BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046I06

Length=840
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN33816.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    501   5e-176   Glycine soja [wild soybean]
emb|CBI18876.3|  unnamed protein product                                506   1e-174   Vitis vinifera
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    507   6e-173   Cucumis melo [Oriental melon]
emb|CAN74077.1|  hypothetical protein VITISV_000978                     504   2e-172   Vitis vinifera
gb|ACN35033.1|  unknown                                                 497   2e-172   Zea mays [maize]
ref|NP_001183829.1|  uncharacterized protein LOC100502422               497   2e-172   Zea mays [maize]
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    505   4e-172   Cicer arietinum [garbanzo]
ref|XP_006656509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    496   8e-172   Oryza brachyantha
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             504   1e-171   Phaseolus vulgaris [French bean]
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    503   2e-171   Vitis vinifera
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    503   3e-171   Glycine max [soybeans]
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    503   3e-171   Nelumbo nucifera [Indian lotus]
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...    501   5e-171   Setaria italica
gb|EEC81336.1|  hypothetical protein OsI_24516                          499   5e-171   Oryza sativa Indica Group [Indian rice]
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         503   5e-171   Jatropha curcas
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    502   7e-171   Cucumis sativus [cucumbers]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    501   1e-170   
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    501   1e-170   Sesamum indicum [beniseed]
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    502   1e-170   Citrus sinensis [apfelsine]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             502   1e-170   Citrus clementina [clementine]
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    501   2e-170   Sesamum indicum [beniseed]
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    499   4e-170   
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    499   2e-169   Tarenaya hassleriana [spider flower]
ref|NP_001058625.1|  Os06g0725900                                       497   2e-169   
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          497   3e-169   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85305.1|  predicted protein                                      480   5e-169   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002301927.1|  Cell division protein ftsH                         497   6e-169   Populus trichocarpa [western balsam poplar]
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    497   7e-169   Eucalyptus grandis [rose gum]
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    496   1e-168   Solanum tuberosum [potatoes]
emb|CDP07308.1|  unnamed protein product                                496   1e-168   Coffea canephora [robusta coffee]
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    496   1e-168   Populus euphratica
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    495   2e-168   Populus euphratica
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    495   2e-168   Gossypium arboreum [tree cotton]
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       495   2e-168   
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            496   3e-168   Morus notabilis
ref|NP_001234196.1|  FtsH-like protein precursor                        495   3e-168   
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...    495   4e-168   Elaeis guineensis
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    494   5e-168   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...    494   1e-167   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    493   2e-167   Nicotiana sylvestris
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    493   3e-167   Nicotiana tomentosiformis
emb|CDX96068.1|  BnaA07g26630D                                          491   3e-167   
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760          493   3e-167   Amborella trichopoda
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    493   3e-167   Brassica rapa
emb|CDY01840.1|  BnaC06g28800D                                          492   3e-167   
gb|EMS62975.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    485   4e-167   Triticum urartu
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             492   6e-167   Arabidopsis lyrata subsp. lyrata
ref|XP_002306970.2|  Cell division protein ftsH                         491   8e-167   Populus trichocarpa [western balsam poplar]
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             491   1e-166   Eutrema salsugineum [saltwater cress]
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             491   2e-166   Capsella rubella
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    490   4e-166   Prunus mume [ume]
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             490   4e-166   Prunus persica
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    490   4e-166   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    490   4e-166   Camelina sativa [gold-of-pleasure]
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    490   6e-166   Camelina sativa [gold-of-pleasure]
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             489   9e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    488   3e-165   Phoenix dactylifera
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...    487   3e-165   Brachypodium distachyon [annual false brome]
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    484   5e-164   Genlisea aurea
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    484   5e-164   Nicotiana tomentosiformis
gb|EMT09942.1|  Cell division protease ftsH-like protein, chlorop...    483   5e-164   
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    484   1e-163   Nicotiana sylvestris
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    483   2e-163   Fragaria vesca subsp. vesca
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    482   5e-163   
gb|KJB14315.1|  hypothetical protein B456_002G118800                    481   7e-163   Gossypium raimondii
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    481   9e-163   Gossypium arboreum [tree cotton]
emb|CAA68141.1|  chloroplast FtsH protease                              481   1e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    479   5e-162   Pyrus x bretschneideri [bai li]
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    479   6e-162   Nicotiana tabacum [American tobacco]
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         478   2e-161   Medicago truncatula
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    478   4e-161   
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                471   6e-159   Erythranthe guttata [common monkey flower]
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    470   2e-158   Medicago sativa [alfalfa]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726             461   7e-156   
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    463   1e-155   Arabis alpina [alpine rockcress]
dbj|BAH20236.1|  AT5G42270                                              455   3e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             460   2e-154   Capsella rubella
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    459   3e-154   Camelina sativa [gold-of-pleasure]
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    459   3e-154   Camelina sativa [gold-of-pleasure]
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             459   4e-154   
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             459   5e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             458   7e-154   Eutrema salsugineum [saltwater cress]
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    458   9e-154   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                     454   3e-152   Chrysanthemum x morifolium [florist's chrysanthemum]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    452   4e-152   Capsicum annuum
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    452   2e-151   Camelina sativa [gold-of-pleasure]
emb|CAA73318.1|  ATPase                                                 446   6e-150   Arabidopsis thaliana [mouse-ear cress]
gb|AIS72760.1|  ATP-dependent zinc metalloprotease chloroplastic-...    427   4e-148   Rhizophora apiculata
ref|XP_001760664.1|  predicted protein                                  438   8e-147   
ref|XP_001753657.1|  predicted protein                                  436   8e-146   
gb|KJB14314.1|  hypothetical protein B456_002G118800                    434   1e-144   Gossypium raimondii
ref|XP_002510649.1|  Cell division protease ftsH, putative              431   2e-143   
dbj|BAH20250.1|  AT5G42270                                              369   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005650371.1|  membrane AAA-metalloprotease                       384   1e-124   Coccomyxa subellipsoidea C-169
gb|KJB57987.1|  hypothetical protein B456_009G188700                    379   5e-123   Gossypium raimondii
gb|KIY93255.1|  cell division protease FtsH                             374   5e-123   Monoraphidium neglectum
gb|KIZ03250.1|  cell division protease FtsH                             376   1e-121   Monoraphidium neglectum
ref|XP_001690889.1|  membrane AAA-metalloprotease                       374   1e-120   Chlamydomonas reinhardtii
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122              373   1e-120   Volvox carteri f. nagariensis
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         364   8e-120   Medicago truncatula
ref|XP_007510744.1|  cell division protein FtsH2                        367   2e-118   Bathycoccus prasinos
ref|WP_029963924.1|  cell division protein FtsH                         349   6e-116   
ref|WP_025947145.1|  cell division protein FtsH                         349   7e-116   
ref|WP_006518079.1|  membrane protease FtsH catalytic subunit           356   3e-115   Leptolyngbya sp. PCC 7375
ref|WP_023072541.1|  membrane protease catalytic subunit                356   5e-115   Leptolyngbya sp. Heron Island J
ref|WP_025970576.1|  cell division protein FtsH                         347   2e-114   
ref|WP_025954333.1|  cell division protein FtsH                         347   8e-114   
ref|WP_025971093.1|  cell division protein FtsH                         347   2e-113   
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...    355   2e-113   Auxenochlorella protothecoides
ref|WP_044452063.1|  cell division protein FtsH                         345   2e-113   Mastigocladus laminosus
ref|XP_002505995.1|  hypothetical protein MICPUN_106506                 353   5e-113   Micromonas commoda
ref|XP_003057154.1|  predicted protein                                  353   1e-112   Micromonas pusilla CCMP1545
gb|ABX08179.1|  cell division protein FtsH2                             349   2e-112   Prochlorococcus marinus str. MIT 9211
ref|WP_041391000.1|  cell division protein FtsH                         349   2e-112   Prochlorococcus marinus
ref|WP_025958220.1|  cell division protein FtsH                         347   2e-112   
gb|KGF94553.1|  cell division protein FtsH2                             348   2e-112   Prochlorococcus marinus str. MIT 9201
ref|WP_032522853.1|  cell division protein FtsH                         348   3e-112   Prochlorococcus marinus
ref|WP_036973151.1|  cell division protein FtsH                         341   5e-112   Prochlorococcus sp. MIT 0703
ref|WP_025971671.1|  cell division protein FtsH                         348   5e-112   
gb|KGG03814.1|  Cell division protein FtsH                              347   6e-112   Prochlorococcus marinus str. MIT 9321
gb|KGG30054.1|  cell division protein FtsH2                             341   6e-112   Prochlorococcus sp. MIT 0703
ref|WP_025935637.1|  MULTISPECIES: cell division protein FtsH           348   6e-112   
ref|WP_035992112.1|  cell division protein FtsH                         348   7e-112   Leptolyngbya sp. KIOST-1
ref|WP_015191439.1|  ATP-dependent metalloprotease FtsH                 348   7e-112   Stanieria cyanosphaera
ref|WP_025969610.1|  cell division protein FtsH                         347   8e-112   
ref|WP_025944375.1|  cell division protein FtsH                         347   8e-112   
ref|WP_025900256.1|  MULTISPECIES: cell division protein FtsH           347   8e-112   
ref|WP_032519670.1|  cell division protein FtsH                         347   8e-112   Prochlorococcus marinus
ref|WP_025922112.1|  cell division protein FtsH                         347   8e-112   
ref|WP_025939914.1|  MULTISPECIES: cell division protein FtsH           347   9e-112   
ref|WP_025890345.1|  MULTISPECIES: cell division protein FtsH           347   1e-111   Prochlorococcus sp. HOT208_60m_808M21
ref|WP_025964562.1|  cell division protein FtsH                         347   1e-111   
ref|WP_025924120.1|  MULTISPECIES: cell division protein FtsH           347   1e-111   Prochlorococcus marinus
ref|WP_025967396.1|  cell division protein FtsH                         347   1e-111   
ref|WP_025980194.1|  cell division protein FtsH                         347   1e-111   
ref|WP_044106285.1|  cell division protein FtsH                         347   1e-111   cyanobacterium endosymbiont of Epithemia turgida
gb|KGG06312.1|  Cell division protein FtsH                              347   1e-111   Prochlorococcus marinus str. MIT 9322
ref|WP_032515715.1|  cell division protein FtsH                         347   1e-111   Prochlorococcus marinus
ref|WP_025951376.1|  cell division protein FtsH                         347   1e-111   
ref|WP_009455956.1|  MULTISPECIES: cell division protein FtsH           347   1e-111   Fischerella thermalis
ref|WP_017297226.1|  cell division protein FtsH                         347   1e-111   Nodosilinea nodulosa
gb|KGF88464.1|  cell division protein FtsH2                             346   1e-111   Prochlorococcus marinus str. GP2
ref|WP_025892538.1|  cell division protein FtsH                         347   1e-111   
ref|WP_032517345.1|  cell division protein FtsH                         347   1e-111   Prochlorococcus marinus
ref|WP_006911156.1|  cell division protein FtsH                         347   2e-111   Cyanobium sp. PCC 7001
ref|WP_002806664.1|  cell division protein FtsH                         346   3e-111   Prochlorococcus marinus
gb|AIQ94296.1|  Cell division protein FtsH                              346   3e-111   Prochlorococcus sp. MIT 0604
ref|WP_025937982.1|  cell division protein FtsH                         346   3e-111   
ref|WP_012593655.1|  MULTISPECIES: cell division protein FtsH           346   3e-111   Cyanothece
ref|WP_032523992.1|  cell division protein FtsH                         346   3e-111   Prochlorococcus marinus
ref|WP_025941250.1|  cell division protein FtsH                         346   3e-111   
ref|WP_025956453.1|  MULTISPECIES: cell division protein FtsH           346   3e-111   
ref|WP_011817719.1|  cell division protein FtsH                         346   3e-111   Prochlorococcus marinus
ref|WP_025971407.1|  cell division protein FtsH                         345   4e-111   
ref|WP_025925903.1|  cell division protein FtsH                         346   4e-111   
ref|WP_025914082.1|  cell division protein FtsH                         345   4e-111   
ref|WP_028953545.1|  cell division protein FtsH                         345   5e-111   Synechococcus sp. CC9616
ref|WP_025979191.1|  cell division protein FtsH                         345   5e-111   
ref|WP_025921388.1|  MULTISPECIES: cell division protein FtsH           345   5e-111   
ref|WP_025929709.1|  cell division protein FtsH                         345   5e-111   
ref|WP_025933036.1|  cell division protein FtsH                         345   5e-111   
ref|WP_012007029.1|  cell division protein FtsH                         345   5e-111   Prochlorococcus marinus
ref|WP_017320405.1|  cell division protein FtsH                         345   5e-111   cyanobacterium PCC 7702
ref|WP_025937318.1|  cell division protein FtsH                         345   5e-111   
ref|WP_025981174.1|  cell division protein FtsH                         345   5e-111   
ref|WP_025959316.1|  cell division protein FtsH                         345   5e-111   
ref|WP_025925013.1|  MULTISPECIES: cell division protein FtsH           345   5e-111   
ref|WP_042849723.1|  cell division protein FtsH                         345   5e-111   Prochlorococcus sp. MIT 0604
ref|WP_010871638.1|  cell division protein FtsH                         345   5e-111   Synechocystis
ref|WP_008275101.1|  cell division protein FtsH                         345   5e-111   Cyanothece sp. CCY0110
ref|WP_011862269.1|  cell division protein FtsH                         345   6e-111   Prochlorococcus marinus
ref|WP_025965256.1|  cell division protein FtsH                         345   6e-111   Prochlorococcus sp. HOT208_60m_805A16
ref|WP_002797753.1|  cell division protein FtsH                         345   7e-111   Microcystis aeruginosa
ref|WP_002784350.1|  Cell division protein FtsH; ATP-dependent zi...    345   7e-111   Microcystis aeruginosa
dbj|GAL91410.1|  cell division protein FtsH                             345   8e-111   Microcystis aeruginosa NIES-44
ref|WP_017312914.1|  cell division protein FtsH                         345   8e-111   Fischerella sp. PCC 9339
ref|WP_011375794.1|  cell division protein FtsH                         345   8e-111   Prochlorococcus marinus
ref|WP_002763074.1|  MULTISPECIES: cell division protein FtsH           345   8e-111   Microcystis
ref|WP_032514590.1|  cell division protein FtsH                         345   1e-110   Prochlorococcus marinus
ref|WP_016862523.1|  cell division protein FtsH                         345   1e-110   Fischerella muscicola
ref|WP_002771354.1|  cell division protein FtsH                         344   1e-110   Microcystis aeruginosa
ref|WP_002793446.1|  cell division protein FtsH                         344   1e-110   Microcystis aeruginosa
ref|WP_002742170.1|  cell division protein FtsH                         344   1e-110   Microcystis
ref|WP_026723275.1|  cell division protein FtsH                         344   1e-110   Hapalosiphonaceae
ref|WP_002737367.1|  ATP-dependent zinc metalloprotease FtsH 3          344   2e-110   Microcystis aeruginosa
ref|WP_002801795.1|  cell division protein FtsH                         344   2e-110   Microcystis aeruginosa
ref|WP_012264056.1|  cell division protein FtsH                         344   2e-110   Microcystis aeruginosa
ref|WP_016867387.1|  cell division protein FtsH                         344   2e-110   Fischerella muscicola
ref|WP_038542994.1|  cell division protein FtsH                         343   3e-110   Synechococcus sp. KORDI-100
ref|WP_009545257.1|  MULTISPECIES: cell division protein FtsH           343   3e-110   Cyanothece
ref|WP_015220601.1|  membrane protease FtsH catalytic subunit           343   3e-110   Cyanobacterium aponinum
ref|WP_015188582.1|  membrane protease FtsH catalytic subunit           343   3e-110   Cyanobacteria [blue-green bacteria]
ref|WP_025929131.1|  hypothetical protein                               330   4e-110   
ref|WP_036901462.1|  cell division protein FtsH                         343   4e-110   Prochlorococcus sp. MIT 0601
ref|WP_017293936.1|  cell division protein FtsH                         343   4e-110   Geminocystis herdmanii
ref|WP_016876546.1|  cell division protein FtsH                         343   5e-110   Chlorogloeopsis fritschii
ref|WP_007100703.1|  cell division protein FtsH                         343   5e-110   Synechococcus sp. RS9917
ref|WP_011932280.1|  cell division protein FtsH                         343   6e-110   Synechococcus sp. WH 7803
ref|WP_028949001.1|  cell division protein FtsH                         343   6e-110   Synechocystis sp. PCC 6714
ref|WP_025922823.1|  cell division protein FtsH                         343   6e-110   
ref|WP_006042287.1|  cell division protein FtsH                         342   7e-110   Synechococcus sp. WH 7805
ref|WP_032527521.1|  cell division protein FtsH                         342   7e-110   Prochlorococcus marinus
ref|WP_006511599.1|  ATP-dependent metalloprotease FtsH                 342   1e-109   Xenococcus sp. PCC 7305
ref|WP_011055986.1|  cell division protein FtsH                         342   1e-109   Thermosynechococcus
ref|WP_024125602.1|  ATP-dependent metalloprotease FtsH3                342   1e-109   Thermosynechococcus sp. NK55a
ref|WP_019478058.1|  cell division protein FtsH                         342   1e-109   
ref|WP_011826974.1|  cell division protein FtsH                         342   1e-109   Prochlorococcus sp. MIT 1306
ref|WP_036922150.1|  cell division protein FtsH                         342   2e-109   
ref|WP_019477234.1|  cell division protein FtsH                         342   2e-109   
ref|WP_036913475.1|  MULTISPECIES: cell division protein FtsH           342   2e-109   Prochlorococcus
ref|WP_026730933.1|  cell division protein FtsH                         341   2e-109   Fischerella sp. PCC 9605
ref|WP_006102026.1|  cell division protein FtsH                         341   2e-109   Coleofasciculus chthonoplastes
ref|WP_039726378.1|  MULTISPECIES: cell division protein FtsH           341   2e-109   Lyngbya confervoides
ref|WP_006453661.1|  cell division protein FtsH                         341   2e-109   Synechococcus sp. PCC 7335
ref|WP_009556886.1|  ATP-dependent metalloprotease FtsH                 341   3e-109   Oscillatoriales cyanobacterium JSC-12
ref|WP_013320241.1|  cell division protein FtsH                         341   3e-109   Cyanothece sp. PCC 7822
ref|WP_039716361.1|  cell division protein FtsH                         341   3e-109   
ref|WP_015109466.1|  ATP-dependent metalloprotease FtsH                 341   3e-109   Cyanobacteria [blue-green bacteria]
ref|WP_012305681.1|  MULTISPECIES: cell division protein FtsH           341   3e-109   Synechococcus
ref|WP_011936606.1|  cell division protein FtsH                         341   3e-109   
ref|WP_017303138.1|  cell division protein FtsH                         340   4e-109   Spirulina subsalsa
ref|WP_027255466.1|  cell division protein FtsH                         340   4e-109   Planktothrix agardhii
ref|WP_035832496.1|  cell division protein FtsH                         340   4e-109   
ref|WP_015156116.1|  membrane protease FtsH catalytic subunit           340   4e-109   Cyanobacteria [blue-green bacteria]
ref|WP_026794256.1|  MULTISPECIES: cell division protein FtsH           340   5e-109   Planktothrix
ref|WP_015224048.1|  membrane protease FtsH catalytic subunit           340   5e-109   
gb|KIE06858.1|  cell division protein FtsH                              340   5e-109   Tolypothrix bouteillei VB521301
ref|WP_042152619.1|  cell division protein FtsH                         340   6e-109   Planktothrix agardhii
ref|WP_019476442.1|  cell division protein FtsH                         340   6e-109   
ref|WP_019474071.1|  MULTISPECIES: cell division protein FtsH           340   6e-109   
ref|WP_027249137.1|  cell division protein FtsH                         340   6e-109   Planktothrix agardhii
ref|WP_026097926.1|  cell division protein FtsH                         340   7e-109   Geitlerinema sp. PCC 7105
ref|WP_017715041.1|  cell division protein FtsH                         340   9e-109   Oscillatoria sp. PCC 10802
ref|WP_017291153.1|  cell division protein FtsH                         339   1e-108   Leptolyngbya boryana
ref|WP_026786321.1|  cell division protein FtsH                         339   1e-108   Planktothrix rubescens
