BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046E18

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011087158.1|  PREDICTED: nucleobase-ascorbate transporter 6    71.2    4e-13   Sesamum indicum [beniseed]
ref|XP_009803945.1|  PREDICTED: nucleobase-ascorbate transporter ...  68.6    5e-12   Nicotiana sylvestris
ref|XP_009608483.1|  PREDICTED: nucleobase-ascorbate transporter ...  68.6    5e-12   Nicotiana tomentosiformis
ref|XP_004241491.1|  PREDICTED: nucleobase-ascorbate transporter 6    68.6    5e-12   
ref|XP_009608481.1|  PREDICTED: nucleobase-ascorbate transporter ...  68.6    6e-12   
gb|KEH31855.1|  nucleobase-ascorbate transporter-like protein         67.4    6e-12   Medicago truncatula
gb|AAX95758.2|  xanthine/uracil permease family protein               68.6    7e-12   Solanum lycopersicum
ref|XP_004508844.1|  PREDICTED: nucleobase-ascorbate transporter ...  67.8    8e-12   Cicer arietinum [garbanzo]
ref|XP_004508843.1|  PREDICTED: nucleobase-ascorbate transporter ...  67.8    9e-12   
gb|KEH31856.1|  nucleobase-ascorbate transporter-like protein         67.4    9e-12   Medicago truncatula
gb|AAL76261.1|AF466824_1  putative permease 1                         65.1    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608951.1|  Nucleobase ascorbate transporter                 67.4    1e-11   Medicago truncatula
gb|KHN48615.1|  Nucleobase-ascorbate transporter 6                    67.4    1e-11   Glycine soja [wild soybean]
ref|XP_003549636.1|  PREDICTED: nucleobase-ascorbate transporter ...  67.4    1e-11   Glycine max [soybeans]
ref|XP_006579556.1|  PREDICTED: nucleobase-ascorbate transporter ...  67.4    1e-11   Glycine max [soybeans]
ref|XP_009610581.1|  PREDICTED: nucleobase-ascorbate transporter ...  66.6    2e-11   Nicotiana tomentosiformis
ref|XP_009610578.1|  PREDICTED: nucleobase-ascorbate transporter ...  66.6    2e-11   Nicotiana tomentosiformis
gb|AIS71908.1|  nucleobase-ascorbate transporter 6-like isoform 1     66.6    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_010678709.1|  PREDICTED: nucleobase-ascorbate transporter 6    66.2    3e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002283469.1|  PREDICTED: nucleobase-ascorbate transporter 6    66.2    3e-11   Vitis vinifera
gb|AAK59508.2|  putative permease 1                                   65.1    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AET03140.2|  nucleobase-ascorbate transporter-like protein         65.9    4e-11   Medicago truncatula
ref|XP_003628664.1|  Nucleobase ascorbate transporter                 65.9    4e-11   
ref|XP_008453115.1|  PREDICTED: nucleobase-ascorbate transporter 6    65.9    4e-11   Cucumis melo [Oriental melon]
gb|AGV54390.1|  nucleobase-ascorbate transporter 6-like protein       65.1    7e-11   Phaseolus vulgaris [French bean]
ref|XP_007155396.1|  hypothetical protein PHAVU_003G197800g           65.1    7e-11   Phaseolus vulgaris [French bean]
ref|XP_010550666.1|  PREDICTED: nucleobase-ascorbate transporter 6    65.1    7e-11   Tarenaya hassleriana [spider flower]
ref|XP_010444153.1|  PREDICTED: nucleobase-ascorbate transporter ...  65.1    7e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010459419.1|  PREDICTED: nucleobase-ascorbate transporter ...  65.1    7e-11   Camelina sativa [gold-of-pleasure]
emb|CDX84363.1|  BnaC03g51370D                                        65.1    7e-11   
ref|XP_009151410.1|  PREDICTED: nucleobase-ascorbate transporter 6    65.1    7e-11   Brassica rapa
ref|XP_009112041.1|  PREDICTED: nucleobase-ascorbate transporter 6    65.1    7e-11   Brassica rapa
emb|CDY56736.1|  BnaC09g50870D                                        65.1    7e-11   Brassica napus [oilseed rape]
ref|XP_006394340.1|  hypothetical protein EUTSA_v10003977mg           65.1    7e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006280290.1|  hypothetical protein CARUB_v10026214mg           65.1    7e-11   
ref|NP_201094.1|  Xanthine/uracil permease family protein             65.1    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864824.1|  hypothetical protein ARALYDRAFT_496474           65.1    7e-11   
ref|XP_009782990.1|  PREDICTED: nucleobase-ascorbate transporter 6    65.1    8e-11   Nicotiana sylvestris
ref|XP_006345027.1|  PREDICTED: nucleobase-ascorbate transporter ...  65.1    8e-11   Solanum tuberosum [potatoes]
ref|XP_004236131.1|  PREDICTED: nucleobase-ascorbate transporter 6    65.1    8e-11   
ref|XP_010519558.1|  PREDICTED: nucleobase-ascorbate transporter ...  64.7    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_011071803.1|  PREDICTED: nucleobase-ascorbate transporter ...  64.3    1e-10   Sesamum indicum [beniseed]
ref|XP_004138122.1|  PREDICTED: nucleobase-ascorbate transporter ...  64.3    1e-10   Cucumis sativus [cucumbers]
emb|CDY30739.1|  BnaA02g33610D                                        64.3    2e-10   Brassica napus [oilseed rape]
emb|CDY45747.1|  BnaC02g42350D                                        64.3    2e-10   Brassica napus [oilseed rape]
ref|XP_011028608.1|  PREDICTED: nucleobase-ascorbate transporter 6    64.3    2e-10   Populus euphratica
ref|XP_009130240.1|  PREDICTED: nucleobase-ascorbate transporter ...  64.3    2e-10   Brassica rapa
ref|XP_004509863.1|  PREDICTED: nucleobase-ascorbate transporter ...  63.9    2e-10   Cicer arietinum [garbanzo]
emb|CAH58638.1|  putative xanthine/uracil permease                    60.5    2e-10   Plantago major [cart-track plant]
ref|XP_003574490.1|  PREDICTED: nucleobase-ascorbate transporter ...  63.5    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_007209884.1|  hypothetical protein PRUPE_ppa003999mg           63.2    3e-10   Prunus persica
gb|KDO69758.1|  hypothetical protein CISIN_1g009582mg                 63.2    3e-10   Citrus sinensis [apfelsine]
gb|KDO69759.1|  hypothetical protein CISIN_1g009582mg                 63.2    3e-10   Citrus sinensis [apfelsine]
ref|XP_006439754.1|  hypothetical protein CICLE_v10019673mg           63.2    3e-10   
gb|KDO69757.1|  hypothetical protein CISIN_1g009582mg                 63.2    4e-10   Citrus sinensis [apfelsine]
gb|KDO69752.1|  hypothetical protein CISIN_1g009582mg                 63.2    4e-10   Citrus sinensis [apfelsine]
gb|KDO69748.1|  hypothetical protein CISIN_1g009582mg                 63.2    4e-10   Citrus sinensis [apfelsine]
ref|XP_006476733.1|  PREDICTED: nucleobase-ascorbate transporter ...  63.2    4e-10   Citrus sinensis [apfelsine]
ref|XP_006439755.1|  hypothetical protein CICLE_v10019673mg           63.2    4e-10   
gb|KJB19548.1|  hypothetical protein B456_003G109900                  62.4    4e-10   Gossypium raimondii
ref|XP_007036127.1|  Xanthine/uracil permease family protein isof...  62.8    5e-10   Theobroma cacao [chocolate]
gb|KJB53228.1|  hypothetical protein B456_008G297500                  62.0    6e-10   Gossypium raimondii
gb|KJB19546.1|  hypothetical protein B456_003G109900                  62.4    6e-10   Gossypium raimondii
ref|XP_002311584.2|  hypothetical protein POPTR_0008s14580g           62.4    6e-10   
ref|XP_004501951.1|  PREDICTED: nucleobase-ascorbate transporter ...  62.4    6e-10   Cicer arietinum [garbanzo]
gb|EYU42538.1|  hypothetical protein MIMGU_mgv1a004467mg              62.4    7e-10   Erythranthe guttata [common monkey flower]
ref|XP_011021644.1|  PREDICTED: nucleobase-ascorbate transporter 7    62.4    7e-10   Populus euphratica
ref|XP_011025599.1|  PREDICTED: nucleobase-ascorbate transporter ...  62.4    7e-10   Populus euphratica
ref|XP_002315809.1|  xanthine/uracil permease family protein          62.4    7e-10   
ref|XP_010100509.1|  Nucleobase-ascorbate transporter 6               62.4    7e-10   Morus notabilis
ref|XP_006438462.1|  hypothetical protein CICLE_v10031192mg           62.4    7e-10   Citrus clementina [clementine]
gb|KJB77978.1|  hypothetical protein B456_012G170700                  62.4    7e-10   Gossypium raimondii
gb|KHG18287.1|  Nucleobase-ascorbate transporter 7 -like protein      62.4    7e-10   Gossypium arboreum [tree cotton]
gb|KJB53223.1|  hypothetical protein B456_008G297500                  62.0    8e-10   Gossypium raimondii
gb|KJB53217.1|  hypothetical protein B456_008G297500                  62.0    8e-10   Gossypium raimondii
gb|KHG14639.1|  Nucleobase-ascorbate transporter 6 -like protein      62.0    8e-10   Gossypium arboreum [tree cotton]
ref|XP_010028015.1|  PREDICTED: nucleobase-ascorbate transporter 6    62.0    8e-10   Eucalyptus grandis [rose gum]
ref|XP_002511446.1|  purine permease, putative                        62.0    1e-09   Ricinus communis
gb|ABK93255.1|  unknown                                               60.8    1e-09   Populus trichocarpa [western balsam poplar]
gb|KDP31138.1|  hypothetical protein JCGZ_11514                       61.6    1e-09   Jatropha curcas
ref|XP_008239723.1|  PREDICTED: nucleobase-ascorbate transporter 6    61.6    1e-09   
gb|KHN44541.1|  Nucleobase-ascorbate transporter 6                    61.6    1e-09   Glycine soja [wild soybean]
gb|KHN10623.1|  Nucleobase-ascorbate transporter 6                    61.6    1e-09   Glycine soja [wild soybean]
ref|XP_003552008.1|  PREDICTED: nucleobase-ascorbate transporter ...  61.6    1e-09   
ref|XP_003532028.1|  PREDICTED: nucleobase-ascorbate transporter ...  61.6    1e-09   Glycine max [soybeans]
gb|KHG22799.1|  Nucleobase-ascorbate transporter 6 -like protein      61.6    1e-09   Gossypium arboreum [tree cotton]
gb|KEH35060.1|  nucleobase-ascorbate transporter-like protein         61.6    1e-09   Medicago truncatula
ref|XP_007044538.1|  Nucleobase-ascorbate transporter 7               61.2    1e-09   
gb|ABO30057.1|  xanthine/uracil/vitamin C permease                    58.5    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009360485.1|  PREDICTED: nucleobase-ascorbate transporter ...  61.2    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_008389596.1|  PREDICTED: nucleobase-ascorbate transporter ...  61.2    2e-09   Malus domestica [apple tree]
gb|ABO30011.1|  xanthine/uracil/vitamin C permease                    58.5    2e-09   Triticum dicoccon [cultivated emmer wheat]
ref|XP_008339995.1|  PREDICTED: nucleobase-ascorbate transporter ...  61.2    2e-09   
ref|XP_002452570.1|  hypothetical protein SORBIDRAFT_04g028300        61.2    2e-09   Sorghum bicolor [broomcorn]
gb|ABO30069.1|  xanthine/uracil/vitamin C permease                    58.5    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004953888.1|  PREDICTED: nucleobase-ascorbate transporter ...  61.2    2e-09   Setaria italica
ref|XP_008393061.1|  PREDICTED: nucleobase-ascorbate transporter 6    60.8    2e-09   
ref|XP_002322154.1|  xanthine/uracil permease family protein          60.8    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_003519478.1|  PREDICTED: nucleobase-ascorbate transporter ...  60.8    2e-09   
ref|XP_006339989.1|  PREDICTED: nucleobase-ascorbate transporter ...  60.8    2e-09   Solanum tuberosum [potatoes]
ref|XP_004252190.1|  PREDICTED: nucleobase-ascorbate transporter 6    60.8    2e-09   Solanum lycopersicum
gb|KHN45288.1|  Nucleobase-ascorbate transporter 6                    60.8    3e-09   Glycine soja [wild soybean]
ref|XP_006574587.1|  PREDICTED: nucleobase-ascorbate transporter ...  60.8    3e-09   
ref|XP_003517836.1|  PREDICTED: nucleobase-ascorbate transporter ...  60.8    3e-09   Glycine max [soybeans]
ref|XP_010913510.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...  60.8    3e-09   Elaeis guineensis
ref|XP_006573063.1|  PREDICTED: nucleobase-ascorbate transporter ...  60.8    3e-09   Glycine max [soybeans]
ref|XP_007157491.1|  hypothetical protein PHAVU_002G074100g           60.5    3e-09   Phaseolus vulgaris [French bean]
ref|XP_011044342.1|  PREDICTED: nucleobase-ascorbate transporter ...  60.5    3e-09   Populus euphratica
ref|XP_010546016.1|  PREDICTED: nucleobase-ascorbate transporter ...  60.5    3e-09   Tarenaya hassleriana [spider flower]
gb|KDP21309.1|  hypothetical protein JCGZ_21780                       60.1    4e-09   Jatropha curcas
ref|XP_008446242.1|  PREDICTED: nucleobase-ascorbate transporter 7    60.1    4e-09   Cucumis melo [Oriental melon]
emb|CAJ84113.1|  root uracil permease 1                               60.1    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048084.1|  Os02g0741800                                     60.1    4e-09   
ref|XP_004135225.1|  PREDICTED: nucleobase-ascorbate transporter ...  60.1    5e-09   Cucumis sativus [cucumbers]
ref|XP_008806500.1|  PREDICTED: nucleobase-ascorbate transporter ...  59.3    8e-09   
ref|XP_008245218.1|  PREDICTED: nucleobase-ascorbate transporter ...  59.3    8e-09   Prunus mume [ume]
dbj|BAJ85445.1|  predicted protein                                    59.3    8e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS61607.1|  Nucleobase-ascorbate transporter 6                    59.3    8e-09   Triticum urartu
gb|EMT04471.1|  Nucleobase-ascorbate transporter 6                    59.3    9e-09   
ref|XP_003573107.1|  PREDICTED: nucleobase-ascorbate transporter ...  59.3    9e-09   Brachypodium distachyon [annual false brome]
ref|XP_007221801.1|  hypothetical protein PRUPE_ppa004044mg           59.3    9e-09   
ref|XP_007138109.1|  hypothetical protein PHAVU_009G181000g           59.3    9e-09   Phaseolus vulgaris [French bean]
ref|XP_006647871.1|  PREDICTED: nucleobase-ascorbate transporter ...  59.3    9e-09   Oryza brachyantha
ref|XP_007153664.1|  hypothetical protein PHAVU_003G054500g           58.9    1e-08   Phaseolus vulgaris [French bean]
gb|AFW73350.1|  hypothetical protein ZEAMMB73_676690                  56.2    1e-08   
ref|XP_003613313.1|  Nucleobase ascorbate transporter                 58.9    1e-08   Medicago truncatula
ref|XP_009757662.1|  PREDICTED: nucleobase-ascorbate transporter ...  58.5    1e-08   Nicotiana sylvestris
ref|XP_003527028.1|  PREDICTED: nucleobase-ascorbate transporter ...  58.5    1e-08   Glycine max [soybeans]
ref|NP_001061818.1|  Os08g0420600                                     58.5    2e-08   
