BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046J12

Length=752
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR83865.1|  elongation factor 1-alpha                               306   2e-102   Capsicum annuum
gb|ACF81592.1|  unknown                                                 303   9e-101   Zea mays [maize]
dbj|BAO57272.1|  elongation factor 1-alpha                              311   2e-100   Ipomoea nil [qian niu]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          309   1e-99    Nicotiana tomentosiformis
dbj|BAH20400.1|  AT1G07940                                              300   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            300   3e-99    
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               308   4e-99    Nicotiana tomentosiformis
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   298   1e-98    Gossypium raimondii
gb|ABW74483.1|  elongation factor                                       298   1e-98    Paeonia suffruticosa [moutan peony]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    307   1e-98    Nicotiana tabacum [American tobacco]
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     298   1e-98    Glycine max [soybeans]
gb|AFW76429.1|  putative translation elongation factor Tu family ...    301   2e-98    
dbj|BAA34348.1|  elongation factor-1 alpha                              306   2e-98    Nicotiana paniculata
ref|NP_001234035.1|  elongation factor 1-alpha                          306   2e-98    Solanum lycopersicum
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               306   2e-98    Nicotiana sylvestris
gb|AAQ90154.1|  putative translation elongation factor protein          300   3e-98    Solanum tuberosum [potatoes]
dbj|BAF75826.1|  hypothetical protein                                   296   3e-98    Malus domestica [apple tree]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               306   4e-98    Nicotiana tomentosiformis
dbj|BAF75825.1|  hypothetical protein                                   296   5e-98    Malus domestica [apple tree]
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    302   7e-98    
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          305   7e-98    Solanum lycopersicum
gb|ABV26710.1|  elongation factor 1 alpha                               305   7e-98    Gerbera hybrid cultivar
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          305   8e-98    Nicotiana sylvestris
dbj|BAN42602.1|  putative elongation factor 1-alpha                     296   8e-98    Pyrus pyrifolia var. culta [Asian pear]
gb|AGH55661.1|  elongation factor 1-alpha                               301   8e-98    Atropa belladonna [deadly nightshade]
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          305   8e-98    Nicotiana sylvestris
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          305   9e-98    Tarenaya hassleriana [spider flower]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             305   1e-97    Solanum tuberosum [potatoes]
dbj|BAC23049.1|  Elongation factor 1-alpha                              305   1e-97    Solanum tuberosum [potatoes]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          305   1e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          305   1e-97    Oryza brachyantha
ref|NP_001049145.1|  Os03g0177400                                       304   1e-97    
dbj|BAA23658.1|  EF-1 alpha                                             304   1e-97    Oryza sativa [red rice]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               304   2e-97    Tarenaya hassleriana [spider flower]
gb|AAC15413.1|  translation elongation factor-1 alpha                   304   2e-97    Oryza sativa Japonica Group [Japonica rice]
gb|AAN77897.1|  elongation factor 1 alpha                               304   2e-97    Stevia rebaudiana
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    304   2e-97    
gb|AHE76183.1|  elongation factor 1-alpha                               303   3e-97    Chrysanthemum indicum
emb|CAL25349.1|  elongation factor 1 alpha                              295   3e-97    Platanus x hispanica [London plane tree]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          303   4e-97    Solanum tuberosum [potatoes]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          303   5e-97    Tarenaya hassleriana [spider flower]
gb|AGT16628.1|  elongation factor 1 alpha                               301   6e-97    Saccharum hybrid cultivar R570
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         296   6e-97    Jatropha curcas
gb|AGT16893.1|  elongation factor 1-alpha                               303   6e-97    Saccharum hybrid cultivar R570
dbj|BAL14665.1|  elongation factor 1-alpha                              303   6e-97    Chrysanthemum seticuspe f. boreale
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    303   6e-97    Theobroma cacao [chocolate]
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  301   6e-97    Solanum tuberosum [potatoes]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          303   7e-97    Tarenaya hassleriana [spider flower]
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          302   8e-97    Sesamum indicum [beniseed]
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             301   9e-97    Solanum tuberosum [potatoes]
gb|ACR38047.1|  unknown                                                 302   1e-96    Zea mays [maize]
ref|NP_001152668.1|  LOC100286309                                       302   1e-96    Zea mays [maize]
ref|XP_002518072.1|  elongation factor 1-alpha, putative                297   1e-96    Ricinus communis
gb|AGZ15393.1|  elongation factor 1-alpha                               297   1e-96    Phaseolus vulgaris [French bean]
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          296   1e-96    Cucumis melo [Oriental melon]
gb|ABU63160.1|  elongation factor                                       302   1e-96    Saccharum officinarum [noble cane]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            298   1e-96    
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   297   1e-96    Gossypium raimondii
ref|XP_002539209.1|  elongation factor 1-alpha, putative                296   1e-96    Ricinus communis
gb|AFC88830.1|  putative elongation factor 1-alpha                      302   1e-96    Miscanthus sinensis
gb|AGH32502.1|  translation elongation factor-1 alpha                   302   1e-96    Stylosanthes guianensis [stylo]
gb|ABB86283.1|  elongation factor-1 alpha-like                          302   1e-96    Solanum tuberosum [potatoes]
gb|AAL79775.1|  elongation factor 1 alpha                               301   1e-96    Saccharum hybrid cultivar CP72-2086
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          302   1e-96    Solanum tuberosum [potatoes]
gb|KHG26926.1|  Elongation factor 1-alpha                               301   2e-96    Gossypium arboreum [tree cotton]
dbj|BAN42601.1|  putative elongation factor 1-alpha                     293   2e-96    Pyrus pyrifolia var. culta [Asian pear]
gb|AGZ90153.1|  elongation factor 1-alpha                               294   2e-96    Litsea cubeba [may chang]
ref|NP_001275481.1|  elongation factor 1-alpha-like                     301   2e-96    Solanum tuberosum [potatoes]
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     301   2e-96    Saccharum hybrid cultivar CP65-357
gb|KHG20498.1|  Elongation factor 1-alpha                               301   2e-96    Gossypium arboreum [tree cotton]
emb|CDX70032.1|  BnaA10g23810D                                          298   3e-96    
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   297   3e-96    Gossypium raimondii
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    296   3e-96    
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    301   3e-96    Eucalyptus grandis [rose gum]