ref|WP_015955558.1|  cell division protein FtsH                         339   1e-108   Cyanothece sp. PCC 7424
ref|WP_024546675.1|  cell division protein FtsH                         339   1e-108   Synechococcus
ref|WP_011819579.1|  cell division protein FtsH                         339   1e-108   Prochlorococcus marinus
ref|XP_001419590.1|  predicted protein                                  340   1e-108   Ostreococcus lucimarinus CCE9901
ref|WP_015133797.1|  membrane protease FtsH catalytic subunit           339   1e-108   Leptolyngbya sp. PCC 7376
ref|WP_011131165.1|  cell division protein FtsH                         339   2e-108   Prochlorococcus marinus
ref|WP_017743955.1|  cell division protein FtsH                         339   2e-108   Scytonema hofmannii
ref|WP_019506377.1|  cell division protein FtsH                         339   2e-108   Pleurocapsa sp. PCC 7319
ref|WP_038331075.1|  cell division protein FtsH                         339   2e-108   filamentous cyanobacterium ESFC-1
ref|WP_015143924.1|  ATP-dependent metalloprotease FtsH                 339   2e-108   Pleurocapsa minor
ref|WP_015180805.1|  ATP-dependent metalloprotease FtsH                 338   2e-108   Microcoleus sp. PCC 7113
ref|WP_043694696.1|  cell division protein FtsH                         338   2e-108   Synechococcus sp. KORDI-49
ref|WP_006618677.1|  FtsH peptidase                                     338   2e-108   Arthrospira platensis
ref|WP_006669335.1|  MULTISPECIES: cell division protein FtsH           338   3e-108   Arthrospira
emb|CCH67048.1|  Cell division protein FtsH                             333   3e-108   Richelia intracellularis HH01
ref|WP_035155002.1|  cell division protein FtsH                         338   3e-108   Calothrix sp. 336/3
ref|WP_006623490.1|  cell division protein FtsH                         338   3e-108   
emb|CDN17247.1|  Cell division protein FtsH                             338   3e-108   Richelia intracellularis
ref|WP_011243527.1|  MULTISPECIES: cell division protein FtsH           338   3e-108   Synechococcus
ref|WP_040935720.1|  cell division protein FtsH                         338   5e-108   
ref|WP_011131865.1|  cell division protein FtsH                         338   5e-108   Prochlorococcus marinus
ref|WP_037224718.1|  cell division protein FtsH                         338   5e-108   
ref|WP_040054828.1|  cell division protein FtsH                         338   5e-108   
ref|WP_015116388.1|  membrane protease FtsH catalytic subunit           337   6e-108   Rivularia sp. PCC 7116
ref|WP_015204207.1|  membrane protease FtsH catalytic subunit           337   6e-108   Crinalium epipsammum
ref|WP_006172329.1|  cell division protein FtsH                         337   8e-108   Synechococcus sp. WH 5701
ref|WP_022606782.1|  ATP-dependent metalloprotease FtsH                 337   9e-108   Rubidibacter lacunae
ref|WP_006278775.1|  cell division protein FtsH                         337   9e-108   Cylindrospermopsis
ref|WP_036001623.1|  cell division protein FtsH                         337   1e-107   [Leptolyngbya] sp. JSC-1
ref|WP_009341877.1|  cell division protein FtsH                         337   1e-107   Aphanizomenonaceae
ref|WP_028090468.1|  cell division protein FtsH                         337   1e-107   Dolichospermum circinale
ref|WP_008316727.1|  ATP-dependent metalloprotease FtsH                 337   1e-107   Leptolyngbya sp. PCC 6406
ref|WP_015173051.1|  membrane protease FtsH catalytic subunit           337   1e-107   Geitlerinema sp. PCC 7407
ref|WP_028082599.1|  cell division protein FtsH                         337   1e-107   Dolichospermum circinale
ref|WP_036486108.1|  cell division protein FtsH                         337   1e-107   Myxosarcina sp. GI1
gb|AFK49239.1|  unknown                                                 325   1e-107   Medicago truncatula
ref|WP_012411183.1|  cell division protein FtsH                         337   1e-107   Nostoc
ref|WP_009630197.1|  ATP-dependent metalloprotease FtsH                 336   1e-107   Synechocystis sp. PCC 7509
ref|WP_015139560.1|  ATP-dependent metalloprotease FtsH                 336   1e-107   Nostoc sp. PCC 7524
ref|WP_015079544.1|  ATP-dependent metalloprotease HflB (FtsH)          336   2e-107   Anabaena sp. 90
ref|WP_012954347.1|  cell division protein FtsH                         336   2e-107   Candidatus Atelocyanobacterium thalassa
ref|WP_015177320.1|  membrane protease FtsH catalytic subunit           336   2e-107   Oscillatoria nigro-viridis
ref|WP_012162910.1|  cell division protein FtsH                         335   3e-107   Acaryochloris marina
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                337   3e-107   Erythranthe guttata [common monkey flower]
ref|WP_027401619.1|  cell division protein FtsH                         335   3e-107   
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit           335   4e-107   
ref|WP_026099187.1|  cell division protein FtsH                         335   4e-107   
ref|WP_015162315.1|  ATP-dependent metalloprotease FtsH                 335   4e-107   
ref|WP_036531425.1|  cell division protein FtsH                         335   4e-107   
ref|WP_027841867.1|  cell division protein FtsH                         335   4e-107   
gb|EHJ10086.1|  Cell division protein FtsH                              334   4e-107   
gb|EGJ33321.1|  membrane protease FtsH catalytic subunit                335   4e-107   
ref|WP_010995433.1|  cell division protein FtsH                         335   5e-107   
ref|WP_015129349.1|  membrane protease FtsH catalytic subunit           335   5e-107   
ref|WP_015114520.1|  membrane protease FtsH catalytic subunit           335   5e-107   
ref|WP_044492620.1|  cell division protein FtsH                         335   5e-107   
ref|WP_019494535.1|  cell division protein FtsH                         335   6e-107   
ref|WP_029633975.1|  cell division protein FtsH [                       335   6e-107   
ref|WP_007356988.1|  MULTISPECIES: cell division protein FtsH           335   6e-107   
ref|WP_015214216.1|  membrane protease FtsH catalytic subunit           335   6e-107   
gb|AII47735.1|  cell division protein FtsH                              334   7e-107   
ref|WP_010311939.1|  cell division protein FtsH                         335   7e-107   
ref|WP_011127179.1|  cell division protein FtsH                         335   8e-107   
ref|WP_013189950.1|  cell division protein FtsH                         334   8e-107   
ref|WP_008230065.1|  Cell division protein FtsH                         334   9e-107   
ref|WP_021830407.1|  Cell division protein FtsH                         334   9e-107   
ref|WP_016949229.1|  cell division protein FtsH                         334   9e-107   
ref|WP_038551333.1|  cell division protein FtsH                         334   1e-106   
gb|AHF62715.1|  ATP-dependent metalloprotease FtsH                      334   1e-106   
ref|WP_011363329.1|  cell division protein FtsH                         334   1e-106   
ref|WP_006853632.1|  cell division protein FtsH                         334   1e-106   
ref|WP_021836615.1|  Cell division protein FtsH                         334   1e-106   
ref|WP_006633639.1|  cell division protein FtsH                         334   1e-106   
ref|WP_015124055.1|  membrane protease FtsH catalytic subunit           334   1e-106   
ref|WP_041036156.1|  cell division protein FtsH                         334   1e-106   
ref|WP_017315070.1|  cell division protein FtsH                         334   1e-106   
ref|WP_015230925.1|  ATP-dependent metalloprotease FtsH                 334   2e-106   
ref|WP_012627305.1|  cell division protein FtsH                         333   2e-106   
ref|WP_039740989.1|  cell division protein FtsH                         333   2e-106   
gb|KIJ85386.1|  cell division protein FtsH                              333   2e-106   
ref|WP_011618327.1|  cell division protein FtsH                         333   2e-106   
ref|WP_011317448.1|  cell division protein FtsH                         333   2e-106   
gb|ADD94882.1|  FtsH peptidase                                          333   3e-106   
ref|WP_036906170.1|  cell division protein FtsH                         332   5e-106   
ref|WP_011124410.1|  cell division protein FtsH                         332   6e-106   
ref|WP_023067153.1|  ATP-dependent zinc metalloprotease FtsH 3          332   6e-106   
ref|WP_009782358.1|  cell division protein FtsH                         332   6e-106   
ref|WP_007099803.1|  cell division protein FtsH                         332   8e-106   
ref|WP_011360789.1|  cell division protein FtsH                         332   8e-106   
ref|WP_036892144.1|  MULTISPECIES: cell division protein FtsH           332   8e-106   
ref|WP_017653544.1|  cell division protein FtsH                         332   9e-106   
gb|KGG16707.1|  Cell division protein FtsH                              331   1e-105   
ref|WP_015197493.1|  membrane protease FtsH catalytic subunit           332   1e-105   
ref|WP_038651066.1|  cell division protein FtsH                         332   1e-105   
ref|WP_011294228.1|  cell division protein FtsH                         331   1e-105   
ref|WP_006528450.1|  ATP-dependent metalloprotease FtsH                 331   1e-105   
ref|WP_015208761.1|  membrane protease FtsH catalytic subunit           331   1e-105   
ref|WP_011823081.1|  cell division protein FtsH                         331   2e-105   
ref|WP_009788844.1|  cell division protein FtsH                         331   2e-105   
ref|WP_036916506.1|  MULTISPECIES: cell division protein FtsH           331   2e-105   
ref|WP_010314566.1|  cell division protein FtsH                         331   2e-105   
ref|WP_015146710.1|  membrane protease FtsH catalytic subunit           330   5e-105   
ref|WP_006198086.1|  cell division protein FtsH                         329   8e-105   
ref|WP_011613138.1|  cell division protein FtsH                         329   8e-105   
ref|WP_025953358.1|  hypothetical protein                               308   3e-101   
gb|ACV52574.1|  FtsH-like protein                                       305   9e-101   
ref|WP_011141915.1|  cell division protein FtsH                         318   1e-100   
ref|WP_015167033.1|  ATP-dependent metalloprotease FtsH                 317   4e-100   
ref|WP_023174221.1|  ATP-dependent metalloprotease FtsH                 316   1e-99    
ref|WP_015165890.1|  ATP-dependent metalloprotease FtsH                 315   4e-99    
ref|YP_002049185.1|  cell division protein ftsH                         313   1e-98    
gb|ABH09265.1|  cell division protein                                   313   1e-98    
ref|WP_019500986.1|  cell division protein FtsH                         312   3e-98    
ref|XP_005713345.1|  cell division protein FtsH                         306   5e-95    
ref|WP_025961749.1|  hypothetical protein                               290   7e-95    
ref|WP_009628744.1|  membrane protease FtsH catalytic subunit           303   1e-94    
ref|WP_017324919.1|  hypothetical protein                               301   4e-94    
ref|XP_005834056.1|  hypothetical protein GUITHDRAFT_86435              303   5e-94    
gb|KJB14313.1|  hypothetical protein B456_002G118800                    298   4e-93    
ref|WP_011431525.1|  cell division protein FtsH                         298   2e-92    
ref|XP_005708438.1|  AAA-type ATPase                                    300   3e-92    
ref|WP_011432278.1|  cell division protein FtsH                         297   3e-92    
ref|WP_010468934.1|  cell division protein FtsH                         293   6e-91    
ref|XP_005538209.1|  cell division protein FtsH                         295   6e-90    
gb|ADF81075.1|  FtsH                                                    270   1e-86    
ref|XP_005708136.1|  AAA-type ATPase                                    277   2e-83    
gb|ABC70534.1|  ATPase                                                  249   9e-79    
ref|XP_002287516.1|  metalloprotease                                    259   3e-78    
ref|XP_002177215.1|  predicted protein                                  254   1e-75    
gb|KJB14312.1|  hypothetical protein B456_002G118800                    252   2e-75    
gb|EJK55379.1|  hypothetical protein THAOC_24887                        254   3e-75    
ref|XP_007017988.1|  FTSH protease 1 isoform 2                          250   1e-74    
gb|KDO85047.1|  hypothetical protein CISIN_1g004921mg                   250   2e-74    
ref|XP_002291485.1|  chloroplast ftsH                                   248   7e-74    
ref|WP_022344010.1|  aTP-dependent metallopeptidase HflB subfamil...    248   7e-74    
ref|WP_013119121.1|  cell division protein FtsH                         246   1e-72    
dbj|BAH56755.1|  AT5G42270                                              244   2e-72    
gb|EWM30233.1|  atp-dependent metalloprotease                           248   2e-72    
ref|WP_022451567.1|  aTP-dependent metallopeptidase HflB subfamil...    244   4e-72    
gb|AHJ28404.1|  Cell division protein FtsH                              243   7e-72    
ref|WP_044452899.1|  cell division protein FtsH                         237   7e-72    
ref|WP_034106139.1|  cell division protein FtsH                         243   8e-72    
ref|WP_006199059.1|  cell division protein FtsH                         243   1e-71    
ref|WP_027717445.1|  cell division protein FtsH                         241   4e-71    
ref|WP_041424761.1|  cell division protein FtsH                         241   4e-71    
ref|WP_015119379.1|  membrane protease FtsH catalytic subunit           241   5e-71    
ref|WP_041274355.1|  cell division protein FtsH                         241   5e-71    
ref|WP_031459350.1|  cell division protein FtsH                         241   8e-71    
gb|ACZ41968.1|  ATP-dependent metalloprotease FtsH                      241   9e-71    
gb|ABO48676.1|  membrane protease FtsH catalytic subunit                241   9e-71    
emb|CEF99105.1|  P-loop containing nucleoside triphosphate hydrolase    239   1e-70    
ref|WP_039253834.1|  cell division protein FtsH                         241   1e-70    
ref|WP_043989340.1|  cell division protein FtsH                         240   2e-70    
ref|WP_036002156.1|  cell division protein FtsH                         233   2e-70    
gb|EDS77193.1|  putative Cell division protease FtsH homolog            240   2e-70    
emb|CCH67560.1|  Cell division protein FtsH                             233   3e-70    
ref|WP_039280930.1|  cell division protein FtsH                         240   3e-70    
ref|WP_027364266.1|  cell division protein FtsH                         239   3e-70    
ref|WP_017322954.1|  cell division protein FtsH                         239   4e-70    
ref|WP_006523235.1|  cell division protein FtsH                         239   4e-70    
ref|WP_008412160.1|  ATP-dependent zinc metalloprotease FtsH            239   4e-70    
ref|WP_028457503.1|  cell division protein FtsH                         239   4e-70    
ref|WP_009459923.1|  MULTISPECIES: cell division protein FtsH           239   6e-70    
ref|WP_035150451.1|  cell division protein FtsH                         238   6e-70    
ref|WP_016869882.1|  cell division protein FtsH                         238   8e-70    
ref|WP_027356271.1|  cell division protein FtsH                         238   9e-70    
ref|WP_016858941.1|  cell division protein FtsH                         238   9e-70    
ref|WP_007573233.1|  cell division protein FtsH                         238   1e-69    
ref|WP_015124159.1|  membrane protease FtsH catalytic subunit           238   1e-69    
ref|WP_040355337.1|  ATP-dependent metalloprotease                      238   1e-69    
gb|EEV88713.1|  ATP-dependent metallopeptidase HflB                     238   1e-69    
emb|CEO89112.1|  cell-division protein and general stress protein...    234   1e-69    
ref|WP_026719681.1|  cell division protein FtsH                         238   2e-69    
ref|WP_026732891.1|  cell division protein FtsH                         238   2e-69    
ref|WP_012408087.1|  cell division protein FtsH                         238   2e-69    
ref|WP_015170903.1|  membrane protease FtsH catalytic subunit           237   2e-69    
ref|WP_013191839.1|  cell division protein FtsH                         237   3e-69    
emb|CBN76650.1|  FtsH protease                                          239   3e-69    
ref|WP_015153530.1|  membrane protease FtsH catalytic subunit           236   4e-69    
ref|WP_027845285.1|  cell division protein FtsH                         236   5e-69    
ref|WP_023174351.1|  ATP-dependent metalloprotease FtsH                 236   5e-69    
ref|WP_021202559.1|  ATP-dependent metalloprotease                      228   6e-69    
ref|WP_039738012.1|  cell division protein FtsH                         236   6e-69    
ref|WP_017651155.1|  cell division protein FtsH                         236   6e-69    
ref|WP_012257906.1|  MULTISPECIES: cell division protein FtsH           236   7e-69    
ref|WP_017312271.1|  cell division protein FtsH                         236   7e-69    
ref|WP_012629618.1|  cell division protein FtsH                         236   8e-69    
ref|WP_010997786.1|  cell division protein FtsH                         236   9e-69    
ref|WP_011056581.1|  cell division protein FtsH                         236   9e-69    
ref|WP_016876491.1|  cell division protein FtsH                         235   1e-68    
ref|WP_018867786.1|  MULTISPECIES: ATP-dependent metalloprotease        236   1e-68    
ref|WP_016951384.1|  cell division protein FtsH                         235   1e-68    
ref|WP_018875886.1|  MULTISPECIES: ATP-dependent metalloprotease        236   1e-68    
ref|WP_015216796.1|  membrane protease FtsH catalytic subunit           235   1e-68    
ref|WP_011565143.1|  cell division protein FtsH                         235   1e-68    
ref|WP_015112002.1|  membrane protease FtsH catalytic subunit           235   1e-68    
ref|WP_012162627.1|  cell division protein FtsH                         235   1e-68    
ref|YP_001293616.1|  cell division protein                              235   2e-68    
emb|CDN10469.1|  Cell division protein FtsH                             234   2e-68    
ref|WP_022334726.1|  aTP-dependent zinc metalloprotease FtsH 1          234   2e-68    
ref|WP_015941389.1|  cell division protein FtsH                         235   2e-68    
ref|WP_037216619.1|  cell division protein FtsH                         234   2e-68    
ref|WP_022182470.1|  aTP-dependent metalloprotease FtsH                 234   2e-68    
gb|AHB35104.1|  putative plastid division protein                       234   2e-68    
ref|WP_011142572.1|  cell division protein FtsH                         234   2e-68    
ref|WP_011319922.1|  cell division protein FtsH                         234   2e-68    
ref|WP_018085219.1|  cell division protein FtsH                         234   2e-68    
ref|WP_011564781.1|  cell division protein FtsH                         235   2e-68    
ref|WP_029633486.1|  cell division protein FtsH [                       234   2e-68    
ref|WP_013840279.1|  cell division protein FtsH                         234   3e-68    
ref|WP_018937957.1|  MULTISPECIES: ATP-dependent metalloprotease        235   3e-68    
ref|WP_038038945.1|  cell division protein FtsH                         234   3e-68    
ref|WP_015132046.1|  membrane protease FtsH catalytic subunit           234   3e-68    
ref|WP_003540641.1|  cell division protein FtsH                         234   3e-68    
ref|WP_041570995.1|  cell division protein FtsH                         234   3e-68    
ref|WP_041282707.1|  cell division protein FtsH                         234   3e-68    
ref|WP_013809431.1|  cell division protein FtsH                         234   3e-68    
ref|WP_039716067.1|  cell division protein FtsH                         234   3e-68    
ref|WP_006508907.1|  ATP-dependent metalloprotease FtsH                 234   4e-68    
ref|WP_018146241.1|  MULTISPECIES: ATP-dependent metalloprotease        234   4e-68    
ref|WP_022077624.1|  aTP-dependent metallopeptidase HflB subfamil...    231   4e-68    
ref|WP_022423360.1|  aTP-dependent metalloprotease FtsH                 233   4e-68    
gb|AEG13855.1|  ATP-dependent metalloprotease FtsH                      234   4e-68    
ref|WP_015137807.1|  ATP-dependent metalloprotease FtsH                 234   4e-68    
gb|EHM53778.1|  cell division protease FtsH                             234   4e-68    
gb|ACA58655.1|  ATP-dependent metalloprotease FtsH                      233   4e-68    
ref|WP_006456705.1|  cell division protein FtsH                         234   4e-68    
ref|WP_012871261.1|  cell division protein FtsH                         234   4e-68    
ref|WP_010477442.1|  cell division protein FtsH                         234   4e-68    
ref|WP_021954053.1|  aTP-dependent metalloprotease FtsH                 233   5e-68    
gb|AFW93266.1|  ATP-dependent metallopeptidase                          233   5e-68    
ref|WP_040389162.1|  ATP-dependent metalloprotease                      234   5e-68    
dbj|BAP57909.1|  ATP-dependent metalloprotease FtsH                     234   5e-68    
ref|WP_019593923.1|  ATP-dependent metalloprotease                      234   5e-68    
ref|WP_041739648.1|  cell division protein FtsH                         233   6e-68    
ref|WP_026082835.1|  cell division protein FtsH                         233   6e-68    
ref|WP_039244531.1|  cell division protein FtsH                         234   6e-68    
ref|WP_011721151.1|  cell division protein FtsH                         234   6e-68    
ref|WP_017654114.1|  cell division protein FtsH                         233   6e-68    
ref|WP_023070843.1|  membrane protease catalytic subunit                233   6e-68    
ref|WP_011826180.1|  cell division protein FtsH                         233   7e-68    
ref|NP_050804.1|  cell division protein                                 233   7e-68    
emb|CCH65009.1|  Cell division protein FtsH                             232   7e-68    
gb|AFZ02140.1|  membrane protease FtsH catalytic subunit                233   7e-68    
ref|WP_010073796.1|  cell division protein FtsH                         233   8e-68    
ref|WP_015188757.1|  membrane protease FtsH catalytic subunit           233   8e-68    
ref|WP_011130055.1|  cell division protein FtsH                         233   8e-68    
ref|WP_039238378.1|  cell division protein FtsH                         234   8e-68    
ref|WP_012408423.1|  cell division protein FtsH                         233   9e-68    
ref|WP_041457570.1|  cell division protein FtsH                         233   9e-68    
ref|WP_044258630.1|  hypothetical protein                               232   9e-68    
ref|WP_036915227.1|  MULTISPECIES: cell division protein FtsH           233   1e-67    
ref|WP_018948798.1|  ATP-dependent metalloprotease                      233   1e-67    
ref|WP_009555904.1|  membrane protease FtsH catalytic subunit           233   1e-67    
ref|YP_009027610.1|  putative plastid division protein                  233   1e-67    
ref|WP_011343162.1|  cell division protein FtsH                         232   1e-67    
ref|WP_015163831.1|  membrane protease FtsH catalytic subunit           233   1e-67    
ref|WP_028051728.1|  cell division protein FtsH                         232   1e-67    
gb|ETA79344.1|  cell division protein FtsH                              233   1e-67    
ref|WP_019498223.1|  cell division protein FtsH                         232   1e-67    
ref|WP_022114394.1|  aTP-dependent zinc metalloprotease FtsH 1          232   1e-67    
ref|WP_028083738.1|  cell division protein FtsH                         232   1e-67    
ref|WP_038051416.1|  ATP-dependent metalloprotease                      233   1e-67    
ref|YP_009019579.1|  ftsH protease-like protein                         232   1e-67    
ref|WP_034425265.1|  cell division protein FtsH                         232   1e-67    