gb|EEC83594.1|  hypothetical protein OsI_29273                        58.5    2e-08   Oryza sativa Indica Group [Indian rice]
emb|CDP17001.1|  unnamed protein product                              58.2    2e-08   Coffea canephora [robusta coffee]
gb|EPS64995.1|  hypothetical protein M569_09784                       55.1    2e-08   Genlisea aurea
ref|XP_010254659.1|  PREDICTED: nucleobase-ascorbate transporter ...  58.2    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_009799732.1|  PREDICTED: nucleobase-ascorbate transporter ...  57.8    3e-08   Nicotiana sylvestris
ref|XP_009595521.1|  PREDICTED: nucleobase-ascorbate transporter ...  57.8    3e-08   Nicotiana tomentosiformis
gb|EMT25940.1|  Nucleobase-ascorbate transporter 6                    57.8    3e-08   
ref|XP_004973451.1|  PREDICTED: nucleobase-ascorbate transporter ...  57.4    3e-08   Setaria italica
ref|XP_010111541.1|  Nucleobase-ascorbate transporter 6               57.8    3e-08   
ref|XP_010928566.1|  PREDICTED: nucleobase-ascorbate transporter ...  57.4    4e-08   Elaeis guineensis
ref|XP_004489879.1|  PREDICTED: nucleobase-ascorbate transporter ...  57.0    5e-08   Cicer arietinum [garbanzo]
ref|XP_006280300.1|  hypothetical protein CARUB_v10026223mg           57.0    5e-08   Capsella rubella
gb|AFW73351.1|  hypothetical protein ZEAMMB73_676690                  56.2    5e-08   
ref|XP_006355948.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.6    6e-08   
ref|XP_006659402.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.6    6e-08   Oryza brachyantha
ref|XP_006355947.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.6    7e-08   Solanum tuberosum [potatoes]
ref|XP_010238137.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.2    8e-08   Brachypodium distachyon [annual false brome]
ref|XP_004297660.1|  PREDICTED: nucleobase-ascorbate transporter 6    56.6    8e-08   Fragaria vesca subsp. vesca
dbj|BAB08803.1|  permease                                             56.2    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003523067.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.6    8e-08   Glycine max [soybeans]
ref|XP_010472295.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.2    8e-08   
ref|XP_004238704.1|  PREDICTED: nucleobase-ascorbate transporter 7    56.2    9e-08   Solanum lycopersicum
ref|XP_003578065.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.2    9e-08   Brachypodium distachyon [annual false brome]
ref|XP_008643648.1|  PREDICTED: LOC100282103 isoform X1               56.2    9e-08   Zea mays [maize]
ref|XP_010442477.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.2    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002865770.1|  xanthine/uracil permease family protein          56.2    9e-08   Arabidopsis lyrata subsp. lyrata
ref|NP_199810.2|  xanthine/uracil permease family protein             56.2    9e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26633.1|  hypothetical protein AALP_AA8G273900                  56.2    9e-08   Arabis alpina [alpine rockcress]
ref|XP_010482302.1|  PREDICTED: nucleobase-ascorbate transporter ...  56.2    9e-08   
gb|ACN28348.1|  unknown                                               56.2    9e-08   Zea mays [maize]
gb|ACN34480.1|  unknown                                               56.2    9e-08   Zea mays [maize]
ref|NP_001148488.1|  LOC100282103                                     56.2    9e-08   Zea mays [maize]
ref|XP_004299577.1|  PREDICTED: nucleobase-ascorbate transporter 6    56.2    1e-07   Fragaria vesca subsp. vesca
gb|ACR38061.1|  unknown                                               54.3    1e-07   Zea mays [maize]
ref|XP_002463615.1|  hypothetical protein SORBIDRAFT_01g002960        55.8    1e-07   
ref|XP_004981228.1|  PREDICTED: nucleobase-ascorbate transporter ...  55.8    1e-07   Setaria italica
ref|XP_010272020.1|  PREDICTED: nucleobase-ascorbate transporter 6    55.8    1e-07   Nelumbo nucifera [Indian lotus]
emb|CDX71592.1|  BnaC09g26330D                                        55.8    1e-07   
ref|XP_006402200.1|  hypothetical protein EUTSA_v10013227mg           55.8    1e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010043812.1|  PREDICTED: nucleobase-ascorbate transporter 7    55.8    2e-07   
ref|XP_011086504.1|  PREDICTED: nucleobase-ascorbate transporter 7    55.8    2e-07   Sesamum indicum [beniseed]
ref|NP_001141421.1|  uncharacterized protein LOC100273531             55.5    2e-07   Zea mays [maize]
ref|XP_002444345.1|  hypothetical protein SORBIDRAFT_07g020510        55.5    2e-07   
emb|CAN79848.1|  hypothetical protein VITISV_025959                   55.5    2e-07   Vitis vinifera
ref|XP_002268811.1|  PREDICTED: nucleobase-ascorbate transporter 6    55.5    2e-07   Vitis vinifera
ref|XP_010556259.1|  PREDICTED: nucleobase-ascorbate transporter 7    55.1    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_010037590.1|  PREDICTED: nucleobase-ascorbate transporter ...  54.7    3e-07   Eucalyptus grandis [rose gum]
ref|XP_003559230.1|  PREDICTED: nucleobase-ascorbate transporter ...  52.0    4e-07   
ref|XP_009418014.1|  PREDICTED: nucleobase-ascorbate transporter ...  54.3    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG35525.1|  permease I                                            54.3    4e-07   Zea mays [maize]
ref|NP_001140868.1|  uncharacterized protein LOC100272944             54.3    4e-07   Zea mays [maize]
gb|EEC84500.1|  hypothetical protein OsI_31190                        52.4    5e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002531406.1|  purine permease, putative                        54.3    5e-07   Ricinus communis
ref|XP_010682619.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.9    6e-07   
ref|XP_010532270.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.9    7e-07   Tarenaya hassleriana [spider flower]
ref|XP_009411043.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.9    7e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009118902.1|  PREDICTED: nucleobase-ascorbate transporter 5    53.9    7e-07   Brassica rapa
emb|CDY37762.1|  BnaA10g05590D                                        53.9    7e-07   Brassica napus [oilseed rape]
ref|XP_010532269.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.9    7e-07   Tarenaya hassleriana [spider flower]
ref|XP_009619816.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.5    7e-07   Nicotiana tomentosiformis
ref|XP_009415384.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.5    8e-07   
ref|XP_009415380.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.5    8e-07   
dbj|BAJ89101.1|  predicted protein                                    53.5    8e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT02255.1|  Nucleobase-ascorbate transporter 6                    53.5    8e-07   
ref|XP_003563486.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.5    8e-07   Brachypodium distachyon [annual false brome]
gb|EMS47148.1|  Nucleobase-ascorbate transporter 6                    53.5    8e-07   Triticum urartu
ref|NP_001150400.1|  permease I                                       53.5    8e-07   
tpg|DAA52241.1|  TPA: permease I                                      53.5    8e-07   
ref|XP_008374469.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.1    1e-06   
ref|XP_010929097.1|  PREDICTED: nucleobase-ascorbate transporter ...  53.1    1e-06   
ref|XP_009385304.1|  PREDICTED: nucleobase-ascorbate transporter ...  52.8    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001149779.1|  permease I                                       52.8    1e-06   
ref|NP_001288584.1|  uncharacterized protein LOC103625746             52.8    1e-06   Zea mays [maize]
ref|XP_009391740.1|  PREDICTED: nucleobase-ascorbate transporter ...  52.8    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006836697.1|  hypothetical protein AMTR_s00088p00102240        52.8    2e-06   Amborella trichopoda
ref|XP_009391739.1|  PREDICTED: nucleobase-ascorbate transporter ...  52.8    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650817.1|  PREDICTED: nucleobase-ascorbate transporter ...  52.4    2e-06   Oryza brachyantha
ref|XP_006660592.1|  PREDICTED: nucleobase-ascorbate transporter ...  52.4    2e-06   Oryza brachyantha
ref|NP_001063058.1|  Os09g0381100                                     52.4    2e-06   
ref|XP_008806320.1|  PREDICTED: nucleobase-ascorbate transporter ...  52.0    3e-06   
ref|XP_008806323.1|  PREDICTED: nucleobase-ascorbate transporter ...  52.0    3e-06   Phoenix dactylifera
gb|EYU29705.1|  hypothetical protein MIMGU_mgv1a004288mg              51.6    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_009391237.1|  PREDICTED: nucleobase-ascorbate transporter ...  51.6    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417550.1|  PREDICTED: nucleobase-ascorbate transporter ...  51.6    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK40823.1|  hypothetical protein AALP_AA2G046200                  51.6    4e-06   Arabis alpina [alpine rockcress]
gb|AAC19401.1|  permease 1                                            50.4    1e-05   Mesembryanthemum crystallinum
gb|AAC19400.1|  permease 1                                            50.4    1e-05   Mesembryanthemum crystallinum
ref|NP_176211.2|  nucleobase-ascorbate transporter 7                  50.4    1e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01000.1|  hypothetical protein                                 50.4    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAD14479.1|  Strong similarity to gi|3337350 F13P17.3 putative...  50.4    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006857136.1|  hypothetical protein AMTR_s00065p00152120        50.4    1e-05   Amborella trichopoda
gb|ADE76021.1|  unknown                                               47.0    1e-05   Picea sitchensis
ref|XP_010691555.1|  PREDICTED: nucleobase-ascorbate transporter 4    50.4    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010474016.1|  PREDICTED: nucleobase-ascorbate transporter ...  47.8    2e-05   Camelina sativa [gold-of-pleasure]
gb|AFW67127.1|  hypothetical protein ZEAMMB73_289331                  48.5    2e-05   
ref|NP_001051745.1|  Os03g0823800                                     49.7    2e-05   
gb|EAY92392.1|  hypothetical protein OsI_14125                        49.7    2e-05   Oryza sativa Indica Group [Indian rice]
gb|EAZ29114.1|  hypothetical protein OsJ_13173                        49.7    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386652.1|  PREDICTED: nucleobase-ascorbate transporter ...  48.9    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002886639.1|  xanthine/uracil permease family protein          48.9    3e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_008810107.1|  PREDICTED: nucleobase-ascorbate transporter ...  48.9    4e-05   Phoenix dactylifera
gb|EPS61022.1|  nucleobase ascorbate transporter                      47.8    4e-05   Genlisea aurea
ref|XP_003555298.1|  PREDICTED: nucleobase-ascorbate transporter ...  48.5    4e-05   Glycine max [soybeans]
ref|XP_009103320.1|  PREDICTED: nucleobase-ascorbate transporter 7    48.5    4e-05   Brassica rapa
emb|CDY24508.1|  BnaA01g22120D                                        48.5    4e-05   Brassica napus [oilseed rape]
emb|CDP00202.1|  unnamed protein product                              48.5    5e-05   Coffea canephora [robusta coffee]
ref|XP_006300441.1|  hypothetical protein CARUB_v10020111mg           48.1    6e-05   Capsella rubella
ref|XP_010470160.1|  PREDICTED: nucleobase-ascorbate transporter ...  47.8    8e-05   
ref|XP_010510979.1|  PREDICTED: nucleobase-ascorbate transporter 7    47.8    8e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010470161.1|  PREDICTED: nucleobase-ascorbate transporter ...  47.8    9e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006392193.1|  hypothetical protein EUTSA_v10023405mg           47.4    1e-04   Eutrema salsugineum [saltwater cress]
ref|XP_002265128.1|  PREDICTED: nucleobase-ascorbate transporter 4    47.4    1e-04   Vitis vinifera
emb|CAN81484.1|  hypothetical protein VITISV_015553                   47.4    1e-04   Vitis vinifera
ref|XP_010418834.1|  PREDICTED: nucleobase-ascorbate transporter ...  47.0    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004982109.1|  PREDICTED: nucleobase-ascorbate transporter ...  47.0    2e-04   Setaria italica
gb|KJB47303.1|  hypothetical protein B456_008G019900                  46.6    2e-04   Gossypium raimondii
gb|KHG02370.1|  Nucleobase-ascorbate transporter 4 -like protein      46.6    2e-04   Gossypium arboreum [tree cotton]
ref|XP_010273039.1|  PREDICTED: nucleobase-ascorbate transporter ...  46.2    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010273036.1|  PREDICTED: nucleobase-ascorbate transporter ...  46.2    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010273034.1|  PREDICTED: nucleobase-ascorbate transporter ...  46.2    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010273019.1|  PREDICTED: nucleobase-ascorbate transporter ...  46.2    3e-04   
gb|KJB31307.1|  hypothetical protein B456_005G185400                  45.4    3e-04   Gossypium raimondii
ref|XP_007143130.1|  hypothetical protein PHAVU_007G046400g           46.2    3e-04   Phaseolus vulgaris [French bean]
ref|XP_007200240.1|  hypothetical protein PRUPE_ppa015287mg           45.8    4e-04   Prunus persica
emb|CDY33617.1|  BnaC01g28480D                                        45.8    4e-04   Brassica napus [oilseed rape]
ref|XP_010475923.1|  PREDICTED: nucleobase-ascorbate transporter 8    45.8    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009343913.1|  PREDICTED: nucleobase-ascorbate transporter ...  45.8    4e-04   Pyrus x bretschneideri [bai li]
ref|XP_009375676.1|  PREDICTED: nucleobase-ascorbate transporter ...  45.8    4e-04   Pyrus x bretschneideri [bai li]
ref|XP_010458403.1|  PREDICTED: nucleobase-ascorbate transporter ...  45.4    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_007042667.1|  Xanthine/uracil permease family protein isof...  45.4    6e-04   Theobroma cacao [chocolate]