gb|AID52924.1|  elongation factor 1-alpha                               301   3e-96    Carthamus tinctorius
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    301   3e-96    Setaria italica
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          301   3e-96    
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    301   3e-96    Theobroma cacao [chocolate]
emb|CAL07988.1|  translation elongation factor 1 alpha                  293   3e-96    Platanus x hispanica [London plane tree]
dbj|BAH56641.1|  elongation factor 1a                                   298   4e-96    Nelumbo nucifera [Indian lotus]
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               301   4e-96    Elaeis guineensis
gb|AIX10769.1|  elongation factor 1 alpha                               301   4e-96    Panax notoginseng [san-qi]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          301   4e-96    Tarenaya hassleriana [spider flower]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    300   4e-96    
ref|NP_001105587.1|  elongation factor 1-alpha                          300   4e-96    Zea mays [maize]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          300   4e-96    Zea mays [maize]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               300   5e-96    Elaeis guineensis
gb|KHG23927.1|  Elongation factor 1-alpha                               300   5e-96    Gossypium arboreum [tree cotton]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    300   5e-96    Eucalyptus grandis [rose gum]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          300   6e-96    Setaria italica
gb|ABA12225.1|  translation elongation factor 1A-9                      300   6e-96    Gossypium hirsutum [American cotton]
gb|AEN79476.1|  elongation factor 1-alpha                               300   6e-96    Ziziphus jujuba [Chinese jujube]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          300   7e-96    Elaeis guineensis
gb|KJB09231.1|  hypothetical protein B456_001G130700                    300   7e-96    Gossypium raimondii
gb|EEE58429.1|  hypothetical protein OsJ_09630                          299   7e-96    Oryza sativa Japonica Group [Japonica rice]
gb|ADC68236.1|  elongation factor 1-alpha                               293   7e-96    Dendrobium nobile
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          300   8e-96    Nelumbo nucifera [Indian lotus]
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      296   8e-96    Cicer arietinum [garbanzo]
gb|ABA12221.1|  translation elongation factor 1A-5                      300   8e-96    Gossypium hirsutum [American cotton]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               300   8e-96    Tarenaya hassleriana [spider flower]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     300   8e-96    Zea mays [maize]
gb|ACG34498.1|  elongation factor 1-alpha                               300   9e-96    Zea mays [maize]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    300   9e-96    Zea mays [maize]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    300   1e-95    Sesamum indicum [beniseed]
gb|AGJ50595.1|  EF1alpha                                                300   1e-95    Pericallis cruenta
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               300   1e-95    Sesamum indicum [beniseed]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             300   1e-95    Eutrema salsugineum [saltwater cress]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               299   1e-95    Pyrus x bretschneideri [bai li]
dbj|BAC66180.1|  elongation factor 1A                                   299   1e-95    Avicennia marina
gb|AFY06644.1|  elongation factor 1-alpha                               295   1e-95    Carica papaya [mamon]
emb|CDY22710.1|  BnaC08g43440D                                          298   1e-95    Brassica napus [oilseed rape]
gb|AGY80449.1|  elongation factor 1-alpha                               299   2e-95    Dendrocalamus latiflorus [sweet bamboo]
emb|CAD60652.1|  elongation factor                                      299   2e-95    Solanum tuberosum [potatoes]
ref|NP_001105933.1|  elongation factor alpha2                           299   2e-95    
ref|NP_001105617.1|  elongation factor alpha3                           299   2e-95    Zea mays [maize]
gb|ADI24333.1|  elongation factor 1-alpha                               299   2e-95    Miscanthus sinensis
ref|NP_001288465.1|  elongation factor 1-alpha-like                     299   2e-95    Zea mays [maize]
dbj|BAF02151.1|  elongation factor 1-alpha                              299   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_200847.1|  elongation factor 1-alpha 4                           299   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AAK82537.1|  At1g07930/T6D22_3                                       299   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  299   2e-95    Citrus sinensis [apfelsine]
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              299   2e-95    Capsicum annuum
gb|AFW77593.1|  putative translation elongation factor Tu family ...    299   2e-95    
emb|CDY61938.1|  BnaCnng38780D                                          298   2e-95    Brassica napus [oilseed rape]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    299   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               299   2e-95    Phoenix dactylifera
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             299   2e-95    Citrus clementina [clementine]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             299   2e-95    Brassica rapa
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             299   2e-95    Capsella rubella
gb|ACG31866.1|  elongation factor 1-alpha                               298   2e-95    Zea mays [maize]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             299   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        298   2e-95    Brassica rapa
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               298   3e-95    Fragaria vesca subsp. vesca
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        298   3e-95    Brassica rapa
emb|CAA34456.1|  elongation factor 1-alpha                              298   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          298   3e-95    Eucalyptus grandis [rose gum]
gb|AAL57653.1|  At1g07930/T6D22_3                                       298   3e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         297   3e-95    Jatropha curcas
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          298   4e-95    Eucalyptus grandis [rose gum]
gb|ABA12220.1|  translation elongation factor 1A-4                      298   4e-95    Gossypium hirsutum [American cotton]
ref|XP_002528020.1|  elongation factor 1-alpha, putative                295   4e-95    
gb|ABA12217.1|  translation elongation factor 1A-1                      298   4e-95    Gossypium hirsutum [American cotton]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    298   4e-95    Zea mays [maize]
gb|ABA12218.1|  translation elongation factor 1A-2                      298   5e-95    Gossypium hirsutum [American cotton]
emb|CDX93604.1|  BnaA06g04440D                                          298   5e-95    
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          298   6e-95    Pyrus x bretschneideri [bai li]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               298   6e-95    Malus domestica [apple tree]
gb|ABA12219.1|  translation elongation factor 1A-3                      298   6e-95    Gossypium hirsutum [American cotton]
gb|KHN18669.1|  Elongation factor 1-alpha                               298   6e-95    Glycine soja [wild soybean]
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          298   6e-95    Eucalyptus grandis [rose gum]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             298   6e-95    Citrus clementina [clementine]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                298   7e-95    Ricinus communis