>gb|KHN33816.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Glycine 
soja]
Length=325

 Score =   501 bits (1290),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 246/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  74   GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  133

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  134  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  193

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  194  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  253

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  254  SSQKDYSMATADVVDAEVRELVERAYSRATHIITTHIDILHKLAQLLIEKETVDGEEFMS  313

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  314  LFIDGKAELYVA  325



>emb|CBI18876.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 246/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  287  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  346

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  347  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  406

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  407  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  466

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  467  SSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMS  526

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  527  LFIDGKAELFVA  538



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   507 bits (1306),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 249/252 (99%), Positives = 252/252 (100%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  464  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  523

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  524  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  583

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM
Sbjct  584  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  643

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  644  SSQKDYSMATADIVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  703

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  704  LFIDGKAELYVA  715



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   504 bits (1299),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  412  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  471

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  472  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  531

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  532  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  591

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  592  SSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMS  651

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  652  LFIDGKAELFVA  663



>gb|ACN35033.1| unknown [Zea mays]
Length=463

 Score =   497 bits (1279),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 244/252 (97%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  212  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  271

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  272  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  331

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  332  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  391

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  392  SSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKLAQLLIEKETVDGEEFMS  451

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  452  LFIDGQAELFVA  463



>ref|NP_001183829.1| uncharacterized protein LOC100502422 [Zea mays]
 gb|ACR38427.1| unknown [Zea mays]
Length=475

 Score =   497 bits (1280),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 244/252 (97%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  224  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  283

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  284  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  343

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  344  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  403

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  404  SSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKLAQLLIEKETVDGEEFMS  463

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  464  LFIDGQAELFVA  475



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   505 bits (1301),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  462  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  521

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  522  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  581

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  582  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  641

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            +TQKDYSMATADVVDAEVRELVE+AYSRATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  642  ATQKDYSMATADVVDAEVRELVEKAYSRATQIINTHIDILHKLAQLLIEKETVDGEEFMS  701

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  702  LFIDGKAELFVA  713



>ref|XP_006656509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Oryza brachyantha]
Length=475

 Score =   496 bits (1277),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 252/252 (100%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  224  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  283

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  284  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  343

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  344  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  403

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  404  SSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMS  463

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  464  LFIDGQAELFVA  475



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   504 bits (1297),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  458  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  517

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  518  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  577

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  578  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  637

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  638  STQKDYSMATADVVDAEVRELVERAYSRATNIITTHIDILHKLAQLLIEKETVDGEEFMS  697

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  698  LFIDGKAELYVA  709



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   503 bits (1296),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 246/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  455  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  514

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  515  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  574

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  575  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  634

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  635  SSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMS  694

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  695  LFIDGKAELFVA  706



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   503 bits (1294),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 246/252 (98%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  445  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  504

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  505  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  564

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  565  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  624

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  625  SSQKDYSMATADVVDAEVRELVERAYSRATHIITTHIDILHKLAQLLIEKETVDGEEFMS  684

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  685  LFIDGKAELYVA  696



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   503 bits (1296),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 252/252 (100%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  469  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  528

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  529  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  588

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSK+IGQ+AIGGPGGNPFLGQQM
Sbjct  589  GRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKRIGQVAIGGPGGNPFLGQQM  648

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVERAY+RATQIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  649  SSQKDYSMATADVVDAEVRELVERAYARATQIITTHIDILHKLAQLLMEKETVDGEEFMS  708

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  709  LFIDGKAELYVA  720



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score =   501 bits (1291),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 252/252 (100%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EKKKLVAYH
Sbjct  434  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYH  493

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  494  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  553

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  554  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  613

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  614  SSQKDYSMATADIVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  673

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  674  LFIDGQAELFVA  685



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   499 bits (1286),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 252/252 (100%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  379  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  438

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  439  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  498

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  499  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  558

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  559  SSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMS  618

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  619  LFIDGQAELFVA  630



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   503 bits (1294),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 246/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  464  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  523

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  524  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  583

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  584  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  643

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVERAY+RA  IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  644  SSQKDYSMATADVVDAEVRELVERAYARAKHIITTHIDILHKLAQLLIEKETVDGEEFMS  703

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  704  LFIDGKAELFVA  715



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   502 bits (1293),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 247/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  464  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  523

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  524  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  583

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM
Sbjct  584  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  643

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVERAYSRA QIITTH DILHKLAQLLIEKETVDGEEFMS
Sbjct  644  SSQKDYSMATADIVDAEVRELVERAYSRAKQIITTHNDILHKLAQLLIEKETVDGEEFMS  703

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  704  LFIDGKAELYVA  715



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   501 bits (1290),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  443  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  502

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  503  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  562

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  563  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  622

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVERAYSRAT II+THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  623  SSQKDYSMATADVVDAEVRELVERAYSRATHIISTHIDILHKLAQLLIEKETVDGEEFMS  682

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  683  LFIDGKAELYVA  694



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   501 bits (1290),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 244/252 (97%), Positives = 252/252 (100%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  452  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  511

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  512  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  571

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  572  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  631

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVERAY+RATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  632  SSQKDYSMATADVVDAEVRELVERAYTRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  691

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL++A
Sbjct  692  LFIDGKAELYIA  703



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   502 bits (1292),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 246/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  472  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  531

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  532  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  591

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  592  GRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  651

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  652  SSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMS  711

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  712  LFIDGKAELFVA  723



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   502 bits (1292),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 246/252 (98%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  472  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  531

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  532  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  591

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  592  GRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  651

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  652  SSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMS  711

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  712  LFIDGKAELFVA  723



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   501 bits (1290),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 245/252 (97%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  452  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  511

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  512  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  571

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  572  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  631

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELV+RAY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  632  STQKDYSMATADVVDAEVRELVDRAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMS  691

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  692  LFIDGKAELYVA  703



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   499 bits (1286),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 244/252 (97%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  437  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  496

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  497  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  556

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  557  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  616

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  617  SSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKLAQLLIEKETVDGEEFMS  676

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  677  LFIDGQAELFVA  688



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   499 bits (1284),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 244/252 (97%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  464  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  523

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQM+VALG
Sbjct  524  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMSVALG  583

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  584  GRIAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGSGGNPFLGQQM  643

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVERAY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  644  SSQKDYSMATADVVDAEVRELVERAYARAKQIITTHIDILHKLAQLLIEKETVDGEEFMS  703

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFV+
Sbjct  704  LFIDGKAELFVS  715



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   497 bits (1280),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 252/252 (100%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EK++LVAYH
Sbjct  435  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKRRLVAYH  494

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  495  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  554

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  555  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  614

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  615  SSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMS  674

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  675  LFIDGQAELFVA  686



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   497 bits (1280),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 252/252 (100%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EK++LVAYH
Sbjct  435  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKRRLVAYH  494

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  495  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  554

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  555  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  614

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  615  SSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMS  674

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  675  LFIDGQAELFVA  686



>dbj|BAJ85305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   480 bits (1236),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 234/249 (94%), Positives = 244/249 (98%), Gaps = 0/249 (0%)
 Frame = -2

Query  830  GADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAG  651
            GADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS++K+KLVAYHEAG
Sbjct  1    GADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEQKRKLVAYHEAG  60

Query  650  HALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRV  471
            HALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRV
Sbjct  61   HALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRV  120

Query  470  AEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQ  291
            AEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQMS+Q
Sbjct  121  AEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGSSGGNPFLGQQMSSQ  180

Query  290  KDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFI  111
            KDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+LA LLIEKETVDGEEFMSLFI
Sbjct  181  KDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHRLANLLIEKETVDGEEFMSLFI  240

Query  110  DGKAELFVA  84
            DG+AELFVA
Sbjct  241  DGQAELFVA  249



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   497 bits (1279),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  453  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  512

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  513  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  572

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  573  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  632

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKLAQLLIEKE+VDGEEFMS
Sbjct  633  SSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKESVDGEEFMS  692

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  693  LFIDGKAELYVS  704



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   497 bits (1280),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EKKKLVAYH
Sbjct  462  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYH  521

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  522  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  581

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  582  GRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  641

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELV+RAYSRA QI+TTH+DILHKLAQLLIEKETVDGEEFMS
Sbjct  642  STQKDYSMATADVVDAEVRELVDRAYSRAKQIMTTHVDILHKLAQLLIEKETVDGEEFMS  701

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  702  LFIDGKAELYVS  713



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   496 bits (1278),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 244/252 (97%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  457  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  516

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  517  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  576

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  577  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQM  636

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELVE+AY RATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  637  STQKDYSMATADVVDAEVRELVEKAYERATQIITTHIDILHKLAQLLIEKETVDGEEFMS  696

Query  119  LFIDGKAELFVA  84
            LFIDGKAELF++
Sbjct  697  LFIDGKAELFIS  708



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   496 bits (1277),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  455  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  514

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  515  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  574

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  575  GRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  634

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVD+EVRELVE+AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEF+S
Sbjct  635  SSQKDYSMATADVVDSEVRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFLS  694

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  695  LFIDGKAELYVA  706



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   496 bits (1277),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 241/252 (96%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAI+AARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  454  GFTGADLQNLMNEAAIVAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  513

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  514  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  573

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  574  GRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  633

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVD EVRELVE AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  634  SSQKDYSMATADVVDTEVRELVETAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMS  693

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL++A
Sbjct  694  LFIDGKAELYIA  705



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   495 bits (1275),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 241/252 (96%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAI+AARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  453  GFTGADLQNLMNEAAIVAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  512

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  513  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  572

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  573  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  632

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKLAQLLIEKE+VDGEEFMS
Sbjct  633  SSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKESVDGEEFMS  692

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  693  LFIDGKAELYVS  704



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   495 bits (1275),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 241/252 (96%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  448  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  507

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYL+NQMAVALG
Sbjct  508  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLQNQMAVALG  567

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  568  GRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  627

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVR+LVE AYSRA QIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  628  SSQKDYSMATADVVDAEVRDLVETAYSRAKQIITTHIDILHKLAQLLMEKETVDGEEFMS  687

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  688  LFIDGKAELYVS  699



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   495 bits (1275),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 241/252 (96%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  451  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  510

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  511  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  570

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  571  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  630

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVD+EVRELVE AY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  631  SSQKDYSMATADVVDSEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMS  690

Query  119  LFIDGKAELFVA  84
            LFIDGK EL+V+
Sbjct  691  LFIDGKTELYVS  702



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   496 bits (1276),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+EKKKLVAYH
Sbjct  459  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYH  518

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  519  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  578

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  579  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  638

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE AYSRA QI+TTHIDILHKLA LLIEKETVDGEEFMS
Sbjct  639  SSQKDYSMATADVVDAEVRELVETAYSRAKQILTTHIDILHKLALLLIEKETVDGEEFMS  698

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  699  LFIDGKAELYVS  710



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   495 bits (1275),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  457  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  516

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  517  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  576

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  577  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQM  636

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELVE+AY RATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  637  STQKDYSMATADVVDAEVRELVEKAYERATQIITTHIDILHKLAQLLIEKETVDGEEFMS  696

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+++
Sbjct  697  LFIDGKAELYIS  708



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score =   495 bits (1275),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 243/252 (96%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  472  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  531

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  532  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  591

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  592  GRVAEEVIFGNDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  651

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRA QI+T +IDILHKLAQLLIEKETVDGEEFMS
Sbjct  652  SSQKDYSMATADVVDAEVRELVEKAYSRAKQIMTDNIDILHKLAQLLIEKETVDGEEFMS  711

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  712  LFIDGKAELYVA  723



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   494 bits (1273),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 244/252 (97%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  455  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  514

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  515  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  574

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  575  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGSGGNPFLGQQM  634

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELVERAYSRA QIITTH DILHKLAQLLIEKETVDG+EFMS
Sbjct  635  STQKDYSMATADVVDAEVRELVERAYSRAKQIITTHSDILHKLAQLLIEKETVDGDEFMS  694

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  695  LFIDGKAELYVA  706



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score =   494 bits (1272),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  464  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  523

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  524  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  583

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGE+ VTTGASNDFMQVSRVARQMVER GFSK+IGQ+AIGGPGGNPFLGQQM
Sbjct  584  GRVAEEVIFGEEKVTTGASNDFMQVSRVARQMVERLGFSKRIGQVAIGGPGGNPFLGQQM  643

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVD+EVRELVERAY+RA QIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  644  SSQKDYSMATADVVDSEVRELVERAYARAKQIITTHIDILHKLAQLLIEKETVDGEEFMS  703

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  704  LFIDGKAELYVA  715



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   493 bits (1269),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKKKLVAYH
Sbjct  456  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYH  515

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  516  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  575

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  576  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQM  635

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELVERAY RATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  636  STQKDYSMATADVVDAEVRELVERAYERATQIITTHIDILHKLAQLLIEKETVDGEEFMS  695

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+++
Sbjct  696  LFIDGKAELYIS  707



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   493 bits (1269),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  456  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  515

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  516  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  575

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  576  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQM  635

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELVERAY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  636  STQKDYSMATADVVDAEVRELVERAYERATEIITTHIDILHKLAQLLIEKETVDGEEFMS  695

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+++
Sbjct  696  LFIDGKAELYIS  707



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   491 bits (1265),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  424  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  483

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  484  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  543

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  544  GRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  603

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  604  SSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKLAQLLIEKETVDGEEFMS  663

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  664  LFIDGQAELYVS  675



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score =   493 bits (1269),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 242/252 (96%), Positives = 248/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  462  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  521

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  522  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  581

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  582  GRVAEEVIFGKENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  641

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVD+EVRELV+ AYSRA  IITT IDILHKLAQLLIEKETVDGEEFMS
Sbjct  642  SSQKDYSMATADVVDSEVRELVDEAYSRAKHIITTQIDILHKLAQLLIEKETVDGEEFMS  701

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  702  LFIDGKAELFVA  713



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   493 bits (1268),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  452  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  511

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  512  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  571

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  572  GRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  631

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  632  SSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKLAQLLIEKETVDGEEFMS  691

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  692  LFIDGQAELYVS  703



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   492 bits (1267),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  451  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  510

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  511  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  570

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  571  GRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  630

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  631  SSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKLAQLLIEKETVDGEEFMS  690

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  691  LFIDGQAELYVS  702



>gb|EMS62975.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Triticum 
urartu]
Length=494

 Score =   485 bits (1248),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 247/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS++K+KLVAYH
Sbjct  243  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEQKRKLVAYH  302

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  303  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  362

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQM
Sbjct  363  GRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGSSGGNPFLGQQM  422

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+LA LLIEKETVDGEEFMS
Sbjct  423  SSQKDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHRLANLLIEKETVDGEEFMS  482

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  483  LFIDGQAELFVA  494



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   492 bits (1267),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 235/252 (93%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  469  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  528

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  529  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  588

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  589  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  648

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  649  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMS  708

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+++
Sbjct  709  LFIDGQAELYIS  720



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   491 bits (1265),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 239/252 (95%), Positives = 248/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAI+AARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  454  GFTGADLQNLMNEAAIVAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  513

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  514  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  573

