREG  606

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KA D+WN+IS   YLYVCGDAKGMARDVHRTLHTI QEQG ++SS AE
Sbjct  607  EKKEYVQHKMMEKATDVWNVISGDGYLYVCGDAKGMARDVHRTLHTIAQEQGPMESSAAE  666

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQ+  RYLRDVW
Sbjct  667  AAVKKLQVEERYLRDVW  683



>emb|CDY11017.1| BnaA03g46760D [Brassica napus]
Length=695

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA+KE+G ELGP+LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  559  FRGFLQERLAIKEDGVELGPSLLFFGCRNRRMDFIYEDELNNFVDQGVISELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KAA +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  619  AQKEYVQHKMIEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  679  AIVKKLQTEGRYLRDVW  695



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER AL E+G +LGPALLFFGCRNR+MD+IYEDEL NFVE G+LSELI+AFSREG
Sbjct  556  FRGFLQERYALIEDGVQLGPALLFFGCRNRQMDFIYEDELKNFVEQGSLSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHK+  +AA +W+LISQG YLYVCGDAK MARDVHRTLH+I Q+Q ++DS+KAE
Sbjct  616  PEKEYVQHKIMDQAAHVWSLISQGGYLYVCGDAKCMARDVHRTLHSIVQQQENVDSTKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  676  AIVKKLQMDGRYLRDVW  692



>emb|CDY03447.1| BnaC01g16350D [Brassica napus]
Length=695

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G ELGP+LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  559  FRGFLQERMALKEDGVELGPSLLFFGCRNRRMDFIYEDELNNFVDKGVISELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHK+ +KAA +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  619  AQKEYVQHKIVEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  679  AIVKKLQTEGRYLRDVW  695



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   231 bits (589),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE G +LGP+LLFFGCRNRKMD+IYEDEL N+V+ G LSELI+AFSREG
Sbjct  559  FRGFLQERMALKENGVQLGPSLLFFGCRNRKMDFIYEDELYNYVDQGVLSELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +KAA++W LI +G YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  619  PQKEYVQHKMMEKAAEVWKLIKEG-YLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  678  AVVKKLQMEGRYLRDVW  694



>ref|XP_009137450.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Brassica 
rapa]
Length=695

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA+KE+G ELGP+LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  559  FRGFLQERLAIKEDGVELGPSLLFFGCRNRRMDFIYEDELNNFVDKGVISELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KA+ +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  619  AQKEYVQHKMIEKASQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  679  AIVKKLQTEGRYLRDVW  695



>ref|XP_010526342.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=716

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLA+KE G ELG ++LFFGCRNR+MD+IYEDEL  FVE+GALSEL++AFSRE 
Sbjct  580  FRGFLQERLAMKESGTELGSSILFFGCRNRRMDFIYEDELERFVESGALSELVVAFSRER  639

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             +KEYVQHKM  KA+DIW +I +GAY+YVCGDAKGMARDVHR LH I QEQGS++SS+AE
Sbjct  640  SSKEYVQHKMMDKASDIWKMIREGAYVYVCGDAKGMARDVHRALHAIVQEQGSMESSEAE  699

Query  366  SMVKNLQMSGRYLRDVW  316
            S VKNLQ SGRYLRDVW
Sbjct  700  SFVKNLQTSGRYLRDVW  716



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER  LKEEGA+LGPALLFFGCRNR+MD+IYE EL  + + G +SELI+AFSREG
Sbjct  556  FRGFLQERFVLKEEGAQLGPALLFFGCRNRRMDFIYESELKKYEDEGVVSELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +KAA+IW+L+SQ  YLYVCGDAKGMARDVHR LHTI QEQ   DSSKAE
Sbjct  616  PQKEYVQHKMMEKAAEIWSLLSQEGYLYVCGDAKGMARDVHRALHTIVQEQEKTDSSKAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM+GRYLRDVW
Sbjct  676  AIVKQLQMNGRYLRDVW  692



>ref|XP_011016946.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Populus euphratica]
Length=692

 Score =   231 bits (588),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G +LGPALLFFGCRN +MD+IYEDELNNF   G +SEL++AFSREG
Sbjct  556  FRGFLQERMALKEDGTQLGPALLFFGCRNHQMDFIYEDELNNFAAQGVISELLVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P K YVQHKM  KAA+IW++ISQG+YLYVC DAKGMARDVH TL  I QEQG LDSSK E
Sbjct  616  PQKXYVQHKMVDKAAEIWSIISQGSYLYVCDDAKGMARDVHWTLRAIVQEQGGLDSSKTE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            SMVK LQ+ GRYLRDVW
Sbjct  676  SMVKKLQIEGRYLRDVW  692