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   297   7e-95    Lilium longiflorum [Easter lily]
emb|CDX95108.1|  BnaC05g05630D                                          299   7e-95    
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          298   7e-95    
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          297   8e-95    Phoenix dactylifera
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          297   9e-95    Phoenix dactylifera
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             297   9e-95    Prunus persica
gb|KJB48746.1|  hypothetical protein B456_008G084000                    296   9e-95    Gossypium raimondii
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               297   1e-94    Eucalyptus grandis [rose gum]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          297   1e-94    Malus domestica [apple tree]
gb|ABS10822.1|  elongation factor 1-alpha                               288   1e-94    Phaseolus vulgaris [French bean]
gb|ABA12223.1|  translation elongation factor 1A-7                      297   1e-94    Gossypium hirsutum [American cotton]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             297   1e-94    Phaseolus vulgaris [French bean]
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94    Populus euphratica
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         295   1e-94    Jatropha curcas
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          297   1e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          297   1e-94    Cicer arietinum [garbanzo]
gb|KJB48747.1|  hypothetical protein B456_008G084000                    296   1e-94    Gossypium raimondii
emb|CAA65453.1|  elongation factor                                      290   1e-94    Narcissus pseudonarcissus
gb|KHG01531.1|  Elongation factor 1-alpha                               296   2e-94    Gossypium arboreum [tree cotton]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    296   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          296   2e-94    Phoenix dactylifera
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    296   2e-94    Populus euphratica
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          296   2e-94    Populus euphratica
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    296   2e-94    Populus euphratica
ref|NP_001290506.1|  elongation factor 1-alpha                          296   2e-94    Elaeis guineensis
gb|AAL69396.1|  elongation factor 1-alpha                               296   2e-94    Elaeis oleifera
dbj|BAH19898.1|  AT1G07930                                              296   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          296   2e-94    Elaeis guineensis
gb|AEI29162.1|  EF1a-like protein                                       295   2e-94    Phalaenopsis hybrid cultivar
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    296   2e-94    Daucus carota [carrots]
gb|ACS68200.1|  elongation factor 1 alpha                               296   2e-94    Brassica napus [oilseed rape]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    296   2e-94    Theobroma cacao [chocolate]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             296   2e-94    Prunus persica
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    296   2e-94    
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          296   2e-94    Amborella trichopoda
gb|ABA12224.1|  translation elongation factor 1A-8                      296   3e-94    Gossypium hirsutum [American cotton]
gb|ABD66072.1|  elongation factor 1-alpha                               289   3e-94    Phoenix dactylifera
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          296   3e-94    Elaeis guineensis
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        296   3e-94    Brassica rapa
gb|KGN51228.1|  Elongation factor 1-alpha                               294   3e-94    Cucumis sativus [cucumbers]
ref|NP_001105565.1|  elongation factor alpha5                           296   3e-94    
emb|CDY58828.1|  BnaAnng15460D                                          300   3e-94    Brassica napus [oilseed rape]
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          296   3e-94    Elaeis guineensis
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         296   3e-94    Jatropha curcas
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         292   3e-94    Medicago truncatula
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     296   3e-94    Glycine max [soybeans]
gb|KHG28979.1|  Elongation factor 1-alpha                               296   4e-94    Gossypium arboreum [tree cotton]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     295   4e-94    Glycine max [soybeans]
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    296   4e-94    
gb|ACI96243.1|  elongation factor 1-alpha                               295   4e-94    Prunus persica
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             295   4e-94    Citrus clementina [clementine]
ref|XP_002528028.1|  elongation factor 1-alpha, putative                295   4e-94    
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               295   4e-94    Prunus mume [ume]
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         295   4e-94    Jatropha curcas
ref|NP_001105935.1|  elongation factor alpha8                           295   4e-94    
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  295   4e-94    Solanum tuberosum [potatoes]
emb|CAJ38380.1|  translation elongation factor 1 alpha                  288   5e-94    Plantago major [cart-track plant]
gb|KHN14872.1|  Elongation factor 1-alpha                               295   5e-94    Glycine soja [wild soybean]
ref|WP_033581549.1|  elongation factor 1-alpha                          285   5e-94    
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       291   5e-94    Cucumis sativus [cucumbers]
gb|AAL32631.1|  putative elongation factor 1-a                          295   5e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       290   6e-94    Cucumis sativus [cucumbers]
gb|KHN42761.1|  Elongation factor 1-alpha                               295   6e-94    Glycine soja [wild soybean]
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       291   6e-94    Cucumis sativus [cucumbers]
gb|AFP44110.1|  elongation factor 1-alpha                               295   6e-94    Lycoris longituba
gb|ADW83729.1|  elongation factor 1-alpha                               286   7e-94    Musa acuminata AAA Group [Cavendish banana]
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        295   7e-94    Hevea brasiliensis [jebe]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               295   8e-94    Fragaria vesca subsp. vesca
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          295   8e-94    Fragaria vesca subsp. vesca
gb|AFJ04514.1|  elongation factor 1-alpha                               294   9e-94    Vernicia fordii [tung oil tree]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          295   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        295   1e-93    Bruguiera sexangula
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             294   1e-93    Prunus persica
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    294   1e-93    Vicia faba [broad bean]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   294   1e-93    Ornithogalum longebracteatum [sea-onion]
gb|KHG27341.1|  Elongation factor 1-alpha                               294   1e-93    Gossypium arboreum [tree cotton]
gb|AAX54511.1|  elongation factor 1 alpha                               294   1e-93    Actinidia deliciosa [Chinese gooseberry]
gb|KHG24249.1|  Elongation factor 1-alpha                               293   1e-93    Gossypium arboreum [tree cotton]