>ref|XP_011087158.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087159.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087161.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087162.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
Length=531

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ Q+RKDRGKHWWDKFRSFKTDT SE
Sbjct  482  LDNTMHKKDSQIRKDRGKHWWDKFRSFKTDTRSE  515



>ref|XP_009803945.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
sylvestris]
 ref|XP_009803946.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
sylvestris]
Length=532

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ Q RKDRGKHWWDKF+SFKTDT SE
Sbjct  483  LDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSE  516



>ref|XP_009608483.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009608484.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009608485.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009608486.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana 
tomentosiformis]
Length=532

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ Q RKDRGKHWWDKF+SFKTDT SE
Sbjct  483  LDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSE  516



>ref|XP_004241491.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
 ref|XP_010322558.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
 gb|AAX73299.1| putative permease I [Solanum lycopersicum]
Length=535

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ Q RKDRGKHWWDKF+SFKTDT SE
Sbjct  486  LDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSE  519



>ref|XP_009608481.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Nicotiana 
tomentosiformis]
Length=590

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ Q RKDRGKHWWDKF+SFKTDT SE
Sbjct  541  LDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSE  574



>gb|KEH31855.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=380

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKKE  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  331  LDNTLHKKESAIRKDRGKHWWDKYRSFKTDTRSE  364



>gb|AAX95758.2| xanthine/uracil permease family protein [Solanum lycopersicum]
Length=695

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ Q RKDRGKHWWDKF+SFKTDT SE
Sbjct  646  LDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSE  679



>ref|XP_004508844.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Cicer arietinum]
Length=531

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKKE  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  482  LDNTLHKKESSIRKDRGKHWWDKYRSFKTDTRSE  515



>ref|XP_004508843.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Cicer arietinum]
Length=567

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKKE  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  518  LDNTLHKKESSIRKDRGKHWWDKYRSFKTDTRSE  551



>gb|KEH31856.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=483

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKKE  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  434  LDNTLHKKESAIRKDRGKHWWDKYRSFKTDTRSE  467



>gb|AAL76261.1|AF466824_1 putative permease 1 [Arabidopsis thaliana]
Length=216

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  167  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  200



>ref|XP_003608951.1| Nucleobase ascorbate transporter [Medicago truncatula]
 gb|AES91148.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=532

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKKE  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  483  LDNTLHKKESAIRKDRGKHWWDKYRSFKTDTRSE  516



>gb|KHN48615.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKKE  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  484  LDNTLHKKEAAIRKDRGKHWWDKYRSFKTDTRSE  517



>ref|XP_003549636.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Glycine max]
 ref|XP_006600655.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Glycine max]
 gb|KHN18481.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKKE  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  484  LDNTLHKKEAAIRKDRGKHWWDKYRSFKTDTRSE  517



>ref|XP_006579556.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Glycine max]
 ref|XP_006579557.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Glycine max]
Length=533

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKKE  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  484  LDNTLHKKEAAIRKDRGKHWWDKYRSFKTDTRSE  517



>ref|XP_009610581.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Nicotiana tomentosiformis]
Length=482

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ QVRKDRGK WWDKF+SFKTDT SE
Sbjct  433  LDNTMHKKDSQVRKDRGKPWWDKFKSFKTDTRSE  466



>ref|XP_009610578.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009610579.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009610580.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Nicotiana tomentosiformis]
Length=525

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ QVRKDRGK WWDKF+SFKTDT SE
Sbjct  476  LDNTMHKKDSQVRKDRGKPWWDKFKSFKTDTRSE  509



>gb|AIS71908.1| nucleobase-ascorbate transporter 6-like isoform 1 [Nicotiana 
tabacum]
Length=532

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+ QVRKDRGK WWDKF+SFKTDT SE
Sbjct  483  LDNTMHKKDSQVRKDRGKPWWDKFKSFKTDTRSE  516



>ref|XP_010678709.1| PREDICTED: nucleobase-ascorbate transporter 6 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678710.1| PREDICTED: nucleobase-ascorbate transporter 6 [Beta vulgaris 
subsp. vulgaris]
Length=531

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+KE  VRKDRGKHWWDKFRSFK DT SE
Sbjct  482  LDNTLHRKESSVRKDRGKHWWDKFRSFKGDTRSE  515



>ref|XP_002283469.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera]
 ref|XP_010663208.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera]
 emb|CBI15075.3| unnamed protein product [Vitis vinifera]
Length=531

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  VRKDRGKHWWDKFRSFKTDT SE
Sbjct  482  LDITLHRKDGSVRKDRGKHWWDKFRSFKTDTRSE  515



>gb|AAK59508.2| putative permease 1 [Arabidopsis thaliana]
Length=360

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  311  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  344



>gb|AET03140.2| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=533

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ Q RKDRG HWWDKFRSFKTDT SE
Sbjct  484  LDVTLHKKDNQTRKDRGMHWWDKFRSFKTDTRSE  517



>ref|XP_003628664.1| Nucleobase ascorbate transporter [Medicago truncatula]
Length=549

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ Q RKDRG HWWDKFRSFKTDT SE
Sbjct  500  LDVTLHKKDNQTRKDRGMHWWDKFRSFKTDTRSE  533



>ref|XP_008453115.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis melo]
 ref|XP_008453116.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis melo]
 ref|XP_008453117.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis melo]
 ref|XP_008453119.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis melo]
Length=530

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  481  LDNTMHKKDGAIRKDRGKHWWDKFRSFKGDTRSE  514



>gb|AGV54390.1| nucleobase-ascorbate transporter 6-like protein [Phaseolus vulgaris]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  483  LDNTIHKKDGAIRKDRGKHWWDKYRSFKTDTRSE  516



>ref|XP_007155396.1| hypothetical protein PHAVU_003G197800g [Phaseolus vulgaris]
 gb|ESW27390.1| hypothetical protein PHAVU_003G197800g [Phaseolus vulgaris]
Length=533

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDK+RSFKTDT SE
Sbjct  484  LDNTIHKKDGAIRKDRGKHWWDKYRSFKTDTRSE  517