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  574  GRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGGSGGNPFLGQQM  633

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVD EVRELVE AYSRA QI+TTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  634  SSQKDYSMATADVVDTEVRELVETAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMS  693

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL++A
Sbjct  694  LFIDGKAELYIA  705



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   491 bits (1265),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 236/252 (94%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  471  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  530

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  531  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  590

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG +NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  591  GRVAEEVIFGTENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  650

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  651  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMS  710

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  711  LFIDGQAELYVS  722



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   491 bits (1264),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 235/252 (93%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKK+LVAYH
Sbjct  467  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKRLVAYH  526

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  527  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  586

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  587  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  646

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  647  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMS  706

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+++
Sbjct  707  LFIDGQAELYIS  718



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   490 bits (1262),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 239/252 (95%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYH
Sbjct  468  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYH  527

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  528  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  587

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQM
Sbjct  588  GRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGAGGGNPFLGQQM  647

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  648  SSQKDYSMATADIVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMS  707

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  708  LFIDGKAELYVA  719



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   490 bits (1262),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 239/252 (95%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYH
Sbjct  468  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYH  527

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  528  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  587

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQM
Sbjct  588  GRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGAGGGNPFLGQQM  647

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AYSRATQIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  648  SSQKDYSMATADIVDAEVRELVEKAYSRATQIITTHIDILHKLAQLLMEKETVDGEEFMS  707

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  708  LFIDGKAELYVA  719



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   490 bits (1262),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  472  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  531

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  532  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  591

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  592  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  651

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  652  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMS  711

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+++
Sbjct  712  LFIDGQAELYIS  723



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   490 bits (1262),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  473  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  532

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  533  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  592

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  593  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  652

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  653  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMS  712

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+++
Sbjct  713  LFIDGQAELYIS  724



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   490 bits (1261),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  471  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  530

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  531  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  590

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  591  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  650

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  651  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMS  710

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+++
Sbjct  711  LFIDGQAELYIS  722



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   489 bits (1259),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 251/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  465  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  524

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  525  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  584

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  585  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  644

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  645  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMS  704

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+++
Sbjct  705  LFIDGQAELYIS  716



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   488 bits (1257),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 238/252 (94%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAI+AARRDLKEISKDEISDALERIIAGPEKKNAVVS+EK+KLVAYH
Sbjct  473  GFTGADLQNLMNEAAIIAARRDLKEISKDEISDALERIIAGPEKKNAVVSEEKRKLVAYH  532

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  533  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  592

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  593  GRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  652

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVD+EVRELVE+AYSRA QI++ +IDILHKLAQLLIEKETVDGEEFMS
Sbjct  653  SSQKDYSMATADVVDSEVRELVEKAYSRALQIMSDNIDILHKLAQLLIEKETVDGEEFMS  712

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  713  LFIDGKAELYVA  724



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score =   487 bits (1253),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS++K++LVAYH
Sbjct  430  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEQKRRLVAYH  489

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  490  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  549

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQM
Sbjct  550  GRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGSSGGNPFLGQQM  609

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE++YSRATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  610  SSQKDYSMATADIVDAEVRELVEKSYSRATQIINTHIDILHKLAQLLIEKETVDGEEFMS  669

Query  119  LFIDGKAELFVA  84
            LFIDG+AELFVA
Sbjct  670  LFIDGQAELFVA  681



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   484 bits (1246),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 236/249 (95%), Positives = 245/249 (98%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  446  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  505

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  506  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  565

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE IFG D VTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  566  GRVAEEAIFGVDKVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  625

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATAD+VDAEVRELV+RAY+RA QIITT+IDILH+LAQLLIEKETVDGEEFMS
Sbjct  626  STQKDYSMATADIVDAEVRELVDRAYARAKQIITTNIDILHRLAQLLIEKETVDGEEFMS  685

Query  119  LFIDGKAEL  93
            LFIDGKA++
Sbjct  686  LFIDGKAQM  694



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   484 bits (1247),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 241/252 (96%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  464  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  523

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  524  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  583

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  584  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQM  643

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATAD+VDAEVRELV++AY+RATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  644  STQKDYSMATADIVDAEVRELVDKAYARATQIITTHIDILHKLAQLLIEKETVDGEEFMS  703

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+++
Sbjct  704  LFIDGKAELYIS  715



>gb|EMT09942.1| Cell division protease ftsH-like protein, chloroplastic [Aegilops 
tauschii]
Length=665

 Score =   483 bits (1243),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 237/253 (94%), Positives = 247/253 (98%), Gaps = 1/253 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS++K+KLVAYH
Sbjct  413  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEQKRKLVAYH  472

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  473  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  532

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGP-GGNPFLGQQ  303
            GRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG   GGNPFLGQQ
Sbjct  533  GRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGSSGGGNPFLGQQ  592

Query  302  MSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFM  123
            MS+QKDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+LA LLIEKETVDGEEFM
Sbjct  593  MSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHRLANLLIEKETVDGEEFM  652

Query  122  SLFIDGKAELFVA  84
            SLFIDG+AELFVA
Sbjct  653  SLFIDGQAELFVA  665



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   484 bits (1245),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/252 (96%), Positives = 250/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  459  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  518

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  519  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  578

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  579  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQM  638

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATAD+VDAEVRELV++AY+RATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  639  STQKDYSMATADIVDAEVRELVDKAYARATQIITTHIDILHKLAQLLIEKETVDGEEFMS  698

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+++
Sbjct  699  LFIDGKAELYIS  710



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   483 bits (1243),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 247/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEI+DALERIIAGPEKKNAVVS+EKKKLVAYH
Sbjct  460  GFTGADLQNLMNEAAILAARRELKEISKDEIADALERIIAGPEKKNAVVSEEKKKLVAYH  519

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  520  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  579

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+ NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+G  GGNPFLGQQM
Sbjct  580  GRVAEEVIFGQANVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGSSGGNPFLGQQM  639

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLA LLIEKE+VDGEEFMS
Sbjct  640  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLANLLIEKESVDGEEFMS  699

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  700  LFIDGKAELYVS  711



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   482 bits (1241),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 236/252 (94%), Positives = 246/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYH
Sbjct  467  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYH  526

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  527  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  586

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIG  GGNPFLGQQM
Sbjct  587  GRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGASGGNPFLGQQM  646

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE AYSRA  I+TTHIDILH LAQLL+EKETVDGEEFMS
Sbjct  647  SSQKDYSMATADVVDAEVRELVETAYSRAKDIVTTHIDILHTLAQLLMEKETVDGEEFMS  706

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+VA
Sbjct  707  LFIDGKAELYVA  718



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   481 bits (1238),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 240/252 (95%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  448  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  507

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  508  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  567

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  568  GRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  627

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  628  SSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKLAQLLMEKETVDGEEFMS  687

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  688  LFIDGKAELYVS  699



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   481 bits (1238),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 240/252 (95%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  448  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  507

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  508  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  567

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  568  GRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  627

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  628  SSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKLAQLLMEKETVDGEEFMS  687

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  688  LFIDGKAELYVS  699



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   481 bits (1238),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 231/245 (94%), Positives = 244/245 (99%), Gaps = 0/245 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRD+KEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  465  GFTGADLQNLMNEAAILAARRDVKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  524

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  525  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  584

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  585  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  644

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  645  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMS  704

Query  119  LFIDG  105
            LFIDG
Sbjct  705  LFIDG  709



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   479 bits (1234),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 234/251 (93%), Positives = 244/251 (97%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEI+DALERIIAGPEKKNAVVS++KKKLVAYH
Sbjct  470  GFTGADLQNLMNEAAILAARRDLKEISKDEIADALERIIAGPEKKNAVVSEDKKKLVAYH  529

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGG TFFAPSEERLESGLYSRSYLENQM VALG
Sbjct  530  EAGHALVGALMPEYDPVAKISIIPRGQAGGFTFFAPSEERLESGLYSRSYLENQMVVALG  589

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEV FG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQIA+G  GGNPFLGQQM
Sbjct  590  GRVAEEVSFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQIAVGASGGNPFLGQQM  649

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VD EVRELVE AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  650  SSQKDYSMATADIVDGEVRELVETAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  709

Query  119  LFIDGKAELFV  87
            LFIDGKAEL+V
Sbjct  710  LFIDGKAELYV  720



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   479 bits (1234),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 240/252 (95%), Positives = 248/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            G+TGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  456  GYTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  515

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  516  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  575

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
             RVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  576  ERVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQM  635

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            STQKDYSMATADVVDAEVRELVERAY RAT+IITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  636  STQKDYSMATADVVDAEVRELVERAYERATEIITTHIDILHKLAQLLIEKETVDGEEFMS  695

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+++
Sbjct  696  LFIDGKAELYIS  707



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   478 bits (1230),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 238/252 (94%), Positives = 248/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEI+DALERIIAGPEKKNAVVS+EKKKLVAYH
Sbjct  455  GFTGADLQNLMNEAAILAARRDLKEISKDEIADALERIIAGPEKKNAVVSEEKKKLVAYH  514

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  515  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  574

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  575  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  634

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  635  SSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMS  694

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  695  LFIDGKAELYVS  706



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   478 bits (1229),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 233/251 (93%), Positives = 243/251 (97%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEI+DALERIIAGPEKKNAVVS++KKKLVAYH
Sbjct  470  GFTGADLQNLMNEAAILAARRDLKEISKDEIADALERIIAGPEKKNAVVSEDKKKLVAYH  529

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGG TFFAPSEERLESGLYSRSYLENQM VALG
Sbjct  530  EAGHALVGALMPEYDPVAKISIIPRGQAGGFTFFAPSEERLESGLYSRSYLENQMVVALG  589

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEV FG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIGQIA+G  GGNPFLGQ M
Sbjct  590  GRVAEEVSFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQIAVGASGGNPFLGQMM  649

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VD EVRELVE AYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS
Sbjct  650  SSQKDYSMATADIVDGEVRELVETAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  709

Query  119  LFIDGKAELFV  87
            LFIDGKAEL+V
Sbjct  710  LFIDGKAELYV  720



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   471 bits (1213),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 248/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYH
Sbjct  454  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYH  513

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYD VAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  514  EAGHALVGALMPEYDAVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  573

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIGQ+AIGG GG+PFLGQQM
Sbjct  574  GRIAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGDPFLGQQM  633

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELV+ AYSRA QIITTH+DILHKLAQLLIEKETVDGEEFMS
Sbjct  634  SSQKDYSMATADVVDAEVRELVDTAYSRAKQIITTHVDILHKLAQLLIEKETVDGEEFMS  693

Query  119  LFIDGKAELFVA  84
            LFIDGKAELFVA
Sbjct  694  LFIDGKAELFVA  705



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   470 bits (1210),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/252 (94%), Positives = 246/252 (98%), Gaps = 1/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTG DLQNLMNEAAILAARRDLKEISKDEI+DALERIIAGPEKKNAVVS+EKKKLVAYH
Sbjct  456  GFTGVDLQNLMNEAAILAARRDLKEISKDEIADALERIIAGPEKKNAVVSEEKKKLVAYH  515

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  516  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  575

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEV FG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  576  GRVAEEV-FGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  634

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  635  SSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMS  694

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  695  LFIDGKAELYVS  706



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score =   461 bits (1186),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 224/251 (89%), Positives = 239/251 (95%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVS+E+KKLVAYH
Sbjct  377  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSEERKKLVAYH  436

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRG AGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  437  EAGHALVGALMPEYDPVAKISIIPRGGAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  496

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEEVIFG +NVTTGASNDF QVSRVARQMVERFGFS KIGQ+A+GG GGNPFLGQQ+
Sbjct  497  GRIAEEVIFGPENVTTGASNDFQQVSRVARQMVERFGFSNKIGQVALGGSGGNPFLGQQL  556

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S Q DYSMATADVVDAEVRELVE AY+RA  +ITTH++ILHKLA LLIEKETVDGEEF+S
Sbjct  557  SQQSDYSMATADVVDAEVRELVESAYARAKHLITTHVEILHKLANLLIEKETVDGEEFLS  616

Query  119  LFIDGKAELFV  87
            LF+DG AEL++
Sbjct  617  LFVDGNAELYL  627



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   463 bits (1191),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/252 (94%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  454  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  513

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  514  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  573

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQQM
Sbjct  574  GRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQQM  633

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY+RATQIITT IDILHKLAQLLIEKETVDGEEFMS
Sbjct  634  SSQKDYSMATADIVDAEVRELVEKAYARATQIITTQIDILHKLAQLLIEKETVDGEEFMS  693

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  694  LFIDGQAELYVS  705



>dbj|BAH20236.1| AT5G42270 [Arabidopsis thaliana]
Length=510

 Score =   455 bits (1171),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 247/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  259  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  318

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  319  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  378

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ M
Sbjct  379  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSM  438

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKLAQLLIEKETVDGEEFMS
Sbjct  439  SSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKLAQLLIEKETVDGEEFMS  498

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  499  LFIDGQAELYVS  510



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   460 bits (1183),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 248/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  458  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  517

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  518  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  577

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ M
Sbjct  578  GRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSM  637

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AY+RAT+IITT IDILHKLAQLL+EKETVDGEEFMS
Sbjct  638  SSQKDYSMATADVVDAEVRELVEKAYARATEIITTQIDILHKLAQLLMEKETVDGEEFMS  697

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  698  LFIDGQAELYVS  709



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   459 bits (1182),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/252 (92%), Positives = 248/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  457  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  516

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  517  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  576

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ M
Sbjct  577  GRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSM  636

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AY+RAT+I+TT IDILHKLAQLL+EKETVDGEEFMS
Sbjct  637  SSQKDYSMATADVVDAEVRELVEKAYARATEIVTTQIDILHKLAQLLMEKETVDGEEFMS  696

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  697  LFIDGQAELYVS  708



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   459 bits (1182),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/252 (92%), Positives = 248/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  456  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  515

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  516  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  575

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ M
Sbjct  576  GRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSM  635

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AY+RAT+I+TT IDILHKLAQLL+EKETVDGEEFMS
Sbjct  636  SSQKDYSMATADVVDAEVRELVEKAYARATEIVTTQIDILHKLAQLLMEKETVDGEEFMS  695

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  696  LFIDGQAELYVS  707



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   459 bits (1180),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 247/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  450  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  509

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  510  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  569

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ M
Sbjct  570  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSM  629

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKLAQLLIEKETVDGEEFMS
Sbjct  630  SSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKLAQLLIEKETVDGEEFMS  689

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  690  LFIDGQAELYVS  701



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   459 bits (1180),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 234/252 (93%), Positives = 247/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  453  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  512

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  513  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  572

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ M
Sbjct  573  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSM  632

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKLAQLLIEKETVDGEEFMS
Sbjct  633  SSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKLAQLLIEKETVDGEEFMS  692

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  693  LFIDGQAELYVS  704



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   458 bits (1179),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 231/252 (92%), Positives = 249/252 (99%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  455  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  514

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISI+PRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  515  EAGHALVGALMPEYDPVAKISILPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  574

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPF+GQQM
Sbjct  575  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFMGQQM  634

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVE+AY+RA +I+TT IDILHKLAQLLIEKETVDGEEFMS
Sbjct  635  SSQKDYSMATADIVDAEVRELVEKAYARAKEIVTTQIDILHKLAQLLIEKETVDGEEFMS  694

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  695  LFIDGQAELYVS  706



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   458 bits (1178),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 236/252 (94%), Positives = 246/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEI+DALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  454  GFTGADLQNLMNEAAILAARRELKEISKDEIADALERIIAGPEKKNAVVSEEKKRLVAYH  513

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  514  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  573

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGG GGNPFLGQQM
Sbjct  574  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGGGGNPFLGQQM  633

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ KDYSMATADVVD EVRELVE AY RAT+I+ THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  634  ASSKDYSMATADVVDGEVRELVETAYKRATEIVNTHIDILHKLAQLLIEKETVDGEEFMS  693

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  694  LFIDGKAELYVS  705



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score =   454 bits (1168),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 247/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEI+DALERIIAGPEKKNAVVS+EKKKLVAYH
Sbjct  447  GFTGADLQNLMNEAAILAARRELKEISKDEIADALERIIAGPEKKNAVVSEEKKKLVAYH  506

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  507  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  566

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQ M
Sbjct  567  GRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQSM  626

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VDAEVRELVERAY RAT IITT IDILHKLAQLLIEKETVDGEEFMS
Sbjct  627  SSQKDYSMATADIVDAEVRELVERAYERATTIITTQIDILHKLAQLLIEKETVDGEEFMS  686

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+++
Sbjct  687  LFIDGKAELYIS  698



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   452 bits (1164),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 223/230 (97%), Positives = 226/230 (98%), Gaps = 0/230 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  433  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  492

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  493  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  552

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVER GFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  553  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERLGFSKKIGQVAIGGGGGNPFLGQQM  612

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEK  150
            STQKDYSMATADVVD+EVRELVE+AY RA QIITTHIDILHKLAQLLIEK
Sbjct  613  STQKDYSMATADVVDSEVRELVEKAYERAKQIITTHIDILHKLAQLLIEK  662



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   452 bits (1163),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 230/252 (91%), Positives = 247/252 (98%), Gaps = 0/252 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS++KK+LVAYH
Sbjct  459  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEDKKRLVAYH  518

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYD VAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  519  EAGHALVGALMPEYDAVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  578

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ M
Sbjct  579  GRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSM  638

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVR+LVE+AY+RAT+I+TT IDILHKLAQLL+EKETVDGEEFMS
Sbjct  639  SSQKDYSMATADVVDAEVRKLVEKAYARATEIVTTQIDILHKLAQLLMEKETVDGEEFMS  698

Query  119  LFIDGKAELFVA  84
            LFIDG+AEL+V+
Sbjct  699  LFIDGQAELYVS  710



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score =   446 bits (1147),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 214/237 (90%), Positives = 230/237 (97%), Gaps = 0/237 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  397  GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  456

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHAL G   PEY+PVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMA +LG
Sbjct  457  EAGHALGGCSYPEYNPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMACSLG  516

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIGQ+A+GGPGGNPF+GQQM
Sbjct  517  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQM  576

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEE  129
            S+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKLAQLLIEKETV GE+
Sbjct  577  SSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVAGED  633



>gb|AIS72760.1| ATP-dependent zinc metalloprotease chloroplastic-like protein, 
partial [Rhizophora apiculata]
Length=236

 Score =   427 bits (1097),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  23   GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  82

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  83   EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  142

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  143  GRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  202

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIIT  198
            S+QKDYSMATADVVDAEVRELVE+AY+RA QI+T
Sbjct  203  SSQKDYSMATADVVDAEVRELVEKAYTRAKQIVT  236



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   438 bits (1126),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 238/251 (95%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEI+DALERIIAGPEKKNAVVS+EK+KLVAYH
Sbjct  383  GFTGADLQNLMNEAAILAARRELKEISKDEIADALERIIAGPEKKNAVVSEEKRKLVAYH  442

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  443  EAGHALVGALMPEYDPVAKISIVPRGGAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  502

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+I+G +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+++GG GGNPFLGQ  
Sbjct  503  GRIAEELIYGAENVTTGASNDFMQVSRVARQMVERFGFSKKIGQLSLGGGGGNPFLGQSA  562

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              Q D+SMATADV+DAEVRELVE AY+RA  I+ THIDILHKLA LL+EKETVDGEEF++
Sbjct  563  GQQSDHSMATADVIDAEVRELVETAYTRAKTIMETHIDILHKLAALLLEKETVDGEEFLN  622