gb|AGI15328.1|  elongation factor 1                                     294   1e-93    Aegiceras corniculatum
ref|NP_001183947.1|  uncharacterized protein LOC100502553               293   1e-93    
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   294   1e-93    Lilium longiflorum [Easter lily]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          294   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        294   2e-93    Hevea brasiliensis [jebe]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          294   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               294   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN71914.1|  hypothetical protein VITISV_026485                     286   2e-93    Vitis vinifera
gb|ABA12222.1|  translation elongation factor 1A-6                      294   2e-93    Gossypium hirsutum [American cotton]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          294   2e-93    Pyrus x bretschneideri [bai li]
gb|AEQ75495.1|  elongation factor 1-alpha                               294   2e-93    Rosa multiflora [Japanese rose]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         294   2e-93    
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          293   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237425.1|  elongation factor-1A                               293   2e-93    
gb|AAY56337.1|  elongation factor-1 alpha                               293   2e-93    Musa acuminata [banana]
ref|XP_003604823.1|  Elongation factor 1-alpha                          293   2e-93    
ref|NP_001104938.1|  elongation factor 1 alpha                          293   3e-93    
ref|NP_001280807.1|  elongation factor 1-alpha-like                     293   3e-93    Malus domestica [apple tree]
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         294   3e-93    Medicago truncatula
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               293   3e-93    Cucumis melo [Oriental melon]
ref|XP_003588821.1|  Elongation factor 1-alpha                          293   3e-93    
gb|AHB86963.1|  elongation factor 1-alpha                               293   3e-93    Sedum alfredii
gb|AIM48895.1|  elongation factor 1-alpha                               293   3e-93    Cinnamomum camphora
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          293   3e-93    Sorghum bicolor [broomcorn]
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         293   4e-93    Medicago truncatula
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         293   4e-93    Medicago truncatula
ref|NP_001151074.1|  elongation factor 1-alpha                          293   4e-93    
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   293   4e-93    Lilium longiflorum [Easter lily]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    293   4e-93    Gossypium raimondii
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    293   4e-93    Populus euphratica
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          293   4e-93    
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    284   4e-93    
gb|ABF00115.1|  elongation factor 1-alpha                               293   4e-93    Litchi chinensis [litchi]
gb|AAF99703.1|  elongation factor                                       293   4e-93    Saccharum officinarum [noble cane]
gb|EPS66340.1|  elongation factor 1-alpha                               293   4e-93    Genlisea aurea
dbj|BAM13874.1|  elongation factor 1 alpha                              293   4e-93    Symplocarpus renifolius
gb|AAV92325.1|  translation elongation factor-1 alpha                   286   5e-93    Pseudotsuga menziesii var. menziesii
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          293   5e-93    Malus domestica [apple tree]
gb|AGC94754.1|  elongation factor 1 alpha                               293   5e-93    Euphorbia lathyris
ref|XP_002312029.1|  ADR12-2 family protein                             293   5e-93    Populus trichocarpa [western balsam poplar]
ref|XP_002311107.1|  ADR12-2 family protein                             293   5e-93    Populus trichocarpa [western balsam poplar]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    293   5e-93    Glycine max [soybeans]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             293   6e-93    Phaseolus vulgaris [French bean]
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          292   6e-93    Cicer arietinum [garbanzo]
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               292   7e-93    Brachypodium distachyon [annual false brome]
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               292   7e-93    Cucumis melo [Oriental melon]
gb|AGV54713.1|  elongation factor 1-alpha                               292   8e-93    Phaseolus vulgaris [French bean]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          292   9e-93    Amborella trichopoda
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    292   9e-93    Manihot esculenta [manioc]
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          292   9e-93    
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    292   9e-93    
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               292   1e-92    
dbj|BAM13877.1|  elongation factor 1 alpha                              291   1e-92    
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    291   1e-92    
ref|XP_002311106.1|  ADR12-2 family protein                             291   1e-92    
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          291   2e-92    
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          291   2e-92    
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               291   2e-92    
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               291   2e-92    
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             291   2e-92    
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    295   2e-92    
gb|EPS66069.1|  elongation factor 1-alpha                               291   2e-92    
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               291   3e-92    
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         290   3e-92    
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        290   4e-92    
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             290   4e-92    
gb|KJB76560.1|  hypothetical protein B456_012G094600                    290   5e-92    
ref|XP_003591959.1|  Elongation factor 1-alpha                          293   5e-92    
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          290   5e-92    
gb|ABD66517.1|  EF-1 alpha                                              290   6e-92    
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               290   6e-92    
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    290   6e-92    
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             290   8e-92    
ref|XP_009773066.1|  PREDICTED: elongation factor 1-alpha               279   8e-92    
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          290   8e-92    
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             290   9e-92    
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        289   1e-91    
gb|ADK73624.1|  elongation factor 1 alpha                               284   1e-91    
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        289   1e-91    
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             285   1e-91    
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          289   2e-91    
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          289   2e-91    
ref|NP_001104939.1|  elongation factor alpha6                           289   2e-91    
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                289   2e-91    