>ref|XP_010550666.1| PREDICTED: nucleobase-ascorbate transporter 6 [Tarenaya hassleriana]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  VRKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDSTLHKKDGSVRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_010444153.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Camelina 
sativa]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_010459419.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Camelina 
sativa]
 ref|XP_010459427.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Camelina 
sativa]
 ref|XP_010484002.1| PREDICTED: nucleobase-ascorbate transporter 6 [Camelina sativa]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>emb|CDX84363.1| BnaC03g51370D [Brassica napus]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_009151410.1| PREDICTED: nucleobase-ascorbate transporter 6 [Brassica rapa]
 emb|CDY00333.1| BnaA06g22340D [Brassica napus]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_009112041.1| PREDICTED: nucleobase-ascorbate transporter 6 [Brassica rapa]
 ref|XP_009112042.1| PREDICTED: nucleobase-ascorbate transporter 6 [Brassica rapa]
 emb|CDY16755.1| BnaA09g06270D [Brassica napus]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>emb|CDY56736.1| BnaC09g50870D [Brassica napus]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_006394340.1| hypothetical protein EUTSA_v10003977mg [Eutrema salsugineum]
 gb|ESQ31626.1| hypothetical protein EUTSA_v10003977mg [Eutrema salsugineum]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_006280290.1| hypothetical protein CARUB_v10026214mg [Capsella rubella]
 gb|EOA13188.1| hypothetical protein CARUB_v10026214mg [Capsella rubella]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|NP_201094.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 ref|NP_851251.2| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 ref|NP_001032127.2| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 sp|Q27GI3.2|NAT6_ARATH RecName: Full=Nucleobase-ascorbate transporter 6; Short=AtNAT6 
[Arabidopsis thaliana]
 gb|AAM47573.1|AF466198_1 putative permease 1 [Arabidopsis thaliana]
 dbj|BAB10858.1| permease 1 [Arabidopsis thaliana]
 gb|AED97668.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 gb|AED97669.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 gb|AED97670.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_002864824.1| hypothetical protein ARALYDRAFT_496474 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41083.1| hypothetical protein ARALYDRAFT_496474 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_009782990.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nicotiana sylvestris]
 ref|XP_009782991.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nicotiana sylvestris]
 ref|XP_009782992.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nicotiana sylvestris]
Length=525

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRGK WWDKF+SFKTDT SE
Sbjct  476  LDNTLHKKDSQVRKDRGKPWWDKFKSFKTDTRSE  509



>ref|XP_006345027.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Solanum tuberosum]
 ref|XP_006345028.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Solanum tuberosum]
Length=525

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHK++ QVRKDRGK WWDKF+SFKTDT SE
Sbjct  476  LDNTMHKRDGQVRKDRGKPWWDKFKSFKTDTRSE  509



>ref|XP_004236131.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
 ref|XP_004236132.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
 ref|XP_004236133.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
Length=525

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHK++ QVRKDRGK WWDKF+SFKTDT SE
Sbjct  476  LDNTMHKRDGQVRKDRGKPWWDKFKSFKTDTRSE  509



>ref|XP_010519558.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Tarenaya 
hassleriana]
 ref|XP_010519559.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Tarenaya 
hassleriana]
Length=532

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  483  LDNTLHKKDGSIRKDRGKHWWDKFRSFKGDTRSE  516



>ref|XP_011071803.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
 ref|XP_011071804.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
 ref|XP_011071805.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
 ref|XP_011071806.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
 ref|XP_011071807.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
Length=530

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
             D  + KK+ Q+RKDRGKHWWDKFRSFKTDT SE
Sbjct  481  FDNTLDKKDPQIRKDRGKHWWDKFRSFKTDTRSE  514



>ref|XP_004138122.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Cucumis sativus]
 ref|XP_004155010.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Cucumis sativus]
 gb|KGN63603.1| hypothetical protein Csa_1G005640 [Cucumis sativus]
Length=530

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  481  LDNTLHKKDGAIRKDRGKHWWDKFRSFKGDTRSE  514



>emb|CDY30739.1| BnaA02g33610D [Brassica napus]
Length=504

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSF+ DT SE
Sbjct  455  LDNTLHKKDSSIRKDRGKHWWDKFRSFRGDTRSE  488



>emb|CDY45747.1| BnaC02g42350D [Brassica napus]
Length=515

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSF+ DT SE
Sbjct  466  LDNTLHKKDSSIRKDRGKHWWDKFRSFRGDTRSE  499



>ref|XP_011028608.1| PREDICTED: nucleobase-ascorbate transporter 6 [Populus euphratica]
 ref|XP_011028609.1| PREDICTED: nucleobase-ascorbate transporter 6 [Populus euphratica]
 ref|XP_011028611.1| PREDICTED: nucleobase-ascorbate transporter 6 [Populus euphratica]
 ref|XP_011028612.1| PREDICTED: nucleobase-ascorbate transporter 6 [Populus euphratica]
Length=528

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK DT SE
Sbjct  479  LDTTLHRKDSSIRKDRGKHWWDKFRSFKGDTRSE  512



>ref|XP_009130240.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brassica 
rapa]
Length=532

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKFRSF+ DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKFRSFRGDTRSE  516



>ref|XP_004509863.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Cicer arietinum]
Length=533

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KKE Q RKDRG HWWDKFRSFKTDT SE
Sbjct  484  LDVTLRKKENQTRKDRGMHWWDKFRSFKTDTRSE  517



>emb|CAH58638.1| putative xanthine/uracil permease [Plantago major]
Length=100

 Score = 60.5 bits (145),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKKE Q+RKDRGKHWWDKF+S+KTD  SE
Sbjct  51   LDNTMHKKEAQIRKDRGKHWWDKFKSYKTDARSE  84



>ref|XP_003574490.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=533

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MH+++  VR+DRG HWWDKFRSFKTDT SE
Sbjct  484  LDNTMHRRDSAVRRDRGYHWWDKFRSFKTDTRSE  517



>ref|XP_007209884.1| hypothetical protein PRUPE_ppa003999mg [Prunus persica]
 gb|EMJ11083.1| hypothetical protein PRUPE_ppa003999mg [Prunus persica]
Length=536

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  VRKDRGKHWWDKFRSFK D+ SE
Sbjct  487  LDNTLHRKDSSVRKDRGKHWWDKFRSFKGDSRSE  520



>gb|KDO69758.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=433

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRG+HWWDKF SFK DT SE
Sbjct  384  LDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSE  417



>gb|KDO69759.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=434

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRG+HWWDKF SFK DT SE
Sbjct  385  LDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSE  418



>ref|XP_006439754.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 gb|ESR52994.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
Length=434

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRG+HWWDKF SFK DT SE
Sbjct  385  LDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSE  418



>gb|KDO69757.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=484

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRG+HWWDKF SFK DT SE
Sbjct  435  LDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSE  468



>gb|KDO69752.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=501

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRG+HWWDKF SFK DT SE
Sbjct  452  LDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSE  485



>gb|KDO69748.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
 gb|KDO69749.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
 gb|KDO69750.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
 gb|KDO69751.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=531

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRG+HWWDKF SFK DT SE
Sbjct  482  LDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSE  515



>ref|XP_006476733.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Citrus sinensis]
 ref|XP_006476734.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Citrus sinensis]
Length=531

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRG+HWWDKF SFK DT SE
Sbjct  482  LDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSE  515



>ref|XP_006439755.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 ref|XP_006439756.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 ref|XP_006439757.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 gb|ESR52995.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 gb|ESR52996.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 gb|ESR52997.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
Length=531

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ QVRKDRG+HWWDKF SFK DT SE
Sbjct  482  LDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSE  515



>gb|KJB19548.1| hypothetical protein B456_003G109900 [Gossypium raimondii]
Length=399

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK D+ SE
Sbjct  350  LDNTLHRKDSAIRKDRGKHWWDKFRSFKGDSRSE  383



>ref|XP_007036127.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007036128.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007036129.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20628.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20629.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20630.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
Length=530

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK D+ SE
Sbjct  481  LDNTLHRKDSSIRKDRGKHWWDKFRSFKGDSRSE  514



>gb|KJB53228.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=399

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK D+ SE
Sbjct  350  LDNTLHRKDSGIRKDRGKHWWDKFRSFKGDSRSE  383



>gb|KJB19546.1| hypothetical protein B456_003G109900 [Gossypium raimondii]
 gb|KJB19547.1| hypothetical protein B456_003G109900 [Gossypium raimondii]
 gb|KJB19552.1| hypothetical protein B456_003G109900 [Gossypium raimondii]
Length=531

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK D+ SE
Sbjct  482  LDNTLHRKDSAIRKDRGKHWWDKFRSFKGDSRSE  515



>ref|XP_002311584.2| hypothetical protein POPTR_0008s14580g [Populus trichocarpa]
 gb|EEE88951.2| hypothetical protein POPTR_0008s14580g [Populus trichocarpa]
Length=483

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+   RKDRG HWWD+FRSFKTDT SE
Sbjct  434  LDVTLHKKDTTTRKDRGMHWWDRFRSFKTDTRSE  467



>ref|XP_004501951.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Cicer arietinum]
 ref|XP_004501952.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Cicer arietinum]
Length=532

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDK++SFK DT SE
Sbjct  483  LDNTLHKKDSSIRKDRGKHWWDKYKSFKGDTRSE  516



>gb|EYU42538.1| hypothetical protein MIMGU_mgv1a004467mg [Erythranthe guttata]
Length=525

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
             D  + KK+ Q+RKDRGKHWWDKF++FKTDT SE
Sbjct  476  FDNTLEKKDPQIRKDRGKHWWDKFKTFKTDTRSE  509



>ref|XP_011021644.1| PREDICTED: nucleobase-ascorbate transporter 7 [Populus euphratica]
Length=534

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+   RKDRG HWWD+FRSFKTDT SE
Sbjct  485  LDVTLHKKDTATRKDRGMHWWDRFRSFKTDTRSE  518



>ref|XP_011025599.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011025607.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011025614.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
Length=534

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+   RKDRG HWWD+FRSFKTDT SE
Sbjct  485  LDVTLHKKDTATRKDRGMHWWDRFRSFKTDTRSE  518



>ref|XP_002315809.1| xanthine/uracil permease family protein [Populus trichocarpa]
 gb|EEF01980.1| xanthine/uracil permease family protein [Populus trichocarpa]
Length=534

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+   RKDRG HWWD+FRSFKTDT SE
Sbjct  485  LDVTLHKKDTATRKDRGMHWWDRFRSFKTDTRSE  518



>ref|XP_010100509.1| Nucleobase-ascorbate transporter 6 [Morus notabilis]
 gb|EXB82643.1| Nucleobase-ascorbate transporter 6 [Morus notabilis]
Length=534

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+   RKDRG HWWD+FRSFKTDT SE
Sbjct  485  LDVTLHKKDNATRKDRGMHWWDRFRSFKTDTRSE  518



>ref|XP_006438462.1| hypothetical protein CICLE_v10031192mg [Citrus clementina]
 ref|XP_006483790.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Citrus sinensis]
 ref|XP_006483791.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Citrus sinensis]
 ref|XP_006483792.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X3 
[Citrus sinensis]
 gb|ESR51702.1| hypothetical protein CICLE_v10031192mg [Citrus clementina]
 gb|KDO82572.1| hypothetical protein CISIN_1g009393mg [Citrus sinensis]
Length=535

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+   RKDRG HWWD+FRSFKTDT SE
Sbjct  486  LDVTLHKKDNATRKDRGMHWWDRFRSFKTDTRSE  519



>gb|KJB77978.1| hypothetical protein B456_012G170700 [Gossypium raimondii]
Length=540

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG HWWDKFRSFKTDT SE
Sbjct  491  LDVTLHRKDNATRKDRGMHWWDKFRSFKTDTRSE  524



>gb|KHG18287.1| Nucleobase-ascorbate transporter 7 -like protein [Gossypium arboreum]
Length=542

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG HWWDKFRSFKTDT SE
Sbjct  493  LDVTLHRKDNATRKDRGMHWWDKFRSFKTDTRSE  526



>gb|KJB53223.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=483

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK D+ SE
Sbjct  434  LDNTLHRKDSGIRKDRGKHWWDKFRSFKGDSRSE  467



>gb|KJB53217.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
 gb|KJB53218.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
 gb|KJB53219.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
 gb|KJB53221.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=525

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK D+ SE
Sbjct  476  LDNTLHRKDSGIRKDRGKHWWDKFRSFKGDSRSE  509



>gb|KHG14639.1| Nucleobase-ascorbate transporter 6 -like protein [Gossypium arboreum]
Length=525

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK D+ SE
Sbjct  476  LDNTLHRKDSGIRKDRGKHWWDKFRSFKGDSRSE  509



>ref|XP_010028015.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 ref|XP_010028021.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 ref|XP_010028028.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 ref|XP_010028035.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 ref|XP_010028045.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 gb|KCW83417.1| hypothetical protein EUGRSUZ_B00347 [Eucalyptus grandis]
Length=531

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  VRK+RGKHWWDKFRSFK DT SE
Sbjct  482  LDNTLHRKDGTVRKERGKHWWDKFRSFKGDTRSE  515