>emb|CDY34287.1| BnaA01g13900D [Brassica napus]
Length=694

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQ+R+ALKE+G ELGP+LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  558  FRGFLQKRMALKEDGVELGPSLLFFGCRNRRMDFIYEDELNNFVDKGVISELIVAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHK+ QKAA  WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  618  AQKEYVQHKIVQKAAQFWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  678  AIVKKLQTEGRYLRDVW  694



>gb|AAX59902.1| cytochrome P450 reductase [Taxus wallichiana var. chinensis]
Length=717

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER  L+E G +LGPA+LFFGCRNR+MDYIYEDEL  +VE G L++LI+AFSREG
Sbjct  581  FRGFLQERAKLQEAGEKLGPAVLFFGCRNRQMDYIYEDELKGYVEKGVLTDLIVAFSREG  640

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM +KA+D W+LI+QG YLYVCGDAKGMARDVHRTLHTI QEQ S+DSSKAE
Sbjct  641  ATKEYVQHKMLEKASDTWSLIAQGGYLYVCGDAKGMARDVHRTLHTIVQEQESVDSSKAE  700

Query  366  SMVKNLQMSGRYLRDVW  316
             +VK LQM GRYLRD+W
Sbjct  701  FLVKKLQMDGRYLRDIW  717



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE G + GPA+LFFGCRNR++D+IYE+EL NFVE G+LSELI+AFSREG
Sbjct  555  FRGFLQERFALKEAGVQQGPAILFFGCRNRRLDFIYEEELKNFVEQGSLSELIVAFSREG  614

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  +AA +W+LISQG YLYVCGDAKGMARDVHRTLHTI Q+Q ++DS+KAE
Sbjct  615  AEKEYVQHKMMDQAAQLWSLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSTKAE  674

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  675  AIVKKLQMDGRYLRDVW  691



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALK EGAELGPA+LFFGCRNR+MD+IYE+ELN+FV+ G +SELI+AFSREG
Sbjct  554  FRGFLQERSALKREGAELGPAILFFGCRNRRMDFIYENELNDFVDQGVISELIVAFSREG  613

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              K+YVQHKM +KAA +W+LIS G YLYVCGDAKGMARDVHR+LHTI Q Q ++DS+KAE
Sbjct  614  SQKDYVQHKMMEKAAQVWSLISGGGYLYVCGDAKGMARDVHRSLHTIVQTQENVDSTKAE  673

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  674  ATVKKLQMDGRYLRDVW  690



>ref|XP_010692385.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=693

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQERLALK++G +LGPA+LFFGCRNR+MD+IYE+EL+ FVE GA+SEL++AFSREG
Sbjct  557  FRGFLQERLALKQDGVQLGPAILFFGCRNRRMDFIYEEELHKFVEEGAVSELVVAFSREG  616

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM  KA+ +WNLIS G YLYVCGDAKGMARDVHRTLH I QEQ  ++SSKAE
Sbjct  617  TQKEYVQHKMVDKASYLWNLISSGGYLYVCGDAKGMARDVHRTLHNIVQEQEKVESSKAE  676

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQM GRYLRDVW
Sbjct  677  AIVKKLQMDGRYLRDVW  693



>gb|AAT76449.1| NADPH:cytochrome P450 reductase [Taxus cuspidata]
Length=717

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER  L+E G +LGPA+LFFGCRNR+MDYIYEDEL  +VE G L+ LI+AFSREG
Sbjct  581  FRGFLQERAKLQEAGEKLGPAVLFFGCRNRQMDYIYEDELKGYVEKGILTNLIVAFSREG  640

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
             TKEYVQHKM +KA+D W+LI+QG YLYVCGDAKGMARDVHRTLHTI QEQ S+DSSKAE
Sbjct  641  ATKEYVQHKMLEKASDTWSLIAQGGYLYVCGDAKGMARDVHRTLHTIVQEQESVDSSKAE  700

Query  366  SMVKNLQMSGRYLRDVW  316
             +VK LQM GRYLRD+W
Sbjct  701  FLVKKLQMDGRYLRDIW  717



>ref|XP_002867662.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43921.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G ELG +LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  556  FRGFLQERMALKEDGEELGSSLLFFGCRNRRMDFIYEDELNNFVDQGVISELIVAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KAA +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  616  AQKEYVQHKMMEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  676  AIVKKLQTEGRYLRDVW  692