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             289   2e-91    
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          288   2e-91    
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             288   2e-91    
gb|AGD99674.1|  eukaryotic elongation factor 1A                         288   2e-91    
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    288   2e-91    
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             287   2e-91    
ref|NP_001105934.1|  elongation factor alpha7                           288   3e-91    
gb|ABR16818.1|  unknown                                                 278   4e-91    
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          287   6e-91    
ref|XP_002892424.1|  T6D22.2                                            299   8e-91    
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               286   1e-90    
gb|AAF79822.1|AC026875_2  T6D22.2                                       298   2e-90    
ref|XP_003604587.1|  Elongation factor 1-alpha                          286   2e-90    
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    298   2e-90    
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             286   3e-90    
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             285   3e-90    
ref|XP_001763198.1|  predicted protein                                  282   5e-90    
emb|CAC27139.1|  translation elongation factor-1 alpha                  285   5e-90    
gb|ACN41180.1|  unknown                                                 285   8e-90    
gb|ABK25072.1|  unknown                                                 285   8e-90    
gb|ACN40081.1|  unknown                                                 284   9e-90    
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    284   1e-89    
gb|EMS52529.1|  Elongation factor 1-alpha                               284   1e-89    
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             284   1e-89    
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             284   1e-89    
gb|EMS59091.1|  Elongation factor 1-alpha                               285   2e-89    
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                283   2e-89    
gb|ABK24265.1|  unknown                                                 283   4e-89    
gb|AGI78242.1|  elongation factor 1 alpha                               283   4e-89    
gb|AIZ74328.1|  translation elongation factor 1-alpha                   283   4e-89    
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 283   4e-89    
ref|XP_001766482.1|  predicted protein                                  282   6e-89    
gb|AHA84124.1|  elongation factor 1-alpha                               282   8e-89    
gb|KHG15275.1|  Elongation factor 1-alpha                               281   1e-88    
gb|AGO97079.1|  elongation factor 1-alpha                               273   1e-88    
gb|ABK24843.1|  unknown                                                 281   1e-88    
ref|XP_001763201.1|  predicted protein                                  281   2e-88    
ref|XP_001763194.1|  predicted protein                                  281   2e-88    
ref|XP_001753167.1|  predicted protein                                  281   2e-88    
gb|EMS49772.1|  Elongation factor 1-alpha                               281   2e-88    
ref|XP_001753181.1|  predicted protein                                  281   2e-88    
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    281   2e-88    
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    281   2e-88    
gb|AER42621.1|  elongation factor 1 alpha                               281   3e-88    
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 280   3e-88    
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    293   3e-88    
gb|EMT12343.1|  Elongation factor 1-alpha                               280   5e-88    
gb|AGO97080.1|  elongation factor 1-alpha                               270   1e-87    
gb|EMS65134.1|  Elongation factor 1-alpha                               284   1e-87    
ref|XP_003618775.1|  Elongation factor 1-alpha                          291   2e-87    
gb|ACN40740.1|  unknown                                                 278   2e-87    
gb|AAR82894.1|  elongation factor 1-alpha                               278   3e-87    
gb|EMT09703.1|  Elongation factor 1-alpha                               285   7e-87    
gb|AEE98364.1|  elongation factor 1-alpha                               276   1e-86    
gb|AGO97078.1|  elongation factor 1-alpha                               267   2e-86    
gb|AHZ58493.1|  translation elongation factor alpha                     276   2e-86    
ref|XP_001753059.1|  predicted protein                                  275   4e-86    
gb|ABR17675.1|  unknown                                                 275   4e-86    
ref|XP_010458012.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    263   2e-85    
gb|ABQ81936.1|  elongation factor 1-alpha                               272   3e-85    
dbj|BAK08744.1|  elongation factor 1-alpha                              272   4e-85    
dbj|BAK08818.1|  elongation factor 1-alpha                              272   5e-85    
gb|ABQ81942.1|  elongation factor 1-alpha                               263   1e-84    
dbj|BAD95246.1|  translation elongation factor eEF-1 alpha chain        260   2e-84    
gb|AAC06383.1|  elongation factor 1 alpha                               260   3e-84    
dbj|BAK08819.1|  elongation factor 1-alpha                              270   3e-84    
gb|AFN42763.1|  elongation factor 1-alpha                               263   5e-84    
gb|KJB30602.1|  hypothetical protein B456_005G151200                    261   7e-83    
gb|AAO61852.1|  translation elongation factor-1 alpha                   264   1e-82    
dbj|BAH23674.1|  elongation factor 1-alpha                              253   5e-81    
gb|ABL10112.1|  translation elongation factor 1-alpha                   251   1e-80    
gb|AHZ44777.1|  elongation factor 1 alpha                               248   3e-80    
gb|ACO50109.1|  elongation factor 1 alpha                               251   6e-79    
ref|XP_009387472.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    247   6e-79    
gb|ACT36602.1|  elongation factor 1 alpha                               254   7e-79    
gb|AAV34150.1|  EF-1 alpha                                              248   2e-78    
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     254   4e-78    
dbj|BAL41369.1|  elongation factor 1-alpha                              243   9e-78    
gb|AAP80665.1|AF479046_1  elongation factor-1 alpha                     243   1e-77    
gb|ACO50110.1|  elongation factor 1 alpha                               253   1e-77    
gb|ACL97363.1|  elongation factor-1 alpha                               251   3e-77    
ref|XP_005650451.1|  translation elongation factor                      251   1e-76    
gb|ACL97366.1|  elongation factor-1 alpha                               249   3e-76    
gb|AIM46989.1|  translation elongation factor 1-alpha                   249   3e-76    
emb|CAA09041.1|  elongation factor 1-alpha                              239   4e-76    
gb|ABQ81935.1|  elongation factor 1-alpha                               248   5e-76    
gb|AEK26871.1|  elongation factor 1-alpha                               239   5e-76    
emb|CDP93913.1|  Protein Bm5195, isoform h                              240   5e-76    
emb|CEI96289.1|  Putative Elongation factor 1-alpha                     239   6e-76    
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     248   1e-75    
gb|ACO50115.1|  elongation factor 1 alpha                               247   2e-75    
gb|ABE01407.1|  translation elongation factor 1a-1                      236   3e-75    
gb|EPR59445.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         240   4e-75    