Query  119  LFIDGKAELFV  87
            LFIDG+AEL+V
Sbjct  623  LFIDGQAELYV  633



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   436 bits (1120),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 216/251 (86%), Positives = 237/251 (94%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEI+DALERIIAGPEKKNAVVS+EK+ LVAYH
Sbjct  396  GFTGADLQNLMNEAAILAARRELKEISKDEIADALERIIAGPEKKNAVVSEEKRTLVAYH  455

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  456  EAGHALVGALMPEYDPVAKISIVPRGGAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  515

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+I+G +NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+++GG GGNPFLGQ  
Sbjct  516  GRIAEELIYGTENVTTGASNDFMQVSRVARQMVERFGFSKKIGQLSLGGGGGNPFLGQSA  575

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              Q D+SMATADV+DAEVRELVE AY+RA  I+ THIDILHKLA LL+EKETVDGEEF++
Sbjct  576  GQQSDHSMATADVIDAEVRELVETAYTRAKTIMETHIDILHKLAALLLEKETVDGEEFLN  635

Query  119  LFIDGKAELFV  87
            LFIDG+AEL+V
Sbjct  636  LFIDGQAELYV  646



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   434 bits (1115),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 223/252 (88%), Positives = 232/252 (92%), Gaps = 17/252 (7%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  448  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  507

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
                             AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  508  -----------------AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  550

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  551  GRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  610

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  611  SSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKLAQLLMEKETVDGEEFMS  670

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  671  LFIDGKAELYVS  682



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   431 bits (1108),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 224/252 (89%), Gaps = 27/252 (11%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH
Sbjct  468  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  527

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
                                       AGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  528  ---------------------------AGGLTFFAPSEERLESGLYSRSYLENQMAVALG  560

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGGPGGNPFLGQQM
Sbjct  561  GRVAEEVIFGDDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQM  620

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKLAQLL+EKETVDGEEFMS
Sbjct  621  SSQKDYSMATADVVDAEVRELVEKAYSRAKQIITTHIDILHKLAQLLVEKETVDGEEFMS  680

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  681  LFIDGKAELYVS  692



>dbj|BAH20250.1| AT5G42270 [Arabidopsis thaliana]
Length=215

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISKDEISDALERIIAGPEKKNAVVS+EKK+LVAYH
Sbjct  17   GFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYH  76

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  77   EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  136

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+A+GG GGNPFLGQ M
Sbjct  137  GRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAVGGAGGNPFLGQSM  196

Query  299  STQKDYSMATADVVDAEVR  243
            S+QKDYSMATADVVDAEVR
Sbjct  197  SSQKDYSMATADVVDAEVR  215



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score =   384 bits (986),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/251 (73%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISK+EISDALERI+AGPEKK AV+++ KK+LVAYH
Sbjct  469  GFTGADLQNLMNEAAILAARRNLKEISKEEISDALERIVAGPEKKGAVMTEAKKRLVAYH  528

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  529  EAGHALVGALMPEYDPVAKISIVPRGSAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  588

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGEDNVTTGASNDFMQV+R A+ MV + GFSKK+GQ+A  G GG  FLGQ M
Sbjct  589  GRIAEEIIFGEDNVTTGASNDFMQVARTAKMMVTQMGFSKKLGQVAWSGGGGPSFLGQSM  648

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
                D S  T+D +DAEV++LV+RAY RA  ++ ++I +LHK A++L+E+E +DG+EF+ 
Sbjct  649  GQPADCSGQTSDEIDAEVKQLVDRAYRRAKDLMQSNITVLHKTAEVLLEREQIDGDEFLR  708

Query  119  LFIDGKAELFV  87
            L ++ +AE ++
Sbjct  709  LILESQAENYL  719



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   379 bits (972),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 200/223 (90%), Gaps = 11/223 (5%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVA--  666
            GFTGADLQNLMNEAAILAARRDLKEISKD I+DALERIIAGPEKKN VVS  ++  +   
Sbjct  467  GFTGADLQNLMNEAAILAARRDLKEISKDGITDALERIIAGPEKKNVVVSVRRRNWLPIM  526

Query  665  ---------YHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRS  513
                     + EAGHALVGAL+PEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRS
Sbjct  527  VFDFLYALKFTEAGHALVGALIPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRS  586

Query  512  YLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGG  333
            YLENQMAVAL GR+AEEVIFGE+NVTTGASNDFMQVSRVAR MVERFGFSKKIG++AIGG
Sbjct  587  YLENQMAVALSGRIAEEVIFGEENVTTGASNDFMQVSRVARHMVERFGFSKKIGRVAIGG  646

Query  332  PGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  204
            PGGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AYSRA QI
Sbjct  647  PGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYSRAKQI  689



>gb|KIY93255.1| cell division protease FtsH [Monoraphidium neglectum]
Length=548

 Score =   374 bits (960),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/251 (72%), Positives = 213/251 (85%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR L+EISKDEI+DALERIIAGPEKK AV+SD+KKKLVAYH
Sbjct  284  GFTGADLQNLMNEAAILAARRGLQEISKDEIADALERIIAGPEKKGAVMSDKKKKLVAYH  343

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+Y ENQMAVALG
Sbjct  344  EAGHALVGALMPDYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYFENQMAVALG  403

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGED++TTGAS DF QV+R AR MV + GFSK +GQ+A    GGN FLGQ M
Sbjct  404  GRIAEELIFGEDDITTGASGDFQQVTRTARLMVTQLGFSKVLGQVAWSSGGGNAFLGQSM  463

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            +   D+S  TAD +D EV+ LVERAY RA  +I ++IDILHK A +L+EKE +DG+EF  
Sbjct  464  AQPADFSSQTADEIDQEVKALVERAYRRAKDLIQSNIDILHKTAAVLLEKENIDGDEFQQ  523

Query  119  LFIDGKAELFV  87
            + ++ +A+ ++
Sbjct  524  IVLESQAQQYL  534



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score =   376 bits (966),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/251 (72%), Positives = 213/251 (85%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR L+EISKDEI+DALERIIAGPEKK AV+SD+KKKLVAYH
Sbjct  470  GFTGADLQNLMNEAAILAARRGLQEISKDEIADALERIIAGPEKKGAVMSDKKKKLVAYH  529

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+Y ENQMAVALG
Sbjct  530  EAGHALVGALMPDYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYFENQMAVALG  589

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGED++TTGAS DF QV+R AR MV + GFSK +GQ+A    GGN FLGQ M
Sbjct  590  GRIAEELIFGEDDITTGASGDFQQVTRTARLMVTQLGFSKALGQVAWSSGGGNAFLGQSM  649

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            +   D+S  TAD +D EV+ LVERAY RA  +I ++IDILHK A +L+EKE +DG+EF  
Sbjct  650  AQPADFSSQTADEIDQEVKSLVERAYRRAKDLIQSNIDILHKTAAVLLEKENIDGDEFQQ  709

Query  119  LFIDGKAELFV  87
            + ++ +A+ ++
Sbjct  710  IVLESQAQQYL  720



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score =   374 bits (959),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 214/251 (85%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISK+EI+DALERIIAGPEKK AV+SD+K++LVAYH
Sbjct  463  GFTGADLQNLMNEAAILAARRNLKEISKEEIADALERIIAGPEKKGAVMSDKKRRLVAYH  522

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+YLENQMAVALG
Sbjct  523  EAGHALVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYLENQMAVALG  582

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGED++TTGAS DF QV+R+AR MV + G SKK+GQ+A    GG  FLG   
Sbjct  583  GRIAEELIFGEDDITTGASGDFQQVTRIARLMVTQLGLSKKLGQVAWSNQGGASFLGASA  642

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            +   D+S +TAD +D+EV+ELVERAY RA  ++  +IDILHK+A +LIEKE +DG+EF  
Sbjct  643  AQPADFSQSTADEIDSEVKELVERAYRRAKDLVEQNIDILHKVAAVLIEKENIDGDEFQQ  702

Query  119  LFIDGKAELFV  87
            + +  +A+ + 
Sbjct  703  IVLASQAQQYT  713



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score =   373 bits (958),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 215/251 (86%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADLQNLMNEAAILAARR+LKEISK+EI+DALERIIAGPEKK AV+S++K++LVAYH
Sbjct  458  GFTGADLQNLMNEAAILAARRNLKEISKEEIADALERIIAGPEKKGAVMSEKKRRLVAYH  517

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+YLENQMAVALG
Sbjct  518  EAGHALVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYLENQMAVALG  577

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGED++TTGAS DF QV+R+AR MV + G SKK+GQ+A    GG  FLG   
Sbjct  578  GRIAEELIFGEDDITTGASGDFQQVTRIARLMVTQLGLSKKLGQVAWSSSGGAQFLGASA  637

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            +   D+S ATAD +D EV+ELVERAY RA  ++ ++IDILHK+A +LIEKE +DG+EF  
Sbjct  638  AQPADFSQATADEIDNEVKELVERAYRRAKDLVVSNIDILHKVAAVLIEKENIDGDEFQQ  697

Query  119  LFIDGKAELFV  87
            + +  +A+ ++
Sbjct  698  IVLASQAQQYL  708



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   364 bits (935),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 180/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  308  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  367

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  368  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  427

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  428  SSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMS  487

Query  119  LFIDGKAELFVA  84
            LFIDGKAEL+V+
Sbjct  488  LFIDGKAELYVS  499



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score =   367 bits (943),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 215/251 (86%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NLMNE+AI+AARR+L EISK+EI+DALERI+AG  K+ AV+S++KK+LVAYH
Sbjct  456  GFTGADLANLMNESAIIAARRELTEISKEEIADALERIVAGAAKEGAVMSEKKKRLVAYH  515

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYSRSYLENQMAVA+G
Sbjct  516  EAGHAIVGALMPEYDPVAKISIVPRGAAGGLTFFAPSEERLESGLYSRSYLENQMAVAMG  575

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFG ++VTTGAS DF QVS+ ARQM+E  GFSKKIGQIA+   GG  FLG +M
Sbjct  576  GRVAEELIFGAEDVTTGASGDFQQVSQTARQMIETMGFSKKIGQIALKTGGGQSFLGGEM  635

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
                DY  ATAD+VD+EV+ELV +AY RA  +++ +ID+LHK+A +L+EKE +DG+EF  
Sbjct  636  GRSADYGPATADLVDSEVKELVTKAYRRAKDLVSINIDVLHKVADVLMEKENIDGDEFEK  695

Query  119  LFIDGKAELFV  87
            +  + K+EL++
Sbjct  696  IMFNAKSELYL  706



>ref|WP_029963924.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_526K3]
Length=337

 Score =   349 bits (895),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  85   GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  144

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  145  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  204

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  205  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  264

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  265  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  324

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  325  LL--NRSEVKVA  334



>ref|WP_025947145.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_528N8]
Length=347

 Score =   349 bits (895),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  95   GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  154

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  155  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  214

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  215  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  274

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  275  SSSRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  334

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  335  LL--NRSEVKVA  344



>ref|WP_006518079.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV03719.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=614

 Score =   356 bits (914),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 211/249 (85%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKSLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRGQAGGLT+F PSEERLESGLYSRSYL+NQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGQAGGLTWFTPSEERLESGLYSRSYLKNQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FG++ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   GNPFLG+ +
Sbjct  482  GRLAEEIVFGDEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQGNPFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            +T++D+S  TA V+DAEVR LV+ AYSRA Q++  +  +L +LA +L++KETVD +E   
Sbjct  542  ATERDFSEETAAVIDAEVRSLVDVAYSRAKQVLVENRKVLDQLADMLVDKETVDSDELQR  601

Query  119  LFIDGKAEL  93
            L ID    +
Sbjct  602  LLIDNNVSM  610



>ref|WP_023072541.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36713.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=614

 Score =   356 bits (913),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/249 (67%), Positives = 212/249 (85%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKSLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRGQAGGLT+F PSEERLESGLYSRSYL+NQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGQAGGLTWFTPSEERLESGLYSRSYLKNQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FG++ VTTGASND  QV+RVARQM+ RFG S+K+G +A+G   GNPFLG+ +
Sbjct  482  GRLAEEIVFGDEEVTTGASNDLQQVARVARQMITRFGMSEKLGPVALGRQQGNPFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            +T++D+S  TA V+DAEVR LV+ AYSRA Q++  +  +L +LA++L++KETVD +E   
Sbjct  542  ATERDFSEETAAVIDAEVRGLVDVAYSRAKQVLVENRKVLDQLAEMLVDKETVDSDELQR  601

Query  119  LFIDGKAEL  93
            L ID    +
Sbjct  602  LLIDNNVSM  610



>ref|WP_025970576.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521M10]
Length=396

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  144  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  203

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  204  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  263

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  264  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  323

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  324  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  383

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  384  LL--NRSEVKVA  393



>ref|WP_025954333.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_498C16]
Length=445

 Score =   347 bits (890),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  193  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  252

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  253  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  312

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G  FLG+ M
Sbjct  313  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDM  372

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  373  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQE  432

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  433  LL--NRSEVKVA  442



>ref|WP_025971093.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521N5]
Length=471

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  219  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  278

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  279  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  338

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  339  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  398

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  399  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  458

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  459  LL--NRSEVKVA  468



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score =   355 bits (910),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 206/251 (82%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NLMNEAAILAARR L EISKDEI+DALER++AGPEKK AVVS+ K++LVAYH
Sbjct  458  GFTGADLANLMNEAAILAARRGLSEISKDEIADALERLVAGPEKKGAVVSESKRRLVAYH  517

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            E GHALVGALMPEYD V+KISI+PRG AGGLTFFAPSEERLE+GLYSRSYLENQM+VALG
Sbjct  518  EGGHALVGALMPEYDAVSKISIVPRGNAGGLTFFAPSEERLENGLYSRSYLENQMSVALG  577

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+I G DNVTTGAS DF QV+RVAR MVE+ GFS  +GQ+A    GG  FLG QM
Sbjct  578  GRVAEELILGPDNVTTGASGDFQQVTRVARMMVEQMGFSDSLGQVAWSQSGGGSFLGAQM  637

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            +   + S  T D++D EV+ LV+RAY RA  +I  +I +LH+ A++L+EKE +DGEE  +
Sbjct  638  AQPANCSGETQDIIDKEVKSLVDRAYRRAKDLIQNNISVLHRTAEILLEKEQMDGEELQA  697

Query  119  LFIDGKAELFV  87
            L ++ ++E ++
Sbjct  698  LLLEAQSEQYL  708



>ref|WP_044452063.1| cell division protein FtsH, partial [Mastigocladus laminosus]
 gb|KIY10627.1| cell division protein FtsH, partial [Mastigocladus laminosus 
UU774]
Length=405

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  153  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYH  212

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  213  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  272

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   GN FLG+ +
Sbjct  273  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQGNMFLGRDI  332

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +LA++L+EKETVD EE   
Sbjct  333  MSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQLAEMLVEKETVDAEELQD  392

Query  119  LF  114
            L 
Sbjct  393  LL  394



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score =   353 bits (907),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 209/251 (83%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GF+GA LQNL+NEAAILAARRDL EISK+EI+DALERI+AG  K+ AV+S++KK+LVAYH
Sbjct  454  GFSGAALQNLLNEAAILAARRDLTEISKEEIADALERIVAGAAKEGAVMSEKKKRLVAYH  513

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+YLENQMAVA+G
Sbjct  514  EAGHAIVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYSRTYLENQMAVAMG  573

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFG +NVTTGAS DF QVSR AR M+E+ GFS+KIGQIA+   GG  FLG   
Sbjct  574  GRVAEELIFGAENVTTGASGDFQQVSRTARMMIEQMGFSEKIGQIALKTGGGQTFLGNDA  633

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
                DYS ATAD+VD+EV+ LVE AY RA  ++  +I  LH +A++L++KE +DG+EF  
Sbjct  634  GRGADYSQATADIVDSEVQALVEVAYRRAKDLVQENIQCLHDVAEVLLDKENIDGDEFEQ  693

Query  119  LFIDGKAELFV  87
            + +  KA+L++
Sbjct  694  IMLKAKAKLYL  704



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score =   353 bits (905),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/251 (67%), Positives = 207/251 (82%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GF+GA LQNL+NEAAILAARRDL EISK+EI+DALERI+AG  K+ AV+S++KK+LVAYH
Sbjct  465  GFSGAALQNLLNEAAILAARRDLTEISKEEIADALERIVAGAAKEGAVMSEKKKRLVAYH  524

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYSR+YLENQMAVA+G
Sbjct  525  EAGHAIVGALMPEYDPVTKISIVPRGNAGGLTFFAPSEERLESGLYSRTYLENQMAVAMG  584

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFG +NVTTGAS DF QVS  AR MVE+ GFS+KIGQIA+   GG  FLG   
Sbjct  585  GRIAEELIFGAENVTTGASGDFQQVSNTARMMVEQMGFSEKIGQIALKTGGGQSFLGNDA  644

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
                DYS  TA++VD EV+ LVE AY RA  ++  +ID LH +A++L+EKE +DG+EF  
Sbjct  645  GRAADYSQTTANIVDDEVKILVETAYRRAKDLVQENIDCLHAVAEVLLEKENIDGDEFEE  704

Query  119  LFIDGKAELFV  87
            + +  +A+L++
Sbjct  705  IMLKARAKLYL  715



>gb|ABX08179.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9211]
Length=602

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DE+SDA+ER++AGPEKK+ V+SD +K+LVAYH
Sbjct  350  GFTGADLANLLNEAAILAARRELSEVSNDEVSDAIERVMAGPEKKDRVMSDRRKRLVAYH  409

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL NQMAVALG
Sbjct  410  EAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLHNQMAVALG  469

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  470  GRVAEEIVYGEDEVTTGASNDLKQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  529

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +D EV +LV+ AY RAT+++T +  +L +LA++L+EKETV+ E+   
Sbjct  530  ASERDFSEDTAATIDEEVSQLVDMAYKRATKVLTNNRQVLDQLAEMLVEKETVNSEDLQD  589

Query  119  LFIDGKAEL  93
            L I  + E+
Sbjct  590  LLIQSQVEV  598



>ref|WP_041391000.1| cell division protein FtsH [Prochlorococcus marinus]
Length=615

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DE+SDA+ER++AGPEKK+ V+SD +K+LVAYH
Sbjct  363  GFTGADLANLLNEAAILAARRELSEVSNDEVSDAIERVMAGPEKKDRVMSDRRKRLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL NQMAVALG
Sbjct  423  EAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLHNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  483  GRVAEEIVYGEDEVTTGASNDLKQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +D EV +LV+ AY RAT+++T +  +L +LA++L+EKETV+ E+   
Sbjct  543  ASERDFSEDTAATIDEEVSQLVDMAYKRATKVLTNNRQVLDQLAEMLVEKETVNSEDLQD  602

Query  119  LFIDGKAEL  93
            L I  + E+
Sbjct  603  LLIQSQVEV  611



>ref|WP_025958220.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L15]
Length=538

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  286  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  345

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  346  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  405

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  406  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  465

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  466  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  525

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  526  LL--NRSEVKVA  535



>gb|KGF94553.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9201]
Length=580

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  328  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  387

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  388  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  447

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  448  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  507

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T + ++L ++AQ+LIE+ET+D E+   
Sbjct  508  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRNVLDEMAQMLIERETIDTEDIQD  567

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  568  LL--NRSEVKVA  577



>ref|WP_032522853.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T + ++L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRNVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_036973151.1| cell division protein FtsH, partial [Prochlorococcus sp. MIT 
0703]
Length=402