>ref|XP_002511446.1| purine permease, putative [Ricinus communis]
 gb|EEF52048.1| purine permease, putative [Ricinus communis]
Length=531

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFRSFK D  SE
Sbjct  482  LDNTLHRKDSSIRKDRGKHWWDKFRSFKGDIRSE  515



>gb|ABK93255.1| unknown [Populus trichocarpa]
Length=324

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  +RKDRGKHWWDKFRS+K DT SE
Sbjct  275  LDNTLHRNDSSIRKDRGKHWWDKFRSYKGDTRSE  308



>gb|KDP31138.1| hypothetical protein JCGZ_11514 [Jatropha curcas]
Length=530

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +K+  VRKDRGKHWWDKFRSFK DT SE
Sbjct  481  LDNTLQRKDSSVRKDRGKHWWDKFRSFKGDTRSE  514



>ref|XP_008239723.1| PREDICTED: nucleobase-ascorbate transporter 6 [Prunus mume]
 ref|XP_008239724.1| PREDICTED: nucleobase-ascorbate transporter 6 [Prunus mume]
 ref|XP_008239725.1| PREDICTED: nucleobase-ascorbate transporter 6 [Prunus mume]
Length=539

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  VRKDRGK+WWDKFRSFK+D+ SE
Sbjct  490  LDNTLHRKDSSVRKDRGKNWWDKFRSFKSDSRSE  523



>gb|KHN44541.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KK+ Q RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDVTLRKKDNQTRKDRGMHWWDRFRSFKTDTRSE  517



>gb|KHN10623.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KK+ Q RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDVTLRKKDNQTRKDRGMHWWDRFRSFKTDTRSE  517



>ref|XP_003552008.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Glycine max]
Length=533

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KK+ Q RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDVTLRKKDNQTRKDRGMHWWDRFRSFKTDTRSE  517



>ref|XP_003532028.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Glycine max]
Length=533

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KK+ Q RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDVTLRKKDNQTRKDRGMHWWDRFRSFKTDTRSE  517



>gb|KHG22799.1| Nucleobase-ascorbate transporter 6 -like protein [Gossypium arboreum]
Length=535

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  +RKDRGKHWWDKFR+FK D+ SE
Sbjct  486  LDNTLHRKDSAIRKDRGKHWWDKFRTFKGDSRSE  519



>gb|KEH35060.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=532

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HK++  +RKDRGKHWWDK++SFK DT SE
Sbjct  483  LDNTLHKRDSSIRKDRGKHWWDKYKSFKGDTRSE  516



>ref|XP_007044538.1| Nucleobase-ascorbate transporter 7 [Theobroma cacao]
 gb|EOY00370.1| Nucleobase-ascorbate transporter 7 [Theobroma cacao]
Length=536

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG HWWD+FRSFKTDT SE
Sbjct  487  LDVTLHRKDSTTRKDRGMHWWDRFRSFKTDTRSE  520



>gb|ABO30057.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30070.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30078.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30084.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
Length=151

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  102  LDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSE  135



>ref|XP_009360485.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Pyrus x bretschneideri]
 ref|XP_009360486.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Pyrus x bretschneideri]
 ref|XP_009363509.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Pyrus x bretschneideri]
 ref|XP_009363510.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Pyrus x bretschneideri]
Length=533

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDITLHRKDSATRKDRGMHWWDRFRSFKTDTRSE  517



>ref|XP_008389596.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Malus domestica]
 ref|XP_008389597.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Malus domestica]
Length=533

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDITLHRKDSATRKDRGMHWWDRFRSFKTDTRSE  517



>gb|ABO30011.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30012.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30013.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30014.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30015.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30016.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30017.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30018.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30019.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30020.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30021.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30022.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30023.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30024.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30025.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30026.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30027.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30028.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30029.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30030.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30031.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30032.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30033.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30034.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30035.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30036.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30037.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30038.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30039.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30040.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30041.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30042.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30043.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30044.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30045.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30046.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30047.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30048.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30049.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30050.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30051.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30052.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30053.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30054.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30055.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30056.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30058.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30059.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30060.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30061.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30062.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30063.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30064.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30065.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30066.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30067.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30068.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30071.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30072.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30073.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30074.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30075.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30076.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30077.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30079.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30080.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30081.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30082.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30083.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30085.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30086.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
Length=151

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  102  LDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSE  135



>ref|XP_008339995.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Malus domestica]
Length=533

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDITLHRKDNATRKDRGMHWWDRFRSFKTDTRSE  517



>ref|XP_002452570.1| hypothetical protein SORBIDRAFT_04g028300 [Sorghum bicolor]
 gb|EES05546.1| hypothetical protein SORBIDRAFT_04g028300 [Sorghum bicolor]
Length=537

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ E  VRKDRG HWWDKFRS++TDT SE
Sbjct  488  LDNTIHRHESSVRKDRGYHWWDKFRSYRTDTRSE  521



>gb|ABO30069.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
Length=151

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  102  LDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSE  135



>ref|XP_004953888.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Setaria italica]
Length=536

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ E  VRKDRG HWWDKFRS++TDT SE
Sbjct  487  LDNTIHRHENSVRKDRGYHWWDKFRSYRTDTRSE  520



>ref|XP_008393061.1| PREDICTED: nucleobase-ascorbate transporter 6 [Malus domestica]
 ref|XP_008393062.1| PREDICTED: nucleobase-ascorbate transporter 6 [Malus domestica]
Length=533

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+  VRKDRGKHWWDKFR FK D+ SE
Sbjct  484  LDNTLHRKDSSVRKDRGKHWWDKFRYFKGDSRSE  517



>ref|XP_002322154.1| xanthine/uracil permease family protein [Populus trichocarpa]
 ref|XP_006374513.1| hypothetical protein POPTR_0015s08380g [Populus trichocarpa]
 gb|EEF06281.1| xanthine/uracil permease family protein [Populus trichocarpa]
 gb|ERP52310.1| hypothetical protein POPTR_0015s08380g [Populus trichocarpa]
Length=528

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  +RKDRGKHWWDKFRS+K DT SE
Sbjct  479  LDNTLHRNDSSIRKDRGKHWWDKFRSYKGDTRSE  512



>ref|XP_003519478.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Glycine max]
 ref|XP_006574588.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X3 
[Glycine max]
 gb|KHN28662.1| Nucleobase-ascorbate transporter 7 [Glycine soja]
Length=531

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+ Q RKDRG HWWD+F SFKTDT SE
Sbjct  482  LDTTLHNKDSQTRKDRGMHWWDRFSSFKTDTRSE  515



>ref|XP_006339989.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Solanum tuberosum]
Length=532

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKKE   +KDRGK WW+KFRSFK+DT SE
Sbjct  483  LDNTMHKKESSTKKDRGKPWWNKFRSFKSDTRSE  516



>ref|XP_004252190.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
Length=532

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKKE   +KDRGK WW+KFRSFK+DT SE
Sbjct  483  LDNTMHKKESSTKKDRGKPWWNKFRSFKSDTRSE  516



>gb|KHN45288.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=511

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+ Q RKDRG HWWD+F SFKTDT SE
Sbjct  462  LDATLHNKDSQTRKDRGMHWWDRFSSFKTDTRSE  495



>ref|XP_006574587.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Glycine max]
Length=617

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+ Q RKDRG HWWD+F SFKTDT SE
Sbjct  568  LDTTLHNKDSQTRKDRGMHWWDRFSSFKTDTRSE  601



>ref|XP_003517836.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Glycine max]
 ref|XP_006573064.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X3 
[Glycine max]
 ref|XP_006573065.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X4 
[Glycine max]
Length=531

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+ Q RKDRG HWWD+F SFKTDT SE
Sbjct  482  LDATLHNKDSQTRKDRGMHWWDRFSSFKTDTRSE  515



>ref|XP_010913510.1| PREDICTED: LOW QUALITY PROTEIN: nucleobase-ascorbate transporter 
6 [Elaeis guineensis]
Length=533

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+++   RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDNTLHRRDSATRKDRGYHWWDRFRSFKTDTRSE  517



>ref|XP_006573063.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Glycine max]
Length=569

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+ Q RKDRG HWWD+F SFKTDT SE
Sbjct  520  LDATLHNKDSQTRKDRGMHWWDRFSSFKTDTRSE  553



>ref|XP_007157491.1| hypothetical protein PHAVU_002G074100g [Phaseolus vulgaris]
 gb|ESW29485.1| hypothetical protein PHAVU_002G074100g [Phaseolus vulgaris]
Length=531

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+ Q RKDRG HWWD+F SFKTDT SE
Sbjct  482  LDATLHNKDNQTRKDRGMHWWDRFSSFKTDTRSE  515



>ref|XP_011044342.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011044343.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011044344.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011044345.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011044346.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
Length=528

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWW KF+SFK DT SE
Sbjct  479  LDNTLHKKDSSIRKDRGKHWWAKFKSFKGDTRSE  512



>ref|XP_010546016.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Tarenaya 
hassleriana]
 ref|XP_010546018.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Tarenaya 
hassleriana]
Length=532

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KK+  VRKDRGKHWWDKF+SFK DT SE
Sbjct  483  LDNTLRKKDGSVRKDRGKHWWDKFKSFKGDTRSE  516



>gb|KDP21309.1| hypothetical protein JCGZ_21780 [Jatropha curcas]
Length=536

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+   +KDRG HWWDKFRSFKTDT SE
Sbjct  487  LDTTLHHKDNTTKKDRGMHWWDKFRSFKTDTRSE  520



>ref|XP_008446242.1| PREDICTED: nucleobase-ascorbate transporter 7 [Cucumis melo]
Length=534

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+  ++KDRG HWWDKFRSFKTDT SE
Sbjct  485  LDVTLHSKDNAMKKDRGMHWWDKFRSFKTDTRSE  518



>emb|CAJ84113.1| root uracil permease 1 [Oryza sativa Japonica Group]
Length=538

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  489  LDNTIHRHDSSVRKDRGHHWWDKFRSYRTDTRSE  522



>ref|NP_001048084.1| Os02g0741800 [Oryza sativa Japonica Group]
 dbj|BAD15728.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAD15771.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAF09998.1| Os02g0741800 [Oryza sativa Japonica Group]
 dbj|BAG93519.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73980.1| hypothetical protein OsI_08888 [Oryza sativa Indica Group]
 gb|EEE57787.1| hypothetical protein OsJ_08338 [Oryza sativa Japonica Group]
Length=538

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  489  LDNTIHRHDSSVRKDRGHHWWDKFRSYRTDTRSE  522



>ref|XP_004135225.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Cucumis sativus]
 ref|XP_004155342.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Cucumis sativus]
 gb|KGN51831.1| hypothetical protein Csa_5G603280 [Cucumis sativus]
Length=534

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+   +KDRG HWWDKFRSFKTDT SE
Sbjct  485  LDVTLHSKDNATKKDRGMHWWDKFRSFKTDTRSE  518



>ref|XP_008806500.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Phoenix dactylifera]
Length=533

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+++   RKDRG HWWD+FRSFKTD+ SE
Sbjct  484  LDNTLHRRDSATRKDRGYHWWDRFRSFKTDSRSE  517



>ref|XP_008245218.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Prunus mume]
Length=533

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDITLHRNDSATRKDRGMHWWDRFRSFKTDTRSE  517



>dbj|BAJ85445.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  487  LDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSE  520



>gb|EMS61607.1| Nucleobase-ascorbate transporter 6 [Triticum urartu]
Length=537

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  488  LDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSE  521



>gb|EMT04471.1| Nucleobase-ascorbate transporter 6 [Aegilops tauschii]
Length=561

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  487  LDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSE  520



>ref|XP_003573107.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=539

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  490  LDNTLHRHDSVVRKDRGYHWWDKFRSYRTDTRSE  523



>ref|XP_007221801.1| hypothetical protein PRUPE_ppa004044mg [Prunus persica]
 ref|XP_007221802.1| hypothetical protein PRUPE_ppa004044mg [Prunus persica]
 gb|EMJ23000.1| hypothetical protein PRUPE_ppa004044mg [Prunus persica]
 gb|EMJ23001.1| hypothetical protein PRUPE_ppa004044mg [Prunus persica]
Length=533