gb|AFB18314.1|  translation elongation factor-1 alpha                   244   6e-75    
gb|EDL77720.1|  rCG25445, isoform CRA_b                                 237   7e-75    
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    246   7e-75    
gb|AGW80518.1|  elongation factor 1-alpha 1                             237   7e-75    
emb|CAA40028.1|  42Sp48                                                 242   9e-75    
gb|KFG40151.1|  elongation factor 1-alpha                               240   9e-75    
gb|ABE01408.1|  translation elongation factor 1a-2                      234   9e-75    
gb|ACF70735.1|  eukaryotic translation elongation factor 1              237   1e-74    
gb|EKG07919.1|  elongation factor 1-alpha (ef-1-alpha), putative        237   1e-74    
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   245   1e-74    
gb|ADB55729.1|  elongation factor 1-alpha                               246   1e-74    
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   245   1e-74    
gb|EPY33803.1|  elongation factor 1-alpha                               241   1e-74    
emb|CCW70819.1|  unnamed protein product                                239   1e-74    
gb|AJP77649.1|  elongation factor 1-alpha                               239   1e-74    
gb|KHN88882.1|  Elongation factor 1-alpha                               245   2e-74    
gb|EPY25861.1|  elongation factor 1-alpha                               242   2e-74    
gb|AEG78376.1|  elongation factor 1 alpha                               238   2e-74    
ref|XP_005941015.1|  PREDICTED: elongation factor 1-alpha-like          239   2e-74    
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             245   2e-74    
emb|CDH51884.1|  elongation factor 1-alpha                              239   2e-74    
gb|ABB46371.1|  elongation factor-1 alpha                               236   2e-74    
gb|EPR56707.1|  elongation factor 1-alpha                               239   2e-74    
gb|ACL97367.1|  elongation factor-1 alpha                               244   3e-74    
gb|KJB73628.1|  hypothetical protein B456_011G2414001                   234   3e-74    
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  244   3e-74    
gb|AJF94634.1|  elongation factor 1-alpha                               233   3e-74    
gb|EJW73271.1|  elongation factor 1-alpha                               239   3e-74    
gb|EDL26404.1|  mCG15232, isoform CRA_e                                 237   3e-74    
emb|CBY16376.1|  unnamed protein product                                237   4e-74    
gb|EPR57682.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         240   4e-74    
gb|AAZ81003.1|  eukaryotic translation elongation factor 1 alpha 1      234   4e-74    
ref|XP_004622541.1|  PREDICTED: elongation factor 1-alpha-like          241   4e-74    
gb|EJW86012.1|  translation elongation factor EF-1                      243   4e-74    
tpg|DAA05869.1|  TPA: eukaryotic translation elongation factor 1A       244   4e-74    
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  244   5e-74    
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        244   5e-74    
gb|EKF27061.1|  elongation factor 1-alpha (ef-1-alpha), putative        235   5e-74    
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             244   5e-74    
dbj|GAK62779.1|  elongation factor 1-alpha                              234   5e-74    
ref|XP_007762783.1|  translation elongation factor 1a                   244   5e-74    
gb|EWC64676.1|  hypothetical protein W893_14860                         234   6e-74    
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       243   6e-74    
ref|NP_001079602.1|  elongation factor 1-alpha, oocyte form             244   6e-74    
ref|XP_002392294.1|  hypothetical protein MPER_08150                    239   7e-74    
gb|KDQ63704.1|  hypothetical protein JAAARDRAFT_29726                   244   7e-74    
gb|ABR13275.1|  putative elongation factor-1 alpha 3                    234   7e-74    
emb|CAB59358.1|  translation elongation factor eEF-1 alpha chain        243   9e-74    
ref|XP_011069517.1|  PREDICTED: elongation factor 1-alpha               232   9e-74    
gb|ADK90073.1|  elongation factor 1 alpha                               243   9e-74    
gb|ELK00148.1|  Elongation factor 1-alpha 1                             237   9e-74    
emb|CDQ04680.1|  Protein Bm5196, isoform a                              242   9e-74    
ref|XP_003873869.1|  elongation factor 1-alpha                          235   9e-74    
gb|AAH65761.1|  EEF1A1 protein                                          236   1e-73    
gb|AAH14892.1|  Unknown (protein for IMAGE:3909122)                     236   1e-73    
gb|KIJ21706.1|  hypothetical protein PAXINDRAFT_65274                   243   1e-73    
dbj|BAH28836.1|  elongation factor 1-alpha                              243   1e-73    
ref|XP_003141904.1|  elongation factor 1-alpha                          242   1e-73    
ref|XP_001893409.1|  elongation factor 1-alpha                          243   1e-73    
gb|ADO51768.1|  elongation factor 1-alpha                               243   1e-73    
gb|ACN60128.1|  translation elongation factor 1-alpha                   233   1e-73    
ref|XP_003037261.1|  translation elongation factor 1a                   243   1e-73    
sp|O42820.1|EF1A_SCHCO  RecName: Full=Elongation factor 1-alpha; ...    243   1e-73    
ref|XP_003380597.1|  elongation factor 1-alpha                          244   1e-73    
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    238   1e-73    
gb|ETI46853.1|  elongation factor 1-alpha 1                             233   2e-73    
dbj|BAN14716.1|  elongation factor 1-alpha                              234   2e-73    
ref|XP_007861104.1|  translation elongation factor 1a                   243   2e-73    
ref|NP_989301.1|  eukaryotic translation elongation factor 1 alph...    243   2e-73    
emb|CCI49302.1|  unnamed protein product                                242   2e-73    
gb|EPY27955.1|  elongation factor 1-alpha                               242   2e-73    
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    239   2e-73    
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             242   2e-73    
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  242   2e-73    
sp|P27592.1|EF1A_ONCVO  RecName: Full=Elongation factor 1-alpha; ...    243   2e-73    
ref|NP_001081521.1|  elongation factor 1-alpha, oocyte form             242   2e-73    
emb|CDQ71533.1|  unnamed protein product                                236   2e-73    
gb|KIK71054.1|  hypothetical protein GYMLUDRAFT_33174                   242   3e-73    
emb|CCA22726.1|  PREDICTED: hypothetical protein                        242   3e-73    
gb|AAD03711.1|  elongation translation factor 1 alpha                   242   3e-73    
gb|KDQ12968.1|  hypothetical protein BOTBODRAFT_34109                   242   3e-73    
ref|XP_007246777.1|  PREDICTED: elongation factor 1-alpha 1-like        242   3e-73    
emb|CCU97773.1|  unnamed protein product                                242   4e-73    
ref|XP_005993968.1|  PREDICTED: elongation factor 1-alpha, oocyte...    242   4e-73    
ref|XP_007359855.1|  translation elongation factor 1a                   242   4e-73    
ref|XP_007298247.1|  translation elongation factor                      241   4e-73    
emb|CCO27325.1|  elongation factor EF-1 alpha subunit                   239   4e-73    
gb|AAH63511.1|  EEF1A1 protein                                          236   4e-73    
gb|KIK28513.1|  hypothetical protein PISMIDRAFT_673531                  241   5e-73    
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  241   5e-73    
ref|XP_006454380.1|  hypothetical protein AGABI2DRAFT_133083            241   5e-73    
emb|CBQ70305.1|  probable translation elongation factor eEF-1 alp...    241   5e-73    
gb|KIL70783.1|  hypothetical protein M378DRAFT_116001                   241   5e-73    