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE GA+LGPALLFFGCRNR+MD+IYEDELNNF+++G +SELI+AFSREG
Sbjct  556  FRGFLQERFALKENGAQLGPALLFFGCRNRRMDFIYEDELNNFMDSGVISELILAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KA  +WNLIS+  Y+YVCGDAKGMARDVHRTLHTI QEQ ++ SS+AE
Sbjct  616  LKKEYVQHKMMEKAVQLWNLISKEGYIYVCGDAKGMARDVHRTLHTIVQEQENVRSSEAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  676  AVVKKLQTEGRYLRDVW  692



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER ALKE+GA+LGPA+LFFG RNR+MD+IYE+EL  FV+ G LSELI+AFSREG
Sbjct  550  FRGFLQERAALKEDGAQLGPAMLFFGYRNRRMDFIYEEELQRFVDQGVLSELIVAFSREG  609

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM +KA+ +W+LISQ  YLYVCGDAKGMARDVHR LHTI QEQ + DSSKAE
Sbjct  610  PQKEYVQHKMMEKASHVWSLISQEGYLYVCGDAKGMARDVHRALHTIVQEQENADSSKAE  669

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  670  ATVKKLQMDGRYLRDVW  686



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALK +G +LGPALLFFGCRNR+MD+IY+DEL NFV+ G +SELI+AFSREG
Sbjct  559  FRGFLQERMALKLDGNDLGPALLFFGCRNRRMDFIYKDELYNFVDQGVISELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
            P KEYVQHKM  KAA +W+L+S+  YLYVCGDAKGMARDVHRTLHTI QEQ ++DSS AE
Sbjct  619  PQKEYVQHKMMDKAAYLWSLLSKDGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSTAE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            + VK LQM GRYLRDVW
Sbjct  679  ATVKKLQMEGRYLRDVW  695



>ref|XP_006413419.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
 gb|ESQ54872.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
Length=694

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G +LG +LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  558  FRGFLQERMALKEDGVDLGSSLLFFGCRNRRMDFIYEDELNNFVDQGVISELIVAFSREG  617

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KAA +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  618  AQKEYVQHKMIEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  677

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  678  AVVKKLQTEGRYLRDVW  694



>ref|XP_009138145.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=695

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G ELGP+LLFFGCRNR+MD+IYEDELNN+ + G +SELI+AFSREG
Sbjct  559  FRGFLQERMALKEDGVELGPSLLFFGCRNRRMDFIYEDELNNYADQGVISELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHK+ +KA  +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  619  AQKEYVQHKIIEKATQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  679  AIVKKLQTEGRYLRDVW  695



>emb|CDY34288.1| BnaA01g13910D [Brassica napus]
Length=695

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G ELGP+LLFFGCRNR+MD+IYEDELNN+ + G +SELI+AFSREG
Sbjct  559  FRGFLQERMALKEDGVELGPSLLFFGCRNRRMDFIYEDELNNYADQGVISELIVAFSREG  618

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHK+ +KA  +WNLI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  619  AQKEYVQHKIIEKATQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  678

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  679  AIVKKLQTEGRYLRDVW  695



>emb|CAA46814.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=692

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G ELG +LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  556  FRGFLQERMALKEDGEELGSSLLFFGCRNRQMDFIYEDELNNFVDQGVISELIMAFSREG  615

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KAA +W+LI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  616  AQKEYVQHKMMEKAAQVWDLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  675

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  676  AIVKKLQTEGRYLRDVW  692



>ref|NP_001190823.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AEE84920.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
Length=688

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  726  FRGFLQERLALKEEGAELGPALLFFGCRNRKMDYIYEDELNNFVETGALSELIIAFSREG  547
            FRGFLQER+ALKE+G ELG +LLFFGCRNR+MD+IYEDELNNFV+ G +SELI+AFSREG
Sbjct  552  FRGFLQERMALKEDGEELGSSLLFFGCRNRQMDFIYEDELNNFVDQGVISELIMAFSREG  611

Query  546  PTKEYVQHKMSQKAADIWNLISQGAYLYVCGDAKGMARDVHRTLHTIFQEQGSLDSSKAE  367
              KEYVQHKM +KAA +W+LI +  YLYVCGDAKGMARDVHRTLHTI QEQ  + SS+AE
Sbjct  612  AQKEYVQHKMMEKAAQVWDLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAE  671

Query  366  SMVKNLQMSGRYLRDVW  316
            ++VK LQ  GRYLRDVW
Sbjct  672  AIVKKLQTEGRYLRDVW  688



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100