 Score =   341 bits (875),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 205/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  150  GFTGADLANLLNEAAILAARRELTEVSNDEISDAIERVMAGPEKKDRVMSERRKQLVAYH  209

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            E+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  210  ESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  269

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  270  GRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  329

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKETVD ++   
Sbjct  330  ASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKETVDAQDLQE  389

Query  119  LFI  111
            L I
Sbjct  390  LLI  392



>ref|WP_025971671.1| cell division protein FtsH [Prochlorococcus sp. scB241_527L22]
Length=617

 Score =   348 bits (892),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>gb|KGG03814.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG10073.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9401]
Length=580

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  328  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  387

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  388  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  447

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  448  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  507

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  508  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEMAQMLIERETIDTEDIQD  567

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  568  LL--NRSEVVVA  577



>gb|KGG30054.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0703]
Length=397

 Score =   341 bits (874),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 205/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  145  GFTGADLANLLNEAAILAARRELTEVSNDEISDAIERVMAGPEKKDRVMSERRKQLVAYH  204

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            E+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  205  ESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  264

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  265  GRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  324

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKETVD ++   
Sbjct  325  ASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKETVDAQDLQE  384

Query  119  LFI  111
            L I
Sbjct  385  LLI  387



>ref|WP_025935637.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   348 bits (892),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_035992112.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=613

 Score =   348 bits (892),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  361  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKELVAYH  420

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+RLESGLYSRSYL+NQMAVALG
Sbjct  421  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRLESGLYSRSYLQNQMAVALG  480

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   GN FLG+ +
Sbjct  481  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDI  540

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +DAEVR LV++AY+RA Q++T +  +L +LA++L++KETVD EE   
Sbjct  541  AAERDFSEETAATIDAEVRGLVDQAYARAKQVLTNNRHVLDQLAKMLVDKETVDSEELQH  600

Query  119  LF  114
            L 
Sbjct  601  LL  602



>ref|WP_015191439.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 gb|AFZ33766.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=616

 Score =   348 bits (892),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K+LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKELVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  484  GRIAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLGPVALGRQSGNVFLGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LV++AY RA +++  +  IL KLA +L+EKETVD EEF  
Sbjct  544  ASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLVGNRHILDKLADMLVEKETVDSEEFQD  603

Query  119  LFIDGKAEL  93
            L  +   ++
Sbjct  604  LLANNDVKM  612



>ref|WP_025969610.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520E22]
Length=617

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKQLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025944375.1| cell division protein FtsH [Prochlorococcus sp. scB241_529C4]
Length=617

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 209/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL  +S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDTVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025900256.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQE  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_032519670.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG08326.1| Cell division protein FtsH [Prochlorococcus marinus str. SB]
Length=617

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025922112.1| cell division protein FtsH [Prochlorococcus sp. scB241_529D18]
Length=617

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025939914.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   347 bits (891),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025890345.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025964562.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P15]
Length=617

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025924120.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025967396.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P3]
Length=617

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGLFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025980194.1| cell division protein FtsH [Prochlorococcus sp. scB243_498F21]
Length=617

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_044106285.1| cell division protein FtsH [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17558.1| cell division protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=616

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  484  GRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGMSDRLGPVALGRQNGNVFLGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA V+D EVR+LV  AY RA  ++  +  IL KLA++L+EKETVD EE  S
Sbjct  544  ASDRDFSDETAAVIDEEVRQLVNNAYIRAKDVLVNNRHILDKLAEMLVEKETVDAEELQS  603

Query  119  LF  114
            + 
Sbjct  604  IL  605



>gb|KGG06312.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9322]
Length=600

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  348  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  407

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  408  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  467

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  468  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  527

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  528  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEMAQMLIERETIDTEDIQD  587

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  588  LL--NRSEVVVA  597



>ref|WP_032515715.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG01911.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9314]
Length=617

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025951376.1| cell division protein FtsH [Prochlorococcus sp. scB243_495N4]
Length=617

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSSRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_009455956.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC16019.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=614

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   GN FLG+ +
Sbjct  482  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR+LV+ AY+RA Q++T +  +L +LAQ+L+EKETVD EE   
Sbjct  542  MSERDFSEETAAAIDEEVRQLVDSAYARAKQVLTDNRHVLDQLAQMLVEKETVDAEELQE  601

Query  119  LF  114
            L 
Sbjct  602  LL  603



>ref|WP_017297226.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=613

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  361  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKELVAYH  420

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+RLESGLYSRSYL+NQMAVALG
Sbjct  421  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRLESGLYSRSYLQNQMAVALG  480

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   GN FLG+ +
Sbjct  481  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDI  540

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D+EVR LV++AY+RA Q++T +  +L +LA +L++KETVD EE   
Sbjct  541  AAERDFSEETAATIDSEVRGLVDQAYTRAKQVLTNNRHVLDQLANMLVDKETVDSEELQQ  600

Query  119  LF  114
            L 
Sbjct  601  LL  602



>gb|KGF88464.1| cell division protein FtsH2 [Prochlorococcus marinus str. GP2]
Length=580

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  328  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  387

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  388  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  447

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  448  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  507

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  508  SSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  567

Query  119  LF  114
            L 
Sbjct  568  LL  569



>ref|WP_025892538.1| cell division protein FtsH [Prochlorococcus sp. scB241_527N11]
Length=617

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_032517345.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVVVA  614



>ref|WP_006911156.1| cell division protein FtsH [Cyanobium sp. PCC 7001]
 gb|EDY39239.1| ATP-dependent metalloprotease FtsH [Cyanobium sp. PCC 7001]
Length=614

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/243 (68%), Positives = 204/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR L E+S DE++DA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  362  GFTGADLANLLNEAAILAARRQLTEVSMDEVNDAIERVMAGPEKKDRVMSERRKRLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+I+G+D VTTGASND  QV+RVARQMV RFG S+K+G +A+G   G  FLG+ +
Sbjct  482  GRVAEEIIYGDDEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRSQGGMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV +LVE AY RAT+++T +  +L +LA LL+EKETVD EE   
Sbjct  542  AAERDFSEDTAATIDEEVSQLVEEAYRRATEVLTNNRAVLDQLADLLVEKETVDAEELQE  601

Query  119  LFI  111
            L I
Sbjct  602  LLI  604



>ref|WP_002806664.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|EEE40173.1| ATP-dependent metallopeptidase HflB subfamily protein [Prochlorococcus 
marinus str. MIT 9202]
Length=617

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>gb|AIQ94296.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=603

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  351  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  410

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  411  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  470

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  471  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  530

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  531  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  590

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  591  LL--NRSEVKVA  600



>ref|WP_025937982.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519A13]
Length=617

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQE  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVTVA  614



>ref|WP_012593655.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACK64378.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8801]
 gb|ACU99241.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
Length=616

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 207/249 (83%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  484  GRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGMSDRLGPVALGRQNGNVFLGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR+LV++AY RA  ++  +  IL KLAQ+L+EKETVD +E   
Sbjct  544  ASDRDFSDETAAAIDEEVRQLVDQAYKRAKDVLVNNRHILDKLAQMLVEKETVDADELQE  603

Query  119  LFIDGKAEL  93
            +    + ++
Sbjct  604  ILTSNEVKM  612



>ref|WP_032523992.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LF  114
            L 
Sbjct  605  LL  606



>ref|WP_025941250.1| cell division protein FtsH [Prochlorococcus sp. scB245a_518O7]
Length=617

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSQLVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025956453.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQM+VALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMSVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_011817719.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM69535.1| cell division protein FtsH2 [Prochlorococcus marinus str. AS9601]
Length=617

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025971407.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L16]
Length=598

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  346  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  405

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  406  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  465

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  466  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  525

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET++ E+   
Sbjct  526  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETINTEDIQD  585

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  586  LL--NRSEVKVA  595



>ref|WP_025925903.1| cell division protein FtsH [Prochlorococcus sp. scB241_528J8]
Length=617

 Score =   346 bits (887),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025914082.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520K10]
Length=617

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_028953545.1| cell division protein FtsH [Synechococcus sp. CC9616]
Length=615

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 165/243 (68%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            G+TGADL NL+NEAAILAARR+L E+S DEISDA+ERI+ GPEKK+AV+S+ KK+LVAYH
Sbjct  363  GYTGADLANLLNEAAILAARRELTEVSNDEISDAIERIMVGPEKKDAVISERKKRLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  423  EAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+I+GED VTTGASND  QV++VARQM+ RFG S K+G +A+G   G  FLG+ +
Sbjct  483  GRVAEEIIYGEDEVTTGASNDLQQVAQVARQMITRFGMSDKLGPVALGRSQGGMFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV +LV+ AY RATQ++  +  +L +LA LL+EKETVD EE   
Sbjct  543  AAERDFSEDTASTIDQEVYDLVDVAYKRATQVLVDNRSVLDELADLLVEKETVDAEELQE  602

Query  119  LFI  111
            L I
Sbjct  603  LLI  605



>ref|WP_025979191.1| cell division protein FtsH [Prochlorococcus sp. scB243_497E17]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025921388.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025929709.1| cell division protein FtsH [Prochlorococcus sp. scB241_528O2]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  IL ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDEEVSELVDMAYKRATKVLSDNRTILDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025933036.1| cell division protein FtsH [Prochlorococcus sp. scB243_498A3]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_012007029.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABV49865.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9215]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_017320405.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=614

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKQLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV R+G S+K+G +A+G   GN FLG+ +
Sbjct  482  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRYGMSEKLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              ++D+S  TA  +D EVR+LV+ AY RA Q++T +  IL +LAQLL+EKETVD EE   
Sbjct  542  MAERDFSEETAAAIDEEVRKLVDAAYKRAKQVLTENRHILDQLAQLLMEKETVDAEELQE  601

Query  119  LF  114
            L 
Sbjct  602  LL  603



>ref|WP_025937318.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519O21]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025981174.1| cell division protein FtsH [Prochlorococcus sp. scB245a_521B10]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET++ E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETINTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025959316.1| cell division protein FtsH [Prochlorococcus sp. scB241_527I9]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 209/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTG DL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGPDLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025925013.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET++ E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETINTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_042849723.1| cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_010871638.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 ref|NP_440330.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 sp|P72991.1|FTSH3_SYNY3 RecName: Full=ATP-dependent zinc metalloprotease FtsH 3 [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA17010.1| cell division protein; FtsH [Synechocystis sp. PCC 6803]
 dbj|BAK49182.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 dbj|BAL28181.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31351.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34520.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50723.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 gb|AGF50699.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
Length=616

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 209/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G  GG  FLG+ +
Sbjct  484  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQGGGVFLGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EV +LV++AY RA Q++  +  IL +LA++L+EKETVD EE  +
Sbjct  544  ASDRDFSDETAAAIDEEVSQLVDQAYQRAKQVLVENRGILDQLAEILVEKETVDSEELQT  603

Query  119  LFIDGKAEL  93
            L  +  A+L
Sbjct  604  LLANNNAKL  612



>ref|WP_008275101.1| cell division protein FtsH [Cyanothece sp. CCY0110]
 gb|EAZ91781.1| cell division protein; FtsH [Cyanothece sp. CCY0110]
Length=617

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR+LV+ AYSRA  ++ ++  IL +LA +L+EKETVD +E   
Sbjct  545  ASDRDFSNETASTIDNEVRQLVDTAYSRAKDVLESNRHILDRLADMLVEKETVDSDELQE  604

Query  119  LF  114
            + 
Sbjct  605  IL  606



>ref|WP_011862269.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABO16871.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9301]
Length=617

 Score =   345 bits (886),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+S++KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISEKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_025965256.1| cell division protein FtsH [Prochlorococcus sp. scB243_496M6]
Length=617

 Score =   345 bits (886),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDIAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_002797753.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI26104.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9809]
Length=617

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQN  604

Query  119  LFIDGKAEL  93
            +  +   ++
Sbjct  605  ILANNDVKM  613



>ref|WP_002784350.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa]
 emb|CCI13887.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9806]
Length=617

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQN  604

Query  119  LFIDGKAEL  93
            +  +   ++
Sbjct  605  ILANNDVKM  613



>dbj|GAL91410.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=617

 Score =   345 bits (885),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRTILDQLAQMLVEKETVDAEELQN  604

Query  119  LFIDGKAEL  93
            +  +   ++
Sbjct  605  ILANNDVKM  613



>ref|WP_017312914.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=614

 Score =   345 bits (884),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   GN FLG+ +
Sbjct  482  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +LA++L+EKETVD EE   
Sbjct  542  MSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQLAEMLVEKETVDAEELQD  601

Query  119  LF  114
            L 
Sbjct  602  LL  603



>ref|WP_011375794.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABB49290.1| membrane protease FtsH catalytic subunit [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGG00943.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9311]
Length=617

 Score =   345 bits (885),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDIAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LF  114
            L 
Sbjct  605  LL  606



>ref|WP_002763074.1| MULTISPECIES: cell division protein FtsH [Microcystis]
 emb|CCH99625.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9717]
 emb|CCI33922.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis sp. T1-4]
Length=617

 Score =   345 bits (885),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQN  604

Query  119  LFIDGKAEL  93
            +  +   ++
Sbjct  605  ILANNDVKM  613



>ref|WP_032514590.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF89182.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF89938.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF95373.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9123]
Length=617

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  TSSRDFSEDTAATIDEEVSELVDIAYKRATKVLSDNRTVLDEMAQMLIERETIDTEDIQD  604

Query  119  LF  114
            L 
Sbjct  605  LL  606



>ref|WP_016862523.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   GN FLG+ +
Sbjct  482  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +LA++L+EKETVD EE   
Sbjct  542  MSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQLAEMLVEKETVDAEELQD  601

Query  119  LF  114
            L 
Sbjct  602  LL  603



>ref|WP_002771354.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI04533.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9443]
Length=617

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQN  604

Query  119  LF  114
            + 
Sbjct  605  IL  606



>ref|WP_002793446.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI24284.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9808]
Length=617

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQN  604

Query  119  LF  114
            + 
Sbjct  605  IL  606



>ref|WP_002742170.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CAO87142.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94297.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9432]
 emb|CCI05461.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 7941]
 emb|CCI18127.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9807]
 gb|ELS49082.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21392.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
SPC777]
Length=617

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQN  604

Query  119  LF  114
            + 
Sbjct  605  IL  606



>ref|WP_026723275.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=614

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G +A+G   GN FLG+ +
Sbjct  482  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR+LV+ AY+RA +++T +  +L +LA++L+EKETVD EE   
Sbjct  542  MSERDFSEETAAAIDEEVRQLVDSAYARAKKVLTDNRHVLDQLAEMLVEKETVDAEELQD  601

Query  119  LF  114
            L 
Sbjct  602  LL  603



>ref|WP_002737367.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa]
 gb|ELP54710.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
TAIHU98]
Length=617

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQLAQMLVEKETVDAEELQN  604

Query  119  LF  114
            + 
Sbjct  605  IL  606



>ref|WP_002801795.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI35504.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9701]
Length=617

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRVILDQLAQMLVEKETVDAEELQN  604

Query  119  LFIDGKAEL  93
            +  +   ++
Sbjct  605  ILANNDVKM  613



>ref|WP_012264056.1| cell division protein FtsH [Microcystis aeruginosa]
 dbj|BAG00204.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=617

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRAYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +LAQ+L+EKETVD EE  +
Sbjct  545  ASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRVILDQLAQMLVEKETVDAEELQN  604

Query  119  LF  114
            + 
Sbjct  605  IL  606



>ref|WP_016867387.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKQLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   GN FLG+ +
Sbjct  482  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EV +LV+ AY+RA Q++T +  IL +LA++L+EKETVD EE   
Sbjct  542  MSERDFSEETAAAIDEEVHQLVDSAYARAKQVLTDNRHILDQLAEMLVEKETVDAEELQE  601

Query  119  LF  114
            L 
Sbjct  602  LL  603



>ref|WP_038542994.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
 gb|AII42342.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
Length=615

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 203/244 (83%), Gaps = 0/244 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            G+TGADL NL+NEAAILAARR+L E+S DEISDA+ERI+ GPEKK+AV+S+ KK+LVAYH
Sbjct  363  GYTGADLANLLNEAAILAARRELTEVSNDEISDAIERIMVGPEKKDAVISERKKRLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  423  EAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+I+GED VTTGASND  QV++VARQM+ RFG S K+G +A+G   G  FLG+ +
Sbjct  483  GRVAEEIIYGEDEVTTGASNDLQQVAQVARQMITRFGMSDKLGPVALGRSQGGMFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV +LV+ AY RAT+++  +  +L +LA LL+EKETVD EE   
Sbjct  543  AAERDFSEDTASTIDQEVYDLVDVAYKRATKVLVDNRLVLDELADLLVEKETVDAEELQE  602

Query  119  LFID  108
            L I+
Sbjct  603  LLIN  606



>ref|WP_009545257.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACB52927.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=617

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  365  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  485  GRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR+LV+ AY RA  ++ ++  IL +LA +L+EKETVD +E   
Sbjct  545  ASDRDFSNETASTIDEEVRQLVDTAYKRAKDVLESNRHILDRLADMLVEKETVDSDELQE  604

Query  119  LF  114
            + 
Sbjct  605  IL  606



>ref|WP_015220601.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 gb|AFZ54879.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=615

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 209/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S ++K+LVAYH
Sbjct  363  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSQKRKELVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDP+ KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  423  EAGHALVGALMPDYDPIQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE++FGE+ VTTGASND  QV+RVARQM+ RFG S+++G +A+G   GN FLG+ +
Sbjct  483  GRVAEEIVFGEEEVTTGASNDLQQVARVARQMITRFGMSERLGPVALGRQNGNVFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S +TA ++D EV++LV+ AY RA  ++  + ++L  LAQ+L+EKETVD EE   
Sbjct  543  ASDRDFSDSTAAMIDEEVKKLVDVAYQRAKDVLQNNREVLDTLAQMLVEKETVDSEELQE  602

Query  119  LFIDGKAEL  93
            L  +   +L
Sbjct  603  LLNNNDVKL  611



>ref|WP_015188582.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30709.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=612

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+E+GLYSRSYLENQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMETGLYSRSYLENQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  480  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              ++D+S  TA  +D EVRELVE AY RA +++ ++  IL +LAQ+LI+KETVD EE   
Sbjct  540  VAERDFSEETAAAIDDEVRELVEVAYRRAKEVLVSNRHILDQLAQMLIDKETVDAEELQE  599

Query  119  LF  114
            L 
Sbjct  600  LL  601



>ref|WP_025929131.1| hypothetical protein, partial [Prochlorococcus sp. scB243_496A2]
Length=242

 Score =   330 bits (847),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 201/241 (83%), Gaps = 2/241 (1%)
 Frame = -2

Query  806  NEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALM  627
            NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYHEAGHALVGALM
Sbjct  1    NEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGALM  60

Query  626  PEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGE  447
            P+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALGGRVAEE+++GE
Sbjct  61   PDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGE  120

Query  446  DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQMSTQKDYSMATA  267
            + VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G  FLG+ MS+ +D+S  TA
Sbjct  121  EEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGQSQGGMFLGRDMSSTRDFSEDTA  180

Query  266  DVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFV  87
              +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   L    ++E+ V
Sbjct  181  ATIDVEVSELVDVAYKRATKVLTDNRTVLDEMAQMLIERETIDTEDIQDLL--NRSEVKV  238

Query  86   A  84
            A
Sbjct  239  A  239



>ref|WP_036901462.1| cell division protein FtsH [Prochlorococcus sp. MIT 0601]
 gb|KGG13140.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0601]
Length=615