>gb|AAR83865.1| elongation factor 1-alpha [Capsicum annuum]
Length=167

 Score =   306 bits (785),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  4    EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  63

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  64   YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  123

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  124  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  155



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   303 bits (776),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  22   EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  81

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  82   YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  141

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  142  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  173



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAH20400.1| AT1G07940 [Arabidopsis thaliana]
Length=186

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  22   ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  81

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  82   YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  141

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  142  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  173



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  24   ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  83

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  84   YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  143

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  144  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  175



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  24   EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  83

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  84   YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  143

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  144  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  175



>gb|ABW74483.1| elongation factor [Paeonia suffruticosa]
Length=186

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  22   ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  81

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  82   YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  141

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMR+TVAVGVIK+VDKKDPTG
Sbjct  142  EYPPLGRFAVRDMRRTVAVGVIKSVDKKDPTG  173



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNG
Sbjct  31   EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNG  90

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  91   YAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  150

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  151  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  182



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  131  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  190

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  191  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  250

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  251  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  124  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  183

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  184  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  243

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  244  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  275



>dbj|BAF75826.1| hypothetical protein [Malus domestica]
Length=184

 Score =   296 bits (759),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVA KDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  22   EALQEALPGDNVGFNVKNVAAKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  81

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  82   YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  141

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  142  EYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  173



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAF75825.1| hypothetical protein [Malus domestica]
Length=184

 Score =   296 bits (758),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK  A+FTSQVIIMNHPGQIGNG
Sbjct  22   EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKETANFTSQVIIMNHPGQIGNG  81

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFS
Sbjct  82   YAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFS  141

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  142  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  173



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   302 bits (773),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  184  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  243

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  244  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  303

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  304  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  335



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   305 bits (781),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPSG  436



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   305 bits (781),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   296 bits (759),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  39   EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  98

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPT+PMVVETFS
Sbjct  99   YAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTRPMVVETFS  158

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  159  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  190



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   301 bits (771),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  172  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  231

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFA +LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  232  YAPVLDCHTSHIAVKFAXILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFS  291

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  292  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  323



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   305 bits (781),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  286  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  345

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  346  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  405

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  406  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  437



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  287  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  346

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  347  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  406

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  407  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  438



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  37   EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  96

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  97   YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  156

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  157  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  188



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  237  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  296

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  297  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  356

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  357  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   296 bits (757),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  85   EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  144

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  145  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  204

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  205  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  236



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  237  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  296

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  297  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  356

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  357  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNVDKK+P+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVDKKEPSG  436



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   301 bits (770),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  237  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  296

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  297  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  356

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  357  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  131  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  190

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  191  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  250

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  251  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  131  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  190

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  191  YAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  250

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  251  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  109  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  168

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  169  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  228

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK V+KKD +G
Sbjct  229  EYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  260



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  161  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  220

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  221  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  280

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  281  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  312



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  138  EALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  197

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  198  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  257

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  258  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  289



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  131  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  190

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  191  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  250

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  251  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  279  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  338

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  339  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  398

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  399  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  430



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIG G
Sbjct  39   EAMLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGQG  98

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  99   YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  158

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  159  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  190



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  77   EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  136

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS
Sbjct  137  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFS  196

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  197  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  228



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  180  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  239

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  240  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  299

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  300  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  331



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   297 bits (760),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  160  EALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  219

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  220  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  279

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  280  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  311



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   296 bits (757),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  131  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  190

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  191  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  250

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  251  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFQELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  74   EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  133

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  134  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  193

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  194  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  225



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E  QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  204  ETLQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  263

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  264  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  323

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  324  EYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  355



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKD +G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDASG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKD+KRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDIKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPM+VETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMLVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELE+EPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEREPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   300 bits (768),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   300 bits (768),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = -3

Query  741  QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAP  562
            +EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAP
Sbjct  268  KEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAP  327

Query  561  VLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYP  382
            VLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYP
Sbjct  328  VLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYP  387

Query  381  PLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            PLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  388  PLGRFAVRDMRQTVAVGVIKNVEKKDPTG  416



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   293 bits (749),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  77   EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  136

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM+PT+PMVVETFS
Sbjct  137  YAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTRPMVVETFS  196

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  197  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  228



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E  QEALPGDNVGFNVKNVAVKDLKRGYVASNSK+DPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  ETLQEALPGDNVGFNVKNVAVKDLKRGYVASNSKEDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   296 bits (757),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  164  EALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  223

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS
Sbjct  224  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFS  283

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  284  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  315



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKD+KRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALSEALPGDNVGFNVKNVAVKDIKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMMPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  172  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  231

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  232  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  291

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  292  QYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  323



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  263  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  322

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  323  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  382

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+ QEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGNG
Sbjct  285  ESLQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsicum annuum]
Length=447

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  284  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  343

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDR SGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  344  YAPVLDCHTSHIAVKFGEILTKIDRWSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  403

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            E PPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  404  ENPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  435



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  264  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  323

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  324  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  383

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  384  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  415



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+ QEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGNG
Sbjct  285  ESLQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKD+KRGYVASNS DDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDIKRGYVASNSXDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AASF SQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAASFASQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  182  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  241

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  242  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  301

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  302  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  333



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+P+KPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPSKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  184  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  243

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  244  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  303

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  304  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  335



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVAS SKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  296  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  355

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  356  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  415

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  416  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  447



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  DYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   299 bits (765),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  306  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  365

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  366  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  425

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  426  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  457



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   297 bits (761),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   297 bits (761),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   297 bits (761),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   296 bits (757),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FTSQVIIMNHPGQIGNG
Sbjct  237  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVIIMNHPGQIGNG  296

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  297  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  356

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  357  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAATFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   288 bits (738),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  49   EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  108

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  109  YAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFS  168

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDP  301
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct  169  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDP  198



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQ IIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQGIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  176  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  235

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  236  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  295

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  298
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKD +
Sbjct  296  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDAS  326



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  237  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  296