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG HWWD+FRSFKTDT SE
Sbjct  484  LDITLHRNDNATRKDRGMHWWDRFRSFKTDTRSE  517



>ref|XP_007138109.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 ref|XP_007138110.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 ref|XP_007138111.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 gb|ESW10103.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 gb|ESW10104.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 gb|ESW10105.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
Length=531

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + K+E  +RKDRGKHWWDK++SFK DT SE
Sbjct  482  LDNTLFKRESSIRKDRGKHWWDKYKSFKGDTRSE  515



>ref|XP_006647871.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha]
Length=537

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWWDKFRS++TDT SE
Sbjct  488  LDNTIHRHDGSVRKDRGYHWWDKFRSYRTDTRSE  521



>ref|XP_007153664.1| hypothetical protein PHAVU_003G054500g [Phaseolus vulgaris]
 gb|ESW25658.1| hypothetical protein PHAVU_003G054500g [Phaseolus vulgaris]
Length=534

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KK+ Q RKDRG  WWDKFRSFKTDT SE
Sbjct  485  LDVTLRKKDNQSRKDRGMQWWDKFRSFKTDTRSE  518



>gb|AFW73350.1| hypothetical protein ZEAMMB73_676690 [Zea mays]
Length=165

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + E  VR+DRG HWWDKFRS++TDT SE
Sbjct  116  LDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSE  149



>ref|XP_003613313.1| Nucleobase ascorbate transporter [Medicago truncatula]
 gb|AES96271.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
             D  +HK + Q RKDRG HWWD+F SFKTDT SE
Sbjct  489  FDVTLHKSDNQTRKDRGMHWWDRFSSFKTDTRSE  522



>ref|XP_009757662.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
sylvestris]
 ref|XP_009757663.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
sylvestris]
Length=532

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHKK+  ++KDRGK WW+KF+SFK+DT SE
Sbjct  483  LDNTMHKKDNAIKKDRGKPWWNKFKSFKSDTRSE  516



>ref|XP_003527028.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform 1 
[Glycine max]
 ref|XP_003527029.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform 2 
[Glycine max]
 gb|KHN19327.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=531

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + K+E  +RKDRGKHWWDK++SFK DT SE
Sbjct  482  LDNTLFKREAAIRKDRGKHWWDKYKSFKGDTRSE  515



>ref|NP_001061818.1| Os08g0420600 [Oryza sativa Japonica Group]
 dbj|BAC99450.1| putative permease [Oryza sativa Japonica Group]
 dbj|BAF23732.1| Os08g0420600 [Oryza sativa Japonica Group]
 gb|EAZ42764.1| hypothetical protein OsJ_27344 [Oryza sativa Japonica Group]
 dbj|BAG93520.1| unnamed protein product [Oryza sativa Japonica Group]
Length=533

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +++  VR+DRG HWWDKFRSFKTDT SE
Sbjct  484  LDNTIQRRDNGVRRDRGYHWWDKFRSFKTDTRSE  517



>gb|EEC83594.1| hypothetical protein OsI_29273 [Oryza sativa Indica Group]
Length=543

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +++  VR+DRG HWWDKFRSFKTDT SE
Sbjct  494  LDNTIQRRDNGVRRDRGYHWWDKFRSFKTDTRSE  527



>emb|CDP17001.1| unnamed protein product [Coffea canephora]
Length=531

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+ Q+RKDRGKH+WDKF+S+KTD  ++
Sbjct  482  LDNTLHKKDGQIRKDRGKHFWDKFKSYKTDQRTD  515



>gb|EPS64995.1| hypothetical protein M569_09784, partial [Genlisea aurea]
Length=128

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
             D  + KK+ +VRK+RGKHWWDKFRSFKTD+ SE
Sbjct  79   FDVSLEKKDEEVRKERGKHWWDKFRSFKTDSRSE  112



>ref|XP_010254659.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nelumbo nucifera]
Length=534

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MHK +   RKDRG HWWDKFRSFKTDT SE
Sbjct  486  LDITMHK-DSSTRKDRGLHWWDKFRSFKTDTRSE  518



>ref|XP_009799732.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Nicotiana 
sylvestris]
Length=533

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+   RKDRG  WWDKF+SFKTDT SE
Sbjct  484  LDVSLHKKDAATRKDRGMPWWDKFKSFKTDTRSE  517



>ref|XP_009595521.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Nicotiana 
tomentosiformis]
Length=533

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+   RKDRG  WWDKF+SFKTDT SE
Sbjct  484  LDVSLHKKDAATRKDRGMPWWDKFKSFKTDTRSE  517



>gb|EMT25940.1| Nucleobase-ascorbate transporter 6 [Aegilops tauschii]
Length=538

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MH  +  VRKDRG HWWDKFRSFK D  SE
Sbjct  489  LDNTMHLHQSAVRKDRGYHWWDKFRSFKKDARSE  522



>ref|XP_004973451.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Setaria italica]
Length=533

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +++  VR+DRG HWWDKFRSFKTD+ SE
Sbjct  484  LDNTIQRRDTAVRRDRGYHWWDKFRSFKTDSRSE  517



>ref|XP_010111541.1| Nucleobase-ascorbate transporter 6 [Morus notabilis]
 gb|EXC31174.1| Nucleobase-ascorbate transporter 6 [Morus notabilis]
Length=566

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXS  8
            LD  +H+++  +RKDRGKHWWDKFRS+K DT +
Sbjct  515  LDNTLHRRDGAIRKDRGKHWWDKFRSYKGDTRN  547



>ref|XP_010928566.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
Length=531

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  V+KDRG HWWDKFRSFKTD  S+
Sbjct  482  LDNTLHRHDSAVKKDRGYHWWDKFRSFKTDNRSD  515



>ref|XP_004489879.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Cicer arietinum]
Length=533

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXS  8
            LD  +H  + ++RKDRG HWWDKF SFKTDT S
Sbjct  484  LDASLHNSDSKIRKDRGMHWWDKFSSFKTDTRS  516



>ref|XP_006280300.1| hypothetical protein CARUB_v10026223mg [Capsella rubella]
 gb|EOA13198.1| hypothetical protein CARUB_v10026223mg [Capsella rubella]
Length=528

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWDKF +FK D  +E
Sbjct  479  LDTTLHKKDGSIRKDRGKHWWDKFWTFKKDPRTE  512



>gb|AFW73351.1| hypothetical protein ZEAMMB73_676690 [Zea mays]
Length=326

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + E  VR+DRG HWWDKFRS++TDT SE
Sbjct  277  LDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSE  310



>ref|XP_006355948.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Solanum tuberosum]
Length=483

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG  WWDKF+SFKTDT SE
Sbjct  434  LDVSLHRKDAATRKDRGMPWWDKFKSFKTDTRSE  467



>ref|XP_006659402.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha]
Length=533

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +++   R+DRG HWWDKFRSFKTDT SE
Sbjct  484  LDNTIQRRDNGARRDRGYHWWDKFRSFKTDTRSE  517



>ref|XP_006355947.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Solanum tuberosum]
Length=533

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG  WWDKF+SFKTDT SE
Sbjct  484  LDVSLHRKDAATRKDRGMPWWDKFKSFKTDTRSE  517



>ref|XP_010238137.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Brachypodium distachyon]
Length=483

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MH  +  VRKDRG HWWDKFRSFK D  S+
Sbjct  434  LDNTMHLHQSAVRKDRGYHWWDKFRSFKKDARSQ  467



>ref|XP_004297660.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011463385.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011463386.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
Length=533

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG  WWD+FRS+KTDT SE
Sbjct  484  LDTTLHRKDNATRKDRGMPWWDRFRSYKTDTRSE  517



>dbj|BAB08803.1| permease [Arabidopsis thaliana]
Length=483

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  434  LDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTE  467



>ref|XP_003523067.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Glycine max]
 ref|XP_006578614.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Glycine max]
 ref|XP_006578615.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X3 
[Glycine max]
 ref|XP_006578616.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X4 
[Glycine max]
 gb|KHN16309.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=531

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + K+   +RKDRGKHWWDK++SFK DT SE
Sbjct  482  LDNTLFKRAADIRKDRGKHWWDKYKSFKGDTRSE  515



>ref|XP_010472295.1| PREDICTED: nucleobase-ascorbate transporter 5-like [Camelina 
sativa]
Length=496

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  447  LDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTE  480



>ref|XP_004238704.1| PREDICTED: nucleobase-ascorbate transporter 7 [Solanum lycopersicum]
Length=533

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG  WWDKF+SFKTDT SE
Sbjct  484  LDVSLHRKDVATRKDRGMPWWDKFKSFKTDTRSE  517



>ref|XP_003578065.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Brachypodium distachyon]
Length=530

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  MH  +  VRKDRG HWWDKFRSFK D  S+
Sbjct  481  LDNTMHLHQSAVRKDRGYHWWDKFRSFKKDARSQ  514



>ref|XP_008643648.1| PREDICTED: LOC100282103 isoform X1 [Zea mays]
Length=483

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + E  VR+DRG HWWDKFRS++TDT SE
Sbjct  434  LDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSE  467



>ref|XP_010442477.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X1 [Camelina 
sativa]
 ref|XP_010442478.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X2 [Camelina 
sativa]
 ref|XP_010442479.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X2 [Camelina 
sativa]
Length=528

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  479  LDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTE  512



>ref|XP_002865770.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42029.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=528

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  479  LDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTE  512



>ref|NP_199810.2| xanthine/uracil permease family protein [Arabidopsis thaliana]
 sp|Q8RWE9.1|NAT5_ARATH RecName: Full=Nucleobase-ascorbate transporter 5; Short=AtNAT5 
[Arabidopsis thaliana]
 gb|AAM13136.1| permease [Arabidopsis thaliana]
 gb|AAP68326.1| At5g49990 [Arabidopsis thaliana]
 dbj|BAF01588.1| permease [Arabidopsis thaliana]
 gb|AED95881.1| xanthine/uracil permease family protein [Arabidopsis thaliana]
Length=528

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  479  LDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTE  512



>gb|KFK26633.1| hypothetical protein AALP_AA8G273900 [Arabis alpina]
Length=530

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  481  LDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTE  514



>ref|XP_010482302.1| PREDICTED: nucleobase-ascorbate transporter 5-like [Camelina 
sativa]
Length=549

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  500  LDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTE  533



>gb|ACN28348.1| unknown [Zea mays]
Length=528

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + E  VR+DRG HWWDKFRS++TDT SE
Sbjct  479  LDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSE  512



>gb|ACN34480.1| unknown [Zea mays]
 gb|ACN34637.1| unknown [Zea mays]
 gb|ACR35941.1| unknown [Zea mays]
Length=534

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + E  VR+DRG HWWDKFRS++TDT SE
Sbjct  485  LDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSE  518



>ref|NP_001148488.1| LOC100282103 [Zea mays]
 gb|ACG31696.1| permease I [Zea mays]
Length=534

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + E  VR+DRG HWWDKFRS++TDT SE
Sbjct  485  LDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSE  518



>ref|XP_004299577.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464518.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464519.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464520.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
Length=529

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  +RKDRGKHWWDKFRSFK D+ SE
Sbjct  481  LDNTLHR-DSTIRKDRGKHWWDKFRSFKGDSRSE  513



>gb|ACR38061.1| unknown [Zea mays]
Length=242

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  KE  VRKDRG HWW+KFRSFK D  S+
Sbjct  193  LDNTLQVKESAVRKDRGNHWWEKFRSFKKDARSQ  226



>ref|XP_002463615.1| hypothetical protein SORBIDRAFT_01g002960 [Sorghum bicolor]
 gb|EER90613.1| hypothetical protein SORBIDRAFT_01g002960 [Sorghum bicolor]
Length=528

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+++  VRKDRG H+WD+FRSFKTD  SE
Sbjct  479  LDNTLHRRDGTVRKDRGHHFWDRFRSFKTDPRSE  512



>ref|XP_004981228.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Setaria italica]
Length=529