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 212/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DE+ DA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  363  GFTGADLANLLNEAAILAARRELTEVSNDEVGDAIERVMAGPEKKDRVMSERRKRLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  423  EAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S+K+G +A+G   G  FLG+ +
Sbjct  483  GRVAEEIVYGEDEVTTGASNDLTQVAQVARQMVTRFGMSEKLGPVALGRSQGGMFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +D EV +LV+ AY RAT+++  +  +L +LA++L+EKETVD E+  +
Sbjct  543  ASERDFSEDTAATIDEEVSQLVDFAYKRATKVLIDNRKVLDELAEMLVEKETVDSEQLQN  602

Query  119  LFIDGKAELFVA  84
            L I  K+E+ +A
Sbjct  603  LLI--KSEVKIA  612



>ref|WP_017293936.1| cell division protein FtsH [Geminocystis herdmanii]
Length=615

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S ++K+LVAYH
Sbjct  363  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKNRVMSQKRKELVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  423  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   GN F+G+ +
Sbjct  483  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQNGNVFMGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S +TA  +D EV++LV++AY RA Q++  +  +L KLA +L+EKETVD +E   
Sbjct  543  ASDRDFSDSTASAIDDEVKKLVDQAYQRAKQVLVENRAVLDKLANMLVEKETVDADELQD  602

Query  119  LF  114
            + 
Sbjct  603  IL  604



>ref|WP_016876546.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=614

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKQLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+ +G +A+G   GN FLG+ +
Sbjct  482  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSETLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR+LV+ AY RA Q++T +  +L +LA++L+EKETVD EE   
Sbjct  542  MSERDFSEETAAAIDEEVRKLVDAAYKRAKQVLTDNRHVLDQLAEMLVEKETVDAEELQE  601

Query  119  LF  114
            L 
Sbjct  602  LL  603



>ref|WP_007100703.1| cell division protein FtsH [Synechococcus sp. RS9917]
 gb|EAQ68631.1| cell division protein [Synechococcus sp. RS9917]
Length=616

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 204/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRELTEVSNDEISDAIERVMAGPEKKDRVMSERRKRLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  484  GRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRAQGGMFLGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV +LV  AY RATQ++T +  +L +LA++L+++ETVD E+   
Sbjct  544  AAERDFSEDTAATIDEEVSDLVSVAYKRATQVLTQNRSVLDELAEMLVDQETVDAEDLQE  603

Query  119  LFI  111
            L +
Sbjct  604  LLM  606



>ref|WP_011932280.1| cell division protein FtsH [Synechococcus sp. WH 7803]
 emb|CAK22781.1| Cell division protein FtsH [Synechococcus sp. WH 7803]
Length=617

 Score =   343 bits (879),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 203/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            G+TGADL NL+NEAAILAARRDL E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  365  GYTGADLSNLLNEAAILAARRDLSEVSNDEISDAIERVMAGPEKKDRVMSERRKRLVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRTYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  485  GRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV ELV+ AY RAT+++  +  +L +LA++L+E+ETVD E+   
Sbjct  545  AAERDFSEDTAATIDEEVSELVDVAYKRATKVLVGNRSVLDELAEMLVEQETVDAEQLQE  604

Query  119  LFI  111
            L I
Sbjct  605  LLI  607



>ref|WP_028949001.1| cell division protein FtsH [Synechocystis sp. PCC 6714]
 gb|AIE73467.1| Cell division protein FtsH [Synechocystis sp. PCC 6714]
Length=616

 Score =   343 bits (879),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN ++S+++K LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRMMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G  GG  FLG+ +
Sbjct  484  GRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQGGGVFLGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EV +LV++AY RA +++  +  IL +LA++L+EKETVD EE  +
Sbjct  544  ASDRDFSDETAAAIDEEVSQLVDQAYQRAKRVLVENRGILDQLAEMLVEKETVDSEELQT  603

Query  119  LFIDGKAEL  93
            L     A+L
Sbjct  604  LLASNNAKL  612



>ref|WP_025922823.1| cell division protein FtsH [Prochlorococcus sp. scB243_495D8]
Length=617

 Score =   343 bits (879),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 209/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+S +KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISAKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRIVLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_006042287.1| cell division protein FtsH [Synechococcus sp. WH 7805]
 gb|EAR19163.1| cell division protein FtsH2 [Synechococcus sp. WH 7805]
Length=616

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 160/243 (66%), Positives = 204/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            G+TGADL NL+NEAAILAARRDL E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  364  GYTGADLSNLLNEAAILAARRDLSEVSNDEISDAIERVMAGPEKKDRVMSERRKRLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRTYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  484  GRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV +LV+ AY RAT+++ ++  +L ++A++L+E+ETVD EE   
Sbjct  544  AAERDFSEDTAATIDEEVSDLVDVAYKRATKVLVSNRSVLDEIAEMLVEQETVDAEELQE  603

Query  119  LFI  111
            L I
Sbjct  604  LLI  606



>ref|WP_032527521.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF96190.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9302]
Length=617

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 210/252 (83%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL ++S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARKDLDKVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV +LV+ AY RAT++++ +  +L ++A++LIE+ET+D E+   
Sbjct  545  SSTRDFSEDTAATIDEEVSDLVDIAYKRATKVLSDNRTVLDEMAEMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LL--NRSEVKVA  614



>ref|WP_006511599.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01218.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=616

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K+LVAYH
Sbjct  364  GFTGADLANLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKELVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  484  GRLAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLGPVALGRQNGNVFLGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D E+R LV++AY RA +++  +  IL +LA++L++KETVD +E   
Sbjct  544  ASDRDFSDETASAIDEEIRNLVDQAYRRAKEVLVENRSILDRLAEMLVDKETVDSDELQD  603

Query  119  LF  114
            L 
Sbjct  604  LL  605



>ref|WP_011055986.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_680922.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07684.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=612

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+SD +KKLVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSDRRKKLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F P+E++++SGLYSR+YL+NQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPNEDQMDSGLYSRAYLQNQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FGED VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  480  GRIAEEIVFGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQTGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              ++D+S  TA  +D EVR LVE+AY RA +++  +  +L ++AQ+LIEKET+D EE  S
Sbjct  540  MAERDFSEETAATIDDEVRNLVEQAYRRAKEVLVNNRHVLDQIAQVLIEKETIDAEELQS  599

Query  119  LF  114
            + 
Sbjct  600  IL  601



>ref|WP_024125602.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89224.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
Length=612

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+SD +KKLVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSDRRKKLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F P+E++++SGLYSR+YL+NQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPNEDQMDSGLYSRAYLQNQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FGED VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  480  GRIAEEIVFGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQTGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              ++D+S  TA  +D EVR LVE+AY RA +++  +  +L ++AQ+LIEKET+D EE  S
Sbjct  540  MAERDFSEETAATIDDEVRNLVEQAYRRAKEVLVNNRHVLDQIAQVLIEKETIDAEELQS  599

Query  119  LF  114
            + 
Sbjct  600  IL  601



>ref|WP_019478058.1| cell division protein FtsH [Prochlorococcus sp. W8]
Length=618

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L ++S DE+ DA+ER++AGPEKK+ V+SD KK+LVAYH
Sbjct  366  GFTGADLANLLNEAAILAARRELDKVSNDEVGDAIERVMAGPEKKDRVISDRKKELVAYH  425

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  426  EAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  485

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ +
Sbjct  486  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGRSQGGMFLGRDI  545

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++A++LIE+ET+D E+   
Sbjct  546  ASERDFSEDTAATIDSEVSELVDSAYKRATKVLTDNRGMLDEMAEMLIERETIDSEDIQD  605

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  606  LI--NRSEVKVA  615



>ref|WP_011826974.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM79116.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9303]
Length=615

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 205/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  363  GFTGADLANLLNEAAILAARRELTEVSNDEISDAIERVMAGPEKKDRVMSERRKQLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            E+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  423  ESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  483  GRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKETVD ++   
Sbjct  543  ASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKETVDAQDLQD  602

Query  119  LFI  111
            L I
Sbjct  603  LLI  605



>ref|WP_036922150.1| cell division protein FtsH [Prochlorococcus marinus]
Length=618

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L ++S DE+ DA+ER++AGPEKK+ V+SD KK+LVAYH
Sbjct  366  GFTGADLANLLNEAAILAARRELDKVSNDEVGDAIERVMAGPEKKDRVISDRKKELVAYH  425

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  426  EAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  485

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ +
Sbjct  486  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGRSQGGMFLGRDI  545

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++A++LIE+ET+D E+   
Sbjct  546  ASERDFSEDTAATIDSEVSELVDSAYKRATKVLTENRGMLDEMAEMLIERETIDSEDIQD  605

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  606  LI--NRSEVKVA  615



>ref|WP_019477234.1| cell division protein FtsH [Prochlorococcus sp. W7]
Length=618

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L ++S DE+ DA+ER++AGPEKK+ V+SD KK+LVAYH
Sbjct  366  GFTGADLANLLNEAAILAARRELDKVSNDEVGDAIERVMAGPEKKDRVISDRKKELVAYH  425

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  426  EAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  485

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ +
Sbjct  486  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGRSQGGMFLGRDI  545

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++A++LIE+ET+D E+   
Sbjct  546  ASERDFSEDTAATIDSEVSELVDSAYKRATKVLTENRGMLDEMAEMLIERETIDSEDIQD  605

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  606  LI--NRSEVKVA  615



>ref|WP_036913475.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG26507.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0701]
 gb|KGG29359.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0702]
Length=615

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 205/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DEISDA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  363  GFTGADLANLLNEAAILAARRELTEVSNDEISDAIERVMAGPEKKDRVMSERRKQLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            E+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  423  ESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  483  GRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKETVD ++   
Sbjct  543  ASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKETVDAQDLQE  602

Query  119  LFI  111
            L I
Sbjct  603  LLI  605



>ref|WP_026730933.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=613

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+ +K+LVAYH
Sbjct  361  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSERRKQLVAYH  420

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYLENQMAVALG
Sbjct  421  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLENQMAVALG  480

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G +A+G   GN FLG+ +
Sbjct  481  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRQQGNMFLGRDI  540

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR+LV+ AY+RA  ++T +  +L +LA +L+EKETVD EE   
Sbjct  541  MSERDFSEETAAAIDEEVRKLVDAAYARAKTVLTDNRHVLDQLADMLVEKETVDAEELQE  600

Query  119  LF  114
            L 
Sbjct  601  LL  602



>ref|WP_006102026.1| cell division protein FtsH [Coleofasciculus chthonoplastes]
 gb|EDX74695.1| ATP-dependent metallopeptidase HflB subfamily [Coleofasciculus 
chthonoplastes PCC 7420]
Length=612

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 207/249 (83%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKRLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   GN FLG+ +
Sbjct  480  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQNGNMFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR+LV+ AY+RA  ++  +  IL KL+ +LIEKETVD EE   
Sbjct  540  ASDRDFSNTTAATIDEEVRKLVDEAYNRAKDVLVGNKHILDKLSAMLIEKETVDAEELQE  599

Query  119  LFIDGKAEL  93
            L  +   ++
Sbjct  600  LLAENDVKM  608



>ref|WP_039726378.1| MULTISPECIES: cell division protein FtsH [Oscillatoriophycideae]
 gb|KIF14597.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39523.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=613

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+ +K+LVAYH
Sbjct  361  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSERRKELVAYH  420

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEERLESGLYSR+YL+NQMAVALG
Sbjct  421  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERLESGLYSRAYLQNQMAVALG  480

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+++G + VTTGASND  QV+RVARQM+ RFG S ++G +A+G   GN FLG+ +
Sbjct  481  GRIAEEIVYGNEEVTTGASNDLQQVARVARQMITRFGMSGELGPVALGRQQGNMFLGRDI  540

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA ++DAEVR LV++AY RA Q++  +  IL KLA +L+EKETVD EE   
Sbjct  541  TAERDFSEETAAIIDAEVRSLVDQAYDRAKQVLVENRAILDKLAGMLVEKETVDSEELQE  600

Query  119  LF  114
            L 
Sbjct  601  LL  602



>ref|WP_006453661.1| cell division protein FtsH [Synechococcus sp. PCC 7335]
 gb|EDX83917.1| ATP-dependent metallopeptidase HflB subfamily [Synechococcus 
sp. PCC 7335]
Length=613

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EI+ DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  361  GFTGADLSNLLNEAAILAARRNLTEIAMDEVNDAIDRVLAGPEKKDRVMSEKRKVLVAYH  420

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEERLESGLYSRSYL+NQMAVALG
Sbjct  421  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERLESGLYSRSYLQNQMAVALG  480

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FG++ VTTGASND  QV+  ARQMV RFG S  +G +A+G   GNPFLG+ +
Sbjct  481  GRLAEEIVFGDEEVTTGASNDLQQVANTARQMVTRFGMSDILGPVALGRQQGNPFLGRDI  540

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +DAEVR LV++AY+R  Q++  +  IL +LA +L++KETVD EE  +
Sbjct  541  ASERDFSEKTAASIDAEVRALVDQAYARCKQVLVENRHILDQLADMLVDKETVDSEELQT  600

Query  119  LFIDGKAEL  93
            L  +  A++
Sbjct  601  LLANSNAKM  609



>ref|WP_009556886.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68121.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
Length=624

 Score =   341 bits (875),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  372  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKELVAYH  431

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALG
Sbjct  432  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALG  491

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  492  GRIAEELVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDI  551

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EVR LV++AY RA  ++T +  +L KLAQ+L+EKETVD EE   
Sbjct  552  AAERDFSEETAAAIDDEVRNLVDQAYRRAKAVLTQNRAVLDKLAQMLVEKETVDAEELQD  611

Query  119  LF  114
            L 
Sbjct  612  LL  613



>ref|WP_013320241.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 gb|ADN12131.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=616

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  364  GFTGADLANLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKSRVMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+++
Sbjct  484  GRLAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGREI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LV++AY RA +++  +  IL KLA +LIEKETVD EE   
Sbjct  544  ASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLVNNRHILDKLADMLIEKETVDAEELQD  603

Query  119  LF  114
            + 
Sbjct  604  VL  605



>ref|WP_039716361.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18854.1| cell division protein FtsH [Scytonema millei VB511283]
Length=612

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLSEISMDEVNDAIDRVLAGPEKKDRVMSEKRKQLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSRSYLENQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRSYLENQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   GN FLG+ +
Sbjct  480  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQQGNMFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              ++D+S  TA V+D EV +LV+ AY RA  ++T +  IL +LAQ+L+EKETVD +E   
Sbjct  540  VAERDFSEETAAVIDEEVHQLVDTAYKRAKSVLTNNRAILDRLAQMLVEKETVDADELQE  599

Query  119  LF  114
            L 
Sbjct  600  LL  601



>ref|WP_015109466.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile]
 gb|AFY29018.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile PCC 6307]
Length=614

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR L E+S DE++DA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  362  GFTGADLANLLNEAAILAARRQLAEVSMDEVNDAIERVMAGPEKKDRVMSERRKRLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            E+GHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  422  ESGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV+RVARQMV RFG S ++G +A+G   G  FLG+ +
Sbjct  482  GRVAEEIVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRAQGGMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV +LV  AY RAT+++  +  +L +LA+LL+EKETVD EE   
Sbjct  542  AAERDFSEDTAAAIDEEVSQLVADAYRRATEVLLANRAVLDELAELLVEKETVDAEELQE  601

Query  119  LFI  111
            L I
Sbjct  602  LLI  604



>ref|WP_012305681.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 gb|ACA98057.1| ATP-dependent metalloprotease FtsH subfamily [Synechococcus sp. 
PCC 7002]
Length=620

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 206/249 (83%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSR+YL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRAYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+ VARQM+ RFG S ++G +A+G   GN F+G+ +
Sbjct  484  GRIAEEIIFGEEEVTTGASNDLQQVANVARQMITRFGMSDRLGPVALGRQNGNVFMGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA V+D EVR LVE AY RA  ++  +  +L KLA +L+EKETVD EE  +
Sbjct  544  ASDRDFSDETAAVIDEEVRGLVEEAYKRAKDVLVGNRSVLDKLAAMLVEKETVDAEELQT  603

Query  119  LFIDGKAEL  93
            L ++   ++
Sbjct  604  LLMESDVQM  612



>ref|WP_011936606.1| cell division protein FtsH [Synechococcus sp. RCC307]
 emb|CAK29096.1| Cell division protein FtsH [Synechococcus sp. RCC307]
Length=618

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 206/249 (83%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR L E+S DEI+DA+ER++AGPEKK+ V+S+++K+LVAYH
Sbjct  366  GFTGADLANLLNEAAILAARRQLSEVSMDEINDAIERVMAGPEKKDRVMSEKRKRLVAYH  425

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            E+GHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  426  ESGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  485

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV+RVARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  486  GRVAEELVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  545

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV  LV+ AY+RA Q+++ +  +L +LA++L+E ETVD E+   
Sbjct  546  AAERDFSEDTAATIDKEVSSLVDAAYTRAVQVLSDNRALLDELAEMLVEMETVDAEQLQE  605

Query  119  LFIDGKAEL  93
            L I   A++
Sbjct  606  LLISRDAKV  614



>ref|WP_017303138.1| cell division protein FtsH [Spirulina subsalsa]
Length=616

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR L EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRSLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKQLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+++
Sbjct  484  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQGNVFLGREI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR+LV++AYSRA  +++++  IL  LA +L+EKETVD EE  +
Sbjct  544  ASDRDFSDETAAAIDEEVRKLVDQAYSRAKDVLSSNRHILDALADMLVEKETVDAEELQN  603

Query  119  LF  114
            + 
Sbjct  604  IL  605



>ref|WP_027255466.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYLENQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   GN FLG+ +
Sbjct  480  GRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KETVD +E   
Sbjct  540  MSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLANILIDKETVDADELQE  599

Query  119  LFIDGKAEL  93
            L  + + ++
Sbjct  600  LLANNEVKM  608



>ref|WP_035832496.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
 gb|KEF41405.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
Length=614

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 200/243 (82%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR L E+S DE++DA+ER++AGPEKK+ V+S+ +K+LVAYH
Sbjct  362  GFTGADLANLLNEAAILAARRQLAEVSMDEVNDAIERVMAGPEKKDRVMSERRKRLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV+RVARQMV RFG S ++G +A+G   G  FLG+ +
Sbjct  482  GRVAEEIVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRAQGGMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV  LV  AY RAT ++  +  +L +LA+LL+EKETVD EE   
Sbjct  542  AAERDFSEDTAAAIDEEVSALVAEAYRRATDVLVANRSVLDELAELLVEKETVDAEELQE  601

Query  119  LFI  111
            L I
Sbjct  602  LLI  604



>ref|WP_015156116.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY89574.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=612

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLSEISMDEVNDAIDRVLAGPEKKDRVMSEKRKQLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSRSYLENQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRSYLENQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   GN FLG+ +
Sbjct  480  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQQGNMFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              ++D+S  TA V+D EV +LV+ AY RA  ++T +  IL +LAQ+L+EKETVD +E   
Sbjct  540  VAERDFSEETAAVIDEEVHQLVDTAYKRAKSVLTDNRAILDRLAQMLVEKETVDADELQE  599

Query  119  LF  114
            L 
Sbjct  600  LL  601



>ref|WP_026794256.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=612

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYLENQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   GN FLG+ +
Sbjct  480  GRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KETVD +E   
Sbjct  540  MSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLANVLIDKETVDADELQE  599