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  297  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  356

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  357  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FTSQVIIMNHPGQIGNG
Sbjct  264  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVIIMNHPGQIGNG  323

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  324  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  383

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  384  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  415



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNG
Sbjct  80   ESLLEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNG  139

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAV+FAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  140  YAPVLDCHTSHIAVRFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  199

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPP+GRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  200  EYPPMGRFAVRDMRQTVAVGVIKSVEKKDPTG  231



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG++KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGLIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKN AVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNFAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+F +QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMV M PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVMMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELL+KIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELLSKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  236  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  295

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+
Sbjct  296  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFA  355

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  356  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  387



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVR MRQTVAVGVIK V+KKDPTG
Sbjct  405  EYPPLGRFAVRVMRQTVAVGVIKAVEKKDPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASN KDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNPKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHT HIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTCHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABD66072.1| elongation factor 1-alpha [Phoenix dactylifera]
Length=245

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  96   EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  155

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LT+IDRRSGKELEKEPKFLK+GDAG VKM+PTKPMVVETFS
Sbjct  156  YAPVLDCHTSHIAVKFAEILTEIDRRSGKELEKEPKFLKSGDAGFVKMIPTKPMVVETFS  215

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDP  301
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct  216  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDP  245



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK A SFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAGSFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKK PTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVDKKHPTG  436



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIM HPGQIGNG
Sbjct  238  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMKHPGQIGNG  297

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  298  YAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  357

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  358  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  389



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDL RG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLNRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAV DMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVLDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  263  ESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  322

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  323  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  382

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  EYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  184  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  243

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFS
Sbjct  244  YAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFS  303

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  304  EYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  335



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVK +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKVSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+ QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  DYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001105935.1| elongation factor alpha8 [Zea mays]
 gb|AAF42982.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLK+GDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKDGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             +PPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AFPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDC  SHIAVKFAE+LTKIDRRSGKELEKE KFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCTLSHIAVKFAEILTKIDRRSGKELEKEAKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   288 bits (738),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIG G
Sbjct  85   ESMPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGQG  144

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  145  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFA  204

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  205  EYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  236



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|WP_033581549.1| elongation factor 1-alpha, partial [Dickeya zeae]
Length=147

 Score =   285 bits (728),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = -3

Query  738  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPV  559
            EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPV
Sbjct  3    EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPV  62

Query  558  LDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPP  379
            LDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPP
Sbjct  63   LDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPP  122

Query  378  LGRFAVRDMRQTVAVGVIKNVDKKD  304
            LGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  123  LGRFAVRDMRQTVAVGVIKSVEKKD  147



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   291 bits (745),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  168  ESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  227

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRS KELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  228  YAPVLDCHTSHIAVKFAEILTKIDRRSAKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  287

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  288  TYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  319



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTV V VIK+VDKKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVTVSVIKSVDKKDPTG  436



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   290 bits (742),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EA+PGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNG
Sbjct  131  ESLPEAVPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNG  190

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  191  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  250

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  251  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN51227.1| hypothetical protein Csa_5G495940 [Cucumis sativus]
Length=344

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  180  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  239

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  240  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  299

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK V+KKD +G
Sbjct  300  AYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  331



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+P+KPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMVPSKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADW83729.1| elongation factor 1-alpha [Musa acuminata AAA Group]
Length=191

 Score =   286 bits (732),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNV VKDLKRGYVASNSK DP K AASFTSQVIIMNHPGQIG G
Sbjct  29   EALQEALPGDNVGFNVKNVDVKDLKRGYVASNSKADPTKEAASFTSQVIIMNHPGQIGIG  88

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCH SHIAVKFAELLTKIDRRSGK LEKEPKFLKNGDAG VKM+P+KPMVVETFS
Sbjct  89   YAPVLDCHASHIAVKFAELLTKIDRRSGKALEKEPKFLKNGDAGFVKMIPSKPMVVETFS  148

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  149  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  180



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   295 bits (755),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  TYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  436



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGD+GMVKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  284  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  343

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  344  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  403

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  435



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEA PGDNVGFNVKNVAVKDLKRG+VASNSK+DP K AASFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKEDPTKEAASFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAK A+SFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKEASSFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+ QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG G
Sbjct  285  ESLQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEMLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALLEASPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  237  ESLPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  296

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  297  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  356

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  357  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK A+SFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEASSFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMNPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|NP_001183947.1| uncharacterized protein LOC100502553 [Zea mays]
 gb|ACF84684.1| unknown [Zea mays]
Length=399

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E  QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT+QVIIMNHPGQIGNG
Sbjct  237  ETMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTAQVIIMNHPGQIGNG  296

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE  PKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  297  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELESAPKFLKNGDAGFVKMIPTKPMVVETFS  356

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  357  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALVEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KK+PTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKEPTG  436



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  TYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  GYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  GYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNSK+DPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKEDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            +YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  QYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  E LPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNG
Sbjct  64   ESLVEGLPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNG  123

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+ TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  124  YAPVLDCHTSHIAVKFAEITTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  183

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  184  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  215



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLPEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG G
Sbjct  285  EAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE+EPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEREPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNG
Sbjct  285  ESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNG
Sbjct  285  ESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF+
Sbjct  345  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFA  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKGVEKKDPSG  436



>ref|NP_001104938.1| elongation factor 1 alpha [Zea mays]
 gb|AAF42978.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRG+VASNS+DDPAK A SFTSQVIIMNHPGQIGNG
Sbjct  285  EALQEALPGDNVGFNVKNVAVKDLKRGFVASNSRDDPAKEAGSFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLK GDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKYGDAGMVKMIPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  AYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+F +QVIIMNHPGQIG G
Sbjct  285  EAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGQG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  EYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AES59072.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=465

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            EA  EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  288  EALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  347

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFS
Sbjct  348  YAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFS  407

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
            EYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  408  EYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  439



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  750  EAXQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNG  571
            E+  EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNG
Sbjct  285  ESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNG  344

Query  570  YAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFS  391
            YAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS
Sbjct  345  YAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFS  404

Query  390  EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  295
             YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  405  SYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840