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+++  VRKDRG H+WD+FRSFKTD  SE
Sbjct  480  LDNTLHRRDGTVRKDRGHHFWDRFRSFKTDPRSE  513



>ref|XP_010272020.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nelumbo nucifera]
 ref|XP_010272021.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nelumbo nucifera]
Length=535

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKD G HWW KFRSFKTDT SE
Sbjct  486  LDITLHRKDSATRKDSGMHWWVKFRSFKTDTRSE  519



>emb|CDX71592.1| BnaC09g26330D [Brassica napus]
Length=530

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  481  LDTTLHKKDGSIRKDRGKHWWDRFWTFKGDPRTE  514



>ref|XP_006402200.1| hypothetical protein EUTSA_v10013227mg [Eutrema salsugineum]
 gb|ESQ43653.1| hypothetical protein EUTSA_v10013227mg [Eutrema salsugineum]
Length=530

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +RKDRGKHWWD+F +FK D  +E
Sbjct  481  LDTTLHKKDGSIRKDRGKHWWDRFWTFKGDPRTE  514



>ref|XP_010043812.1| PREDICTED: nucleobase-ascorbate transporter 7 [Eucalyptus grandis]
 gb|KCW85810.1| hypothetical protein EUGRSUZ_B02555 [Eucalyptus grandis]
Length=537

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  106  LDXXMHK-KEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ K+   R+DRG HWWD+FRSFKTDT SE
Sbjct  487  LDITLHRSKDSTTRRDRGMHWWDRFRSFKTDTRSE  521



>ref|XP_011086504.1| PREDICTED: nucleobase-ascorbate transporter 7 [Sesamum indicum]
 ref|XP_011086505.1| PREDICTED: nucleobase-ascorbate transporter 7 [Sesamum indicum]
Length=534

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG HWWDKFRS+KTDT SE
Sbjct  485  LDVTLPPKDNTTRKDRGMHWWDKFRSYKTDTRSE  518



>ref|NP_001141421.1| uncharacterized protein LOC100273531 [Zea mays]
 gb|ACF86349.1| unknown [Zea mays]
 gb|ACG30077.1| permease [Zea mays]
 tpg|DAA49132.1| TPA: permease [Zea mays]
Length=533

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  ++  VR+DRG HWWDKFRSFKTD+ SE
Sbjct  484  LDNTIQVRDSGVRRDRGYHWWDKFRSFKTDSRSE  517



>ref|XP_002444345.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor]
 gb|EES13840.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor]
Length=533

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  ++  VR+DRG HWWDKFRSFKTD+ SE
Sbjct  484  LDNTIQVRDSGVRRDRGYHWWDKFRSFKTDSRSE  517



>emb|CAN79848.1| hypothetical protein VITISV_025959 [Vitis vinifera]
Length=524

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG  WW+KFRSFKTD+ SE
Sbjct  475  LDSTLHRKDNTTRKDRGMIWWEKFRSFKTDSRSE  508



>ref|XP_002268811.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera]
 ref|XP_010653028.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera]
 emb|CBI32088.3| unnamed protein product [Vitis vinifera]
Length=541

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+K+   RKDRG  WW+KFRSFKTD+ SE
Sbjct  492  LDSTLHRKDNTTRKDRGMIWWEKFRSFKTDSRSE  525



>ref|XP_010556259.1| PREDICTED: nucleobase-ascorbate transporter 7 [Tarenaya hassleriana]
Length=533

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HKK+  +R+DRG  WW++FRSFK+DT SE
Sbjct  484  LDLMLHKKDSSMRRDRGLQWWERFRSFKSDTRSE  517



>ref|XP_010037590.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Eucalyptus 
grandis]
 gb|KCW49319.1| hypothetical protein EUGRSUZ_K02873 [Eucalyptus grandis]
Length=526

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KK+ Q+RKDRGK WWDKF+SF  DT S+
Sbjct  477  LDNTLLKKDGQIRKDRGKEWWDKFKSFSGDTRSQ  510



>ref|XP_003559230.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=158

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG H+WD+FRSFKTD  SE
Sbjct  109  LDSTLHRHDSTARKDRGHHFWDRFRSFKTDPRSE  142



>ref|XP_009418014.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=531

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWW KFRSFK D+ S+
Sbjct  482  LDNTLHRNDSTVRKDRGYHWWQKFRSFKGDSRSD  515



>gb|ACG35525.1| permease I [Zea mays]
Length=530

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  KE  VRKDRG HWW+KFRSFK D  S+
Sbjct  481  LDNTLQVKESAVRKDRGNHWWEKFRSFKKDARSQ  514



>ref|NP_001140868.1| uncharacterized protein LOC100272944 [Zea mays]
 gb|ACF78516.1| unknown [Zea mays]
 gb|ACF84845.1| unknown [Zea mays]
 tpg|DAA61282.1| TPA: permease I [Zea mays]
Length=530

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  KE  VRKDRG HWW+KFRSFK D  S+
Sbjct  481  LDNTLQVKESAVRKDRGNHWWEKFRSFKKDARSQ  514



>gb|EEC84500.1| hypothetical protein OsI_31190 [Oryza sativa Indica Group]
Length=216

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +      VRKDRG HWWDKFRSFK D  SE
Sbjct  167  LDNTIETHNNTVRKDRGYHWWDKFRSFKKDARSE  200



>ref|XP_002531406.1| purine permease, putative [Ricinus communis]
 gb|EEF30990.1| purine permease, putative [Ricinus communis]
Length=536

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H K+   RKDRG  WW KFRSFKTDT SE
Sbjct  487  LDITLHHKDQATRKDRGVSWWAKFRSFKTDTRSE  520



>ref|XP_010682619.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682620.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682621.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682622.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682623.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
Length=533

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + KK+  +RKDRG  WWD+FRSFK+DT SE
Sbjct  484  LDVTLRKKDSAIRKDRGVIWWDRFRSFKSDTRSE  517



>ref|XP_010532270.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X2 [Tarenaya 
hassleriana]
Length=491

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  ++KK+  +RKDRGKHWWD+F +FK D+ +E
Sbjct  442  LDTTVYKKDGSIRKDRGKHWWDRFWTFKGDSRTE  475



>ref|XP_009411043.1| PREDICTED: nucleobase-ascorbate transporter LPE1-like [Musa acuminata 
subsp. malaccensis]
Length=530

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + E  +R+DRG HWWDKFRS++TDT SE
Sbjct  481  LDCTLLRGEASIRRDRGWHWWDKFRSYRTDTRSE  514



>ref|XP_009118902.1| PREDICTED: nucleobase-ascorbate transporter 5 [Brassica rapa]
 ref|XP_009118903.1| PREDICTED: nucleobase-ascorbate transporter 5 [Brassica rapa]
Length=529

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HK +  +RKDRGKHWWD+F +FK D  +E
Sbjct  480  LDTTLHKNDGSIRKDRGKHWWDRFWTFKGDPRTE  513



>emb|CDY37762.1| BnaA10g05590D [Brassica napus]
Length=530

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +HK +  +RKDRGKHWWD+F +FK D  +E
Sbjct  481  LDTTLHKNDGSIRKDRGKHWWDRFWTFKGDPRTE  514



>ref|XP_010532269.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X1 [Tarenaya 
hassleriana]
Length=535

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  ++KK+  +RKDRGKHWWD+F +FK D+ +E
Sbjct  486  LDTTVYKKDGSIRKDRGKHWWDRFWTFKGDSRTE  519



>ref|XP_009619816.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009619817.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009619819.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
tomentosiformis]
Length=532

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  M KK+   +KDRGK WW+KF+SFK+DT SE
Sbjct  483  LDNTMTKKDNATKKDRGKPWWNKFKSFKSDTRSE  516



>ref|XP_009415384.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=528

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWW KFRSF  DT SE
Sbjct  479  LDNTLHRHDSAVRKDRGFHWWHKFRSFMGDTRSE  512



>ref|XP_009415380.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415381.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415382.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415383.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=531

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWW KFRSF  DT SE
Sbjct  482  LDNTLHRHDSAVRKDRGFHWWHKFRSFMGDTRSE  515



>dbj|BAJ89101.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG H+WD+FRSFKTD  SE
Sbjct  479  LDSTLHRHDSTARKDRGHHFWDRFRSFKTDPRSE  512



>gb|EMT02255.1| Nucleobase-ascorbate transporter 6 [Aegilops tauschii]
Length=529

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG H+WD+FRSFKTD  SE
Sbjct  480  LDSTLHRHDSTARKDRGHHFWDRFRSFKTDPRSE  513



>ref|XP_003563486.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=529

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG H+WD+FRSFKTD  SE
Sbjct  480  LDSTLHRHDSTARKDRGHHFWDRFRSFKTDPRSE  513



>gb|EMS47148.1| Nucleobase-ascorbate transporter 6 [Triticum urartu]
Length=551

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG H+WD+FRSFKTD  SE
Sbjct  502  LDSTLHRHDSTARKDRGHHFWDRFRSFKTDPRSE  535



>ref|NP_001150400.1| permease I [Zea mays]
 gb|ACG38946.1| permease I [Zea mays]
Length=529

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+++   RKDRG H+WD+FRSFKTD  SE
Sbjct  480  LDNTLHRRDGVARKDRGHHFWDRFRSFKTDPRSE  513



>tpg|DAA52241.1| TPA: permease I [Zea mays]
Length=529

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+++   RKDRG H+WD+FRSFKTD  SE
Sbjct  480  LDNTLHRRDGVARKDRGHHFWDRFRSFKTDPRSE  513



>ref|XP_008374469.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Malus domestica]
Length=533

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +K+  V+KDRGK WW+KFRSFK D+ SE
Sbjct  484  LDNTLQRKDSSVKKDRGKTWWNKFRSFKGDSRSE  517



>ref|XP_010929097.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929098.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929099.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929100.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
Length=531

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  +RKDRG+H+WD+FRSF  D+ SE
Sbjct  482  LDNTLHRHDSAIRKDRGRHFWDRFRSFNADSRSE  515



>ref|XP_009385304.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=533

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG H+WDKFRS+KTD  SE
Sbjct  484  LDNTLHRNDTTARKDRGYHFWDKFRSYKTDPRSE  517



>ref|NP_001149779.1| permease I [Zea mays]
 gb|ACG36768.1| permease I [Zea mays]
Length=531

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +++  VRKDRG H+WD+FRSFKTD  SE
Sbjct  482  LDNTLQRRDGAVRKDRGHHFWDRFRSFKTDPRSE  515



>ref|NP_001288584.1| uncharacterized protein LOC103625746 [Zea mays]
 ref|XP_008644369.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Zea mays]
 gb|ACF82086.1| unknown [Zea mays]
Length=531

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +++  VRKDRG H+WD+FRSFKTD  SE
Sbjct  482  LDNTLQRRDGAVRKDRGHHFWDRFRSFKTDPRSE  515



>ref|XP_009391740.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=531

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWW KFRS+K D  SE
Sbjct  482  LDNSLHRHDSAVRKDRGLHWWHKFRSYKGDPRSE  515



>ref|XP_006836697.1| hypothetical protein AMTR_s00088p00102240 [Amborella trichopoda]
 gb|ERM99550.1| hypothetical protein AMTR_s00088p00102240 [Amborella trichopoda]
Length=536

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  ++   RKDRG HWWDKFRSFK DT SE
Sbjct  487  LDITLPPRDTATRKDRGLHWWDKFRSFKGDTRSE  520



>ref|XP_009391739.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=557

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +  VRKDRG HWW KFRS+K D  SE
Sbjct  508  LDNSLHRHDSAVRKDRGLHWWHKFRSYKGDPRSE  541



>ref|XP_006650817.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha]
Length=529

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG H+WD+FRSF+TD  SE
Sbjct  480  LDNTLHRHDSTARKDRGHHFWDRFRSFRTDPRSE  513



>ref|XP_006660592.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha]
Length=530

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +      VRKDRG HWWDKFRSFK D  SE
Sbjct  481  LDNTIETHNSTVRKDRGYHWWDKFRSFKKDARSE  514