Query  119  LFIDGKAEL  93
            L  + + ++
Sbjct  600  LLANNEVKM  608



>ref|WP_015224048.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri]
 gb|AFZ48735.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
Length=615

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  363  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  423  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFG++ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   GN F+G+ +
Sbjct  483  GRIAEEIIFGQEEVTTGASNDLQQVARVARQMITRFGMSDRLGPVALGRQNGNVFMGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EV +LVERAY RA  ++  +  IL KLA++L+EKETV+ +E   
Sbjct  543  ASDRDFSDTTAATIDEEVSQLVERAYQRAKDVLVQNRPILDKLAEMLVEKETVEADELQE  602

Query  119  LF  114
            + 
Sbjct  603  IL  604



>gb|KIE06858.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=614

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLSEISMDEINDAIDRVLAGPEKKDRVMSEKRKTLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSR+YLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRAYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  482  GRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR+LVE AY RA +++  +  IL KLA++L+EKETVD EE   
Sbjct  542  MSERDFSEETAAAIDEEVRQLVETAYRRAKEVLENNRHILDKLAEMLVEKETVDAEELQD  601

Query  119  LF  114
            + 
Sbjct  602  VL  603



>ref|WP_042152619.1| cell division protein FtsH [Planktothrix agardhii]
 gb|KEI66190.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=612

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYLENQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   GN FLG+ +
Sbjct  480  GRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KETVD +E   
Sbjct  540  MSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLADVLIDKETVDADELQE  599

Query  119  LFIDGKAEL  93
            L  + + ++
Sbjct  600  LLANNEVKM  608



>ref|WP_019476442.1| cell division protein FtsH [Prochlorococcus sp. W4]
Length=617

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L ++S DE+ DA+ER++AGPEKK+ V+S+ KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRELDKVSNDEVGDAIERVMAGPEKKDRVISERKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G  FLG+ +
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGRSQGGMFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  ASERDFSEDTAATIDVEVSELVDIAYKRATKVLTENRGMLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LI--NRSEVKVA  614



>ref|WP_019474071.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 211/252 (84%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L ++S DE+ DA+ER++AGPEKK+ V+S+ KK+LVAYH
Sbjct  365  GFTGADLANLLNEAAILAARRELDKVSNDEVGDAIERVMAGPEKKDRVISERKKELVAYH  424

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLESGLYSRSYL+NQMAVALG
Sbjct  425  EAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLESGLYSRSYLQNQMAVALG  484

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG +A+G   G  FLG+ +
Sbjct  485  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIGPVALGRSQGGMFLGRDI  544

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++AQ+LIE+ET+D E+   
Sbjct  545  ASERDFSEDTAATIDVEVSELVDVAYKRATKVLTENRGMLDEMAQMLIERETIDTEDIQD  604

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  605  LI--NRSEVKVA  614



>ref|WP_027249137.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   340 bits (871),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYLENQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   GN FLG+ +
Sbjct  480  GRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KETVD +E   
Sbjct  540  MSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLADVLIDKETVDADELQE  599

Query  119  LFIDGKAEL  93
            L  + + ++
Sbjct  600  LLANNEVKM  608



>ref|WP_026097926.1| cell division protein FtsH [Geitlerinema sp. PCC 7105]
Length=614

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG AGGLT+F PSEER++SGLYSRSYL+NQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGAAGGLTWFTPSEERMDSGLYSRSYLQNQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+++G +A+G   GN FLG+ +
Sbjct  482  GRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSERLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV +LV+ AY+RA Q+++ +  +L +L+++L+EKETVD EE   
Sbjct  542  AAERDFSEETAAAIDEEVSKLVDEAYTRAKQVLSENRSVLDRLSEMLVEKETVDAEELQD  601

Query  119  LFIDGKAEL  93
            L  +   ++
Sbjct  602  LLANSDVKM  610



>ref|WP_017715041.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=613

 Score =   340 bits (871),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 206/249 (83%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  361  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  420

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALG
Sbjct  421  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALG  480

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+++G +A+G   GN FLG+ +
Sbjct  481  GRVAEEIIFGEEEVTTGASNDLQQVARVARQMVMRFGMSERLGPVALGRQQGNMFLGRDI  540

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
              ++D+S  TA V+D EV  LVE+AY RA +++ ++  +L  LA +L+EKETVD EE   
Sbjct  541  MAERDFSEETASVIDEEVSTLVEQAYRRAKEVLVSNRHVLDTLADMLVEKETVDSEELQD  600

Query  119  LFIDGKAEL  93
            L  +   ++
Sbjct  601  LLANSDVKM  609



>ref|WP_017291153.1| cell division protein FtsH [Leptolyngbya boryana]
Length=613

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  361  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVLAGPEKKDRVMSEKRKELVAYH  420

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALG
Sbjct  421  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALG  480

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FGE+ VTTGASND  QV+RVA+QMV RFG S ++G +A+G   GN FLG+ +
Sbjct  481  GRIAEEIVFGEEEVTTGASNDLQQVARVAKQMVTRFGMSDRLGPVALGRQQGNMFLGRDI  540

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EVR LVE+AY RA  ++  +  +L KLA++L++KETVD EE   
Sbjct  541  AAERDFSEETAAAIDDEVRNLVEQAYRRAKAVLVQNRPVLDKLAEMLVDKETVDAEELQE  600

Query  119  LF  114
            L 
Sbjct  601  LL  602



>ref|WP_026786321.1| cell division protein FtsH [Planktothrix rubescens]
Length=612

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVG+LMP+YDPV KISIIPRG+AGGLT+F PSEER++SGL+SRSYLENQMAVALG
Sbjct  420  EAGHALVGSLMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDSGLFSRSYLENQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G +A+G   GN FLG+ +
Sbjct  480  GRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLGPVALGRQQGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++LA +LI+KETVD +E   
Sbjct  540  MSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQLANVLIDKETVDADELQE  599

Query  119  LFIDGKAEL  93
            L  + + ++
Sbjct  600  LLANNEVKM  608



>ref|WP_015955558.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 gb|ACK71965.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=616

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 207/249 (83%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKSRVMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGL+SRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLFSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+++
Sbjct  484  GRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNVFLGREI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LV++AY RA +++  +  IL +LA +LIEKETVD EE   
Sbjct  544  ASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLMNNRPILDQLASMLIEKETVDAEELQD  603

Query  119  LFIDGKAEL  93
            +  +   ++
Sbjct  604  ILANNDVKM  612



>ref|WP_024546675.1| cell division protein FtsH [Synechococcus sp. NKBG15041c]
Length=620

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 206/249 (83%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSR+YL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRAYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+ VARQM+ RFG S ++G +A+G   GN F+G+ +
Sbjct  484  GRIAEEIIFGEEEVTTGASNDLQQVANVARQMITRFGMSDRLGPVALGRQNGNVFMGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA V+D EVR LVE AY RA  ++  +  +L KLA +L+EKETVD EE  +
Sbjct  544  ASDRDFSDETAAVIDEEVRGLVEEAYKRAKDVLVNNRAVLDKLAAMLVEKETVDAEELQT  603

Query  119  LFIDGKAEL  93
            + ++   ++
Sbjct  604  VLMENDVKM  612



>ref|WP_011819579.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM71467.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9515]
Length=619

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 206/252 (82%), Gaps = 2/252 (1%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAAR+DL  +S DE+ DA+ER++AGPEKK+ V+SD+KK+LVAYH
Sbjct  367  GFTGADLANLLNEAAILAARKDLDTVSNDEVGDAIERVMAGPEKKDRVISDKKKELVAYH  426

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGA MP+YD VAK+SIIPRGQAGGLTFF PSEER+ESGLYSRSYL+NQMAVALG
Sbjct  427  EAGHALVGACMPDYDAVAKVSIIPRGQAGGLTFFTPSEERMESGLYSRSYLQNQMAVALG  486

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG +A+G   G  FLG+ M
Sbjct  487  GRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIGPVALGQSQGGMFLGRDM  546

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            S+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++A +LIE+ET+D E+   
Sbjct  547  SSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRSVLDEMAMMLIERETIDTEDIQD  606

Query  119  LFIDGKAELFVA  84
            L    ++E+ VA
Sbjct  607  LL--NRSEVKVA  616



>ref|XP_001419590.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=651

 Score =   340 bits (872),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 209/251 (83%), Gaps = 0/251 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL+NLMNE+AILAARR+L EISK+EI+DALERIIAG  ++ AV+S++KKKLVAYH
Sbjct  388  GFTGADLENLMNESAILAARRELTEISKEEIADALERIIAGAAREGAVMSEKKKKLVAYH  447

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YD V KISI+PRG AGGLTFFAPSEERLESGLYSR+YLENQMAVA+G
Sbjct  448  EAGHALVGALMPDYDAVTKISIVPRGNAGGLTFFAPSEERLESGLYSRTYLENQMAVAMG  507

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFG ++VTTGAS DF QV+R AR M+E+ GFSK+IGQIAI   GGN FLG  M
Sbjct  508  GRVAEELIFGAEDVTTGASGDFQQVTRTARMMIEQMGFSKRIGQIAIKSGGGNSFLGNDM  567

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
                DYS ATA +VD EV+ LV  AY RA  ++  ++D+LH +A +L+EKE +DG+EF  
Sbjct  568  GRAADYSAATAAIVDEEVKILVTAAYRRAKDLVQLNMDVLHAVADVLMEKENIDGDEFER  627

Query  119  LFIDGKAELFV  87
            + +  K+EL++
Sbjct  628  IMLGAKSELYL  638



>ref|WP_015133797.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7376]
 gb|AFY38027.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7376]
Length=620

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 205/249 (82%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  364  GFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVMAGPEKKNRVMSEKRKTLVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDSGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFG + VTTGASND  QV+ VARQM+ RFG S ++G +A+G   GN F+G+ +
Sbjct  484  GRIAEEIIFGAEEVTTGASNDLQQVANVARQMITRFGMSDRLGPVALGRQNGNVFMGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA V+D EVR LVE AY RA  ++  +  +L +LA +L+EKETVD EE  +
Sbjct  544  ASDRDFSDETASVIDEEVRGLVEEAYVRAKDVLVGNRSVLDRLADMLVEKETVDSEELQT  603

Query  119  LFIDGKAEL  93
            L ++   ++
Sbjct  604  LLMESDVKM  612



>ref|WP_011131165.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE21973.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9313]
Length=615

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 204/243 (84%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L E+S DEISDA+ER++ GPEKK+ V+S+ +K+LVAYH
Sbjct  363  GFTGADLANLLNEAAILAARRELTEVSNDEISDAIERVMVGPEKKDRVMSERRKRLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            E+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  423  ESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G +A+G   G  FLG+ +
Sbjct  483  GRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLGPVALGRSQGGMFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +LA LL+EKET+D ++   
Sbjct  543  ASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDELADLLVEKETLDAQDLQE  602

Query  119  LFI  111
            L I
Sbjct  603  LLI  605



>ref|WP_017743955.1| cell division protein FtsH [Scytonema hofmanni]
Length=614

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DEI+DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  362  GFTGADLSNLLNEAAILAARRNLSEISMDEINDAIDRVLAGPEKKDRVMSEKRKTLVAYH  421

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSR+YLENQMAVALG
Sbjct  422  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRAYLENQMAVALG  481

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR++EE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  482  GRISEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDI  541

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR+LVE AY R+ +++  +  IL KLA++L+EKETVD EE   
Sbjct  542  MSERDFSEETAAAIDEEVRQLVEAAYRRSKEVLENNRHILDKLAEMLVEKETVDAEELQE  601

Query  119  LF  114
            L 
Sbjct  602  LL  603



>ref|WP_019506377.1| cell division protein FtsH [Pleurocapsa sp. PCC 7319]
Length=616

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR L EIS DE++DA++R++AGPEKKN V+S+++K+LVAYH
Sbjct  364  GFTGADLANLLNEAAILAARRSLTEISMDEVNDAIDRVMAGPEKKNRVMSEKRKELVAYH  423

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ESGLYSRSYL+NQMAVALG
Sbjct  424  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMESGLYSRSYLQNQMAVALG  483

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+I+GE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN F+G+ +
Sbjct  484  GRLAEEIIYGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLGPVALGRQNGNVFMGRDI  543

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR  V++AYSRA +++  + +IL +LA++LIEKETV+ +E   
Sbjct  544  ASDRDFSNETAAAIDEEVRNYVDQAYSRAKKVLLDNRNILDRLAEMLIEKETVEADELQD  603

Query  119  LFIDGKAEL  93
            +  +   ++
Sbjct  604  ILANNDVKM  612



>ref|WP_038331075.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=618

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K+LVAYH
Sbjct  366  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKELVAYH  425

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++SGLYSR+YL+NQMAVALG
Sbjct  426  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERMDSGLYSRAYLQNQMAVALG  485

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN F+G+ +
Sbjct  486  GRVAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQNGNMFMGRDI  545

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR+LV++AY R  +++  +  IL KLA++L+E ETVD EE  +
Sbjct  546  ASDRDFSDETASAIDEEVRKLVDQAYERTVEVLKGNRQILDKLAEMLVEAETVDSEELQN  605

Query  119  LFIDGKAEL  93
            L  +   ++
Sbjct  606  LLAESDVKM  614



>ref|WP_015143924.1| ATP-dependent metalloprotease FtsH [Pleurocapsa minor]
 gb|AFY77621.1| ATP-dependent metalloprotease FtsH [Pleurocapsa sp. PCC 7327]
Length=618

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 206/249 (83%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKKN V+S+++K LVAYH
Sbjct  366  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKNRVMSEKRKTLVAYH  425

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER+E+GLYSR+YL+NQMAVALG
Sbjct  426  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERMEAGLYSRAYLQNQMAVALG  485

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FGE+ VTTGA+ND  QV+RVARQM+ RFG S ++G +A+G   G  FLG+ +
Sbjct  486  GRIAEEIVFGEEEVTTGAANDLQQVARVARQMITRFGMSDRLGPVALGRQNGGVFLGRDI  545

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LVE+AY RA  ++  +  +L +LAQ+L+EKETVD EE  +
Sbjct  546  ASDRDFSDETAATIDEEVRLLVEQAYRRAKDVLVNNRHVLDQLAQILVEKETVDAEELQA  605

Query  119  LFIDGKAEL  93
            L  +   ++
Sbjct  606  LLANNDVKM  614



>ref|WP_015180805.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
 gb|AFZ16642.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Length=612

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 205/249 (82%), Gaps = 0/249 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++GLYSRSYL+NQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDTGLYSRSYLQNQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+++
Sbjct  480  GRLAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLGPVALGRQNGNMFLGREI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            ++ +D+S  TA  +D EVR LV+ AY RA  ++  +  IL KLA +LIEKETVD +E   
Sbjct  540  ASDRDFSDTTAATIDEEVRRLVDEAYERAKNVLLGNKHILDKLAGMLIEKETVDSDELQE  599

Query  119  LFIDGKAEL  93
            L  +   ++
Sbjct  600  LLANNDVKI  608



>ref|WP_043694696.1| cell division protein FtsH [Synechococcus sp. KORDI-49]
 gb|AII46861.1| cell division protein FtsH [Synechococcus sp. KORDI-49]
Length=615

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/243 (66%), Positives = 200/243 (82%), Gaps = 0/243 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            G+TGADL NL+NEAAILAARR+L E+S DEISDA+ERI+ GPEKK+AV+S+ KK LVAYH
Sbjct  363  GYTGADLANLLNEAAILAARRELTEVSNDEISDAIERIMVGPEKKDAVISERKKWLVAYH  422

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHA+VGALMP+YDPV KISIIPRG AGGLTFF PSEER+ESGLYSR+YL+NQMAVALG
Sbjct  423  EAGHAIVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMESGLYSRAYLQNQMAVALG  482

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GRVAEE+++GED VTTGASND  QV+  ARQM+ RFG S K+G +A+G   G  FLG+ +
Sbjct  483  GRVAEEIVYGEDEVTTGASNDLQQVASTARQMITRFGMSDKLGPVALGRSQGGMFLGRDI  542

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
            + ++D+S  TA  +D EV +LV+ AY RAT+++  +  +L +LA+LL+E+ETVD EE   
Sbjct  543  AAERDFSEDTASTIDQEVSDLVDVAYKRATKVLVDNRPVLDELAELLVEQETVDAEELQE  602

Query  119  LFI  111
            L I
Sbjct  603  LLI  605



>ref|WP_006618677.1| FtsH peptidase [Arthrospira platensis]
 dbj|BAI92105.1| cell division protein FtsH [Arthrospira platensis NIES-39]
 gb|KDR55786.1| cell division protein FtsH [Arthrospira platensis str. Paraca]
Length=612

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEDRMDSGLYSRSYLQNQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   GN FLG+ +
Sbjct  480  GRLAEEIVFGEEEVTTGASNDLQQVTRVARQMITRFGMSDRLGPVALGRQQGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR LV+ AY RA Q++  +  +L  LA++LIEKETVD EE   
Sbjct  540  MSERDFSEETASAIDEEVRALVDEAYKRARQVLEENRPVLDSLAEMLIEKETVDSEELQE  599

Query  119  LF  114
            L 
Sbjct  600  LL  601



>ref|WP_006669335.1| MULTISPECIES: cell division protein FtsH [Arthrospira]
 gb|EDZ94639.1| ATP-dependent metalloprotease FtsH [Arthrospira maxima CS-328]
Length=612

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAILAARR+L EIS DE++DA++R++AGPEKK+ V+S+++K LVAYH
Sbjct  360  GFTGADLSNLLNEAAILAARRNLTEISMDEVNDAIDRVLAGPEKKDRVMSEKRKTLVAYH  419

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++SGLYSRSYL+NQMAVALG
Sbjct  420  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEDRMDSGLYSRSYLQNQMAVALG  479

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE++FGE+ VTTGASND  QV+RVARQM+ RFG S ++G +A+G   GN FLG+ +
Sbjct  480  GRLAEEIVFGEEEVTTGASNDLQQVTRVARQMITRFGMSDRLGPVALGRQQGNVFLGRDI  539

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR LV+ AY RA Q++  +  +L  LA++LIEKETVD EE   
Sbjct  540  MSERDFSEETASAIDEEVRALVDEAYKRARQVLEENRPVLDSLAEMLIEKETVDSEELQE  599

Query  119  LF  114
            L 
Sbjct  600  LL  601



>emb|CCH67048.1| Cell division protein FtsH [Richelia intracellularis HH01]
Length=465

 Score =   333 bits (855),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -2

Query  839  GFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYH  660
            GFTGADL NL+NEAAIL ARR+L EIS DEI+DA++R++AGPEKK+ V+S+ +K LVAYH
Sbjct  213  GFTGADLSNLLNEAAILTARRNLTEISMDEINDAIDRVLAGPEKKDRVMSERRKLLVAYH  272

Query  659  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  480
            EAGHALVGALMP+YDPV KISIIPRG+AGGLT+F P+E+R++SGLYSRSYLENQMAVALG
Sbjct  273  EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPNEDRMDSGLYSRSYLENQMAVALG  332

Query  479  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  300
            GR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG S ++G +A+G   GN FLG+ +
Sbjct  333  GRLAEEIIFGDEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDI  392

Query  299  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  120
             +++D+S  TA  +D EVR+LV+ AY RA Q++  +  IL++LA +L+EKETVD EE   
Sbjct  393  MSERDFSEETAATIDEEVRQLVDAAYIRAKQVLEENRHILNQLADILVEKETVDAEELQD  452

Query  119  LF  114
            + 
Sbjct  453  IL  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1766194434865