>ref|NP_001063058.1| Os09g0381100 [Oryza sativa Japonica Group]
 dbj|BAD26097.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAF24972.1| Os09g0381100 [Oryza sativa Japonica Group]
 gb|EAZ08924.1| hypothetical protein OsI_31191 [Oryza sativa Indica Group]
 gb|EAZ44570.1| hypothetical protein OsJ_29191 [Oryza sativa Japonica Group]
 dbj|BAG89273.1| unnamed protein product [Oryza sativa Japonica Group]
Length=530

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +      VRKDRG HWWDKFRSFK D  SE
Sbjct  481  LDNTIETHNNTVRKDRGYHWWDKFRSFKKDARSE  514



>ref|XP_008806320.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008806321.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008806322.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Phoenix dactylifera]
Length=483

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG+H+WD+FRSF  D+ SE
Sbjct  434  LDNTLHRHDSATRKDRGRHFWDRFRSFNADSRSE  467



>ref|XP_008806323.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Phoenix dactylifera]
Length=540

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+ +   RKDRG+H+WD+FRSF  D+ SE
Sbjct  491  LDNTLHRHDSATRKDRGRHFWDRFRSFNADSRSE  524



>gb|EYU29705.1| hypothetical protein MIMGU_mgv1a004288mg [Erythranthe guttata]
Length=535

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWDKFRS+KTDT SE
Sbjct  486  LDVTLPPKDGGTRKDRGMQWWDKFRSYKTDTRSE  519



>ref|XP_009391237.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391238.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=535

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+     ++DRG HWW +FRSFK DT SE
Sbjct  486  LDNTLHRHHDATKRDRGYHWWKRFRSFKADTRSE  519



>ref|XP_009417550.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=534

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+     RKDRG HWW KFR+FK D  SE
Sbjct  485  LDNTLHRHNEATRKDRGYHWWKKFRNFKADMRSE  518



>gb|KFK40823.1| hypothetical protein AALP_AA2G046200 [Arabis alpina]
Length=534

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+ + RKDRG  WWD+FRSFK DT SE
Sbjct  485  LDVTLTSKDSETRKDRGMFWWDRFRSFKLDTRSE  518



>gb|AAC19401.1| permease 1 [Mesembryanthemum crystallinum]
Length=526

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H++    R+D G+HWW KFR+F  DT SE
Sbjct  477  LDLTLHRRHTATRRDSGRHWWKKFRTFDADTRSE  510



>gb|AAC19400.1| permease 1 [Mesembryanthemum crystallinum]
Length=528

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H++    R+D G+HWW KFR+F  DT SE
Sbjct  479  LDLTLHRRHTATRRDSGRHWWKKFRTFDADTRSE  512



>ref|NP_176211.2| nucleobase-ascorbate transporter 7 [Arabidopsis thaliana]
 sp|Q0WPE9.2|NAT7_ARATH RecName: Full=Nucleobase-ascorbate transporter 7; Short=AtNAT7 
[Arabidopsis thaliana]
 gb|AEE33651.1| nucleobase-ascorbate transporter 7 [Arabidopsis thaliana]
Length=538

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  M  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  489  LDVTMSSKDSATRKDRGMFWWDRFMSFKSDTRSE  522



>dbj|BAF01000.1| hypothetical protein [Arabidopsis thaliana]
Length=538

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  M  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  489  LDVTMSSKDSATRKDRGMFWWDRFMSFKSDTRSE  522



>gb|AAD14479.1| Strong similarity to gi|3337350 F13P17.3 putative permease from 
Arabidopsis thaliana BAC gb|AC004481 [Arabidopsis thaliana]
Length=543

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  M  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  494  LDVTMSSKDSATRKDRGMFWWDRFMSFKSDTRSE  527



>ref|XP_006857136.1| hypothetical protein AMTR_s00065p00152120 [Amborella trichopoda]
 gb|ERN18603.1| hypothetical protein AMTR_s00065p00152120 [Amborella trichopoda]
Length=535

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  M   E  +R+DRG HWW+KF SFKTD+ SE
Sbjct  486  LDCTMRFGESSLRRDRGWHWWEKFHSFKTDSRSE  519



>gb|ADE76021.1| unknown [Picea sitchensis]
Length=55

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H  E   RKDRG HWWD+FRSFK D  SE
Sbjct  6    LDSTLHLGEAATRKDRGWHWWDRFRSFKNDPRSE  39



>ref|XP_010691555.1| PREDICTED: nucleobase-ascorbate transporter 4 [Beta vulgaris 
subsp. vulgaris]
Length=527

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +H+     RKD G+HWW KFRS+  DT SE
Sbjct  478  LDITLHRSHSATRKDSGRHWWKKFRSYDADTRSE  511



>ref|XP_010474016.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Camelina 
sativa]
Length=189

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  140  LDVTLSFKDSATRKDRGMFWWDRFMSFKSDTRSE  173



>gb|AFW67127.1| hypothetical protein ZEAMMB73_289331 [Zea mays]
Length=232

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +++  VRKDRG H+WD+FRSFKTD  SE
Sbjct  183  LDNTLQRRDGAVRKDRGHHFWDRFRSFKTDPRSE  216



>ref|NP_001051745.1| Os03g0823800 [Oryza sativa Japonica Group]
 gb|AAO18455.1| putative permease [Oryza sativa Japonica Group]
 gb|ABF99619.1| Permease I, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13659.1| Os03g0823800 [Oryza sativa Japonica Group]
Length=529

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + +   RKDRG H+WD+FRSF+TD  SE
Sbjct  480  LDNTLQRHDSTARKDRGHHFWDRFRSFRTDPRSE  513



>gb|EAY92392.1| hypothetical protein OsI_14125 [Oryza sativa Indica Group]
Length=549

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + +   RKDRG H+WD+FRSF+TD  SE
Sbjct  500  LDNTLQRHDSTARKDRGHHFWDRFRSFRTDPRSE  533



>gb|EAZ29114.1| hypothetical protein OsJ_13173 [Oryza sativa Japonica Group]
Length=596

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + +   RKDRG H+WD+FRSF+TD  SE
Sbjct  547  LDNTLQRHDSTARKDRGHHFWDRFRSFRTDPRSE  580



>ref|XP_009386652.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386653.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=537

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  M   E   RKDRG H+WDKFR+FK D  SE
Sbjct  488  LDNTMQLHESSTRKDRGYHFWDKFRTFKKDPRSE  521



>ref|XP_002886639.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62898.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=537

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  488  LDVTLSSKDSATRKDRGMFWWDRFMSFKSDTRSE  521



>ref|XP_008810107.1| PREDICTED: nucleobase-ascorbate transporter LPE1-like [Phoenix 
dactylifera]
Length=535

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + E   R+DRG HWW+KFRS++TD  SE
Sbjct  486  LDFTLLRGEASTRRDRGWHWWEKFRSYRTDPRSE  519



>gb|EPS61022.1| nucleobase ascorbate transporter, partial [Genlisea aurea]
Length=231

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG H+WDK++S+KTD+ SE
Sbjct  182  LDTTLPPKDTATRKDRGLHFWDKYKSYKTDSRSE  215



>ref|XP_003555298.1| PREDICTED: nucleobase-ascorbate transporter 4-like [Glycine max]
 gb|KHN42302.1| Nucleobase-ascorbate transporter 4 [Glycine soja]
Length=530

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  M + E   R+D G+HWW+KFR+F  DT +E
Sbjct  481  LDLTMSRGEGSTRRDSGRHWWEKFRTFNQDTRTE  514



>ref|XP_009103320.1| PREDICTED: nucleobase-ascorbate transporter 7 [Brassica rapa]
Length=537

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  488  LDVTLSSKDSATRKDRGVFWWDRFMSFKSDTRSE  521



>emb|CDY24508.1| BnaA01g22120D [Brassica napus]
Length=537

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  488  LDVTLSSKDSATRKDRGVFWWDRFMSFKSDTRSE  521



>emb|CDP00202.1| unnamed protein product [Coffea canephora]
Length=535

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  DXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            D  +HKK     +DRG  WWD+FRS+K+DT SE
Sbjct  487  DVTLHKKGSATSRDRGLPWWDRFRSYKSDTRSE  519



>ref|XP_006300441.1| hypothetical protein CARUB_v10020111mg [Capsella rubella]
 gb|EOA33339.1| hypothetical protein CARUB_v10020111mg [Capsella rubella]
Length=537

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  488  LDVTLSSKDSATRKDRGMVWWDRFMSFKSDTRSE  521



>ref|XP_010470160.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Camelina sativa]
Length=464

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  415  LDVTLSFKDSATRKDRGMFWWDRFMSFKSDTRSE  448



>ref|XP_010510979.1| PREDICTED: nucleobase-ascorbate transporter 7 [Camelina sativa]
Length=537

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  488  LDVTLSCKDSATRKDRGMFWWDRFMSFKSDTRSE  521



>ref|XP_010470161.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Camelina sativa]
Length=539

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+DT SE
Sbjct  490  LDVTLSFKDSATRKDRGMFWWDRFMSFKSDTRSE  523



>ref|XP_006392193.1| hypothetical protein EUTSA_v10023405mg [Eutrema salsugineum]
 gb|ESQ29479.1| hypothetical protein EUTSA_v10023405mg [Eutrema salsugineum]
Length=537

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RKDRG  WWD+F SFK+D+ SE
Sbjct  488  LDVTLTSKDSATRKDRGMFWWDRFMSFKSDSRSE  521



>ref|XP_002265128.1| PREDICTED: nucleobase-ascorbate transporter 4 [Vitis vinifera]
 emb|CBI22436.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +     R D G+HWW KFRSF TDT SE
Sbjct  480  LDCTLDRAHSSTRADSGRHWWGKFRSFHTDTRSE  513



>emb|CAN81484.1| hypothetical protein VITISV_015553 [Vitis vinifera]
Length=557

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + +     R D G+HWW KFRSF TDT SE
Sbjct  508  LDCTLDRAHSSTRADSGRHWWGKFRSFHTDTRSE  541



>ref|XP_010418834.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Camelina 
sativa]
Length=487

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  +  K+   RK+RG  WWD+F SFK+DT SE
Sbjct  438  LDVTLSSKDSATRKNRGMFWWDRFMSFKSDTRSE  471



>ref|XP_004982109.1| PREDICTED: nucleobase-ascorbate transporter LPE1-like [Setaria 
italica]
Length=527

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  82   EXQVRKDRGKHWWDKFRSFKTDTXSE  5
            E  VRKDRG HWW+KF+S+K D+ SE
Sbjct  486  EASVRKDRGWHWWEKFKSYKQDSRSE  511



>gb|KJB47303.1| hypothetical protein B456_008G019900 [Gossypium raimondii]
Length=529

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD         VR+D G+HWW+KFR+F TDT SE
Sbjct  480  LDCTHSYGHSSVRRDSGRHWWEKFRNFNTDTRSE  513



>gb|KHG02370.1| Nucleobase-ascorbate transporter 4 -like protein [Gossypium arboreum]
Length=529

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD         VR+D G+HWW+KFR+F TDT SE
Sbjct  480  LDCTHSYGHSSVRRDSGRHWWEKFRNFNTDTRSE  513



>ref|XP_010273039.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X4 
[Nelumbo nucifera]
Length=468

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + +  V +D G HWW+KFR+FKTD+ SE
Sbjct  419  LDCTLGRGDSTVVRDSGSHWWEKFRNFKTDSRSE  452



>ref|XP_010273036.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X3 
[Nelumbo nucifera]
Length=507

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + +  V +D G HWW+KFR+FKTD+ SE
Sbjct  458  LDCTLGRGDSTVVRDSGSHWWEKFRNFKTDSRSE  491



>ref|XP_010273034.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Nelumbo nucifera]
Length=513

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + +  V +D G HWW+KFR+FKTD+ SE
Sbjct  464  LDCTLGRGDSTVVRDSGSHWWEKFRNFKTDSRSE  497



>ref|XP_010273019.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010273028.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Nelumbo nucifera]
Length=533

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  106  LDXXMHKKEXQVRKDRGKHWWDKFRSFKTDTXSE  5
            LD  + + +  V +D G HWW+KFR+FKTD+ SE
Sbjct  484  LDCTLGRGDSTVVRDSGSHWWEKFRNFKTDSRSE  517



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 572